Advanced Search (OLGA)

Gene: Nr2c1 (nuclear receptor subfamily 2, group C, member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Nr2c1

Name:

nuclear receptor subfamily 2, group C, member 1

RGD ID:

3200

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; histone deacetylase binding activity; and protein homodimerization activity. Predicted to be involved in cell differentiation; negative regulation of transcription by RNA polymerase II; and positive regulation of retinoic acid receptor signaling pathway. Predicted to be located in PML body. Orthologous to human NR2C1 (nuclear receptor subfamily 2 group C member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

nuclear receptor subfamily 2 group C member 1; nuclear receptor subfamily 2, group H, member 1; orphan nuclear receptor TR2; orphan receptor; orphan receptor, TR2-11; pregnancy specific beta-1-glycoprotein 4; Psg4; testicular receptor 2; Tr2; TR2-11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	30,602,338 - 30,655,610 (+)	NCBI		GRCr8
mRatBN7.2	7	28,715,347 - 28,768,624 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	28,715,562 - 28,767,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	30,713,646 - 30,765,220 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	32,875,895 - 32,927,468 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	32,646,428 - 32,698,239 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	35,069,807 - 35,122,810 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	35,069,814 - 35,122,796 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	35,137,598 - 35,189,641 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	31,293,180 - 31,345,189 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	31,313,973 - 31,365,460 (+)	NCBI
Celera	7	25,816,321 - 25,858,083 (+)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	Contracture		ISO	NR2C1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Contractures	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	endometriosis		ISO	NR2C1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22138541

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NR2C1 mRNA	CTD	PMID:36331819
Nr2c1	Rat	1,2-dichloroethane	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of NR2C1 mRNA	CTD	PMID:28960355
Nr2c1	Rat	1,2-dimethylhydrazine	affects expression	ISO	Nr2c1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of NR2C1 mRNA	CTD	PMID:22206623
Nr2c1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Nr2c1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of NR2C1 mRNA	CTD	PMID:17555576
Nr2c1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Nr2c1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of NR2C1 mRNA	CTD	PMID:21570461 and PMID:24058054
Nr2c1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of NR2C1 mRNA	CTD	PMID:33387578
Nr2c1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of NR2C1 mRNA	CTD	PMID:18796159 more ...
Nr2c1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of NR2C1 mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of NR2C1 mRNA	CTD	PMID:16214954 and PMID:25975270
Nr2c1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	bisphenol S results in increased expression of NR2C1 mRNA	CTD	PMID:39298647
Nr2c1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of NR2C1 mRNA	CTD	PMID:30047161
Nr2c1	Rat	acrylamide	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of NR2C1 mRNA	CTD	PMID:32763439
Nr2c1	Rat	Aflatoxin B2 alpha	decreases methylation	ISO	NR2C1 (Homo sapiens)	6480464	aflatoxin B2 results in decreased methylation of NR2C1 intron	CTD	PMID:30157460
Nr2c1	Rat	all-trans-retinoic acid	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	NR2C1 protein affects the reaction [Tretinoin results in increased expression of MYC protein] more ...	CTD	PMID:17389641
Nr2c1	Rat	all-trans-retinoic acid	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of NR2C1 mRNA	CTD	PMID:33167477
Nr2c1	Rat	all-trans-retinoic acid	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	Tretinoin results in increased expression of NR2C1 mRNA and Tretinoin results in increased expression of NR2C1 protein	CTD	PMID:17389641
Nr2c1	Rat	all-trans-retinoic acid	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	Tretinoin results in decreased expression of NR2C1 mRNA and Tretinoin results in decreased expression of NR2C1 protein	CTD	PMID:17389641
Nr2c1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of NR2C1 mRNA	CTD	PMID:30047161
Nr2c1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of NR2C1 mRNA	CTD	PMID:16483693
Nr2c1	Rat	aristolochic acid A	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of NR2C1 mRNA	CTD	PMID:33212167
Nr2c1	Rat	arsane	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	arsenic atom	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	benzo[a]pyrene	affects methylation	ISO	NR2C1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NR2C1 intron and Benzo(a)pyrene affects the methylation of NR2C1 promoter	CTD	PMID:27901495 and PMID:30157460
Nr2c1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Nr2c1	Rat	benzo[e]pyrene	decreases methylation	ISO	NR2C1 (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of NR2C1 intron	CTD	PMID:30157460
Nr2c1	Rat	beta-hexachlorocyclohexane	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	beta-hexachlorocyclohexane results in increased expression of NR2C1 mRNA	CTD	PMID:25270620
Nr2c1	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	Mustard Gas results in increased expression of NR2C1 mRNA	CTD	PMID:15674843
Nr2c1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NR2C1 mRNA	CTD	PMID:25181051
Nr2c1	Rat	bisphenol A	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	bisphenol A results in decreased expression of NR2C1 mRNA	CTD	PMID:33670352
Nr2c1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NR2C1 mRNA	CTD	PMID:34947998
Nr2c1	Rat	cadmium sulfate	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	cadmium sulfate results in decreased expression of NR2C1 mRNA	CTD	PMID:19274763
Nr2c1	Rat	carbon nanotube	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of NR2C1 mRNA	CTD	PMID:25554681
Nr2c1	Rat	chlorpyrifos	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of NR2C1 mRNA	CTD	PMID:37019170
Nr2c1	Rat	choline	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NR2C1 mRNA	CTD	PMID:20938992
Nr2c1	Rat	clofibrate	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	Clofibrate results in decreased expression of NR2C1 mRNA	CTD	PMID:17585979
Nr2c1	Rat	coumestrol	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Coumestrol results in decreased expression of NR2C1 mRNA	CTD	PMID:19167446
Nr2c1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of NR2C1 mRNA	CTD	PMID:23640034
Nr2c1	Rat	dexamethasone	decreases expression	EXP		6480464	Dexamethasone results in decreased expression of NR2C1 mRNA	CTD	PMID:21804312
Nr2c1	Rat	Dibutyl phosphate	affects expression	ISO	NR2C1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of NR2C1 mRNA	CTD	PMID:37042841
Nr2c1	Rat	dicrotophos	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of NR2C1 mRNA	CTD	PMID:28302478
Nr2c1	Rat	dorsomorphin	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Nr2c1	Rat	doxorubicin	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of NR2C1 mRNA	CTD	PMID:29803840
Nr2c1	Rat	elemental selenium	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Selenium results in decreased expression of NR2C1 mRNA	CTD	PMID:19244175
Nr2c1	Rat	entinostat	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	entinostat results in decreased expression of NR2C1 mRNA	CTD	PMID:26272509
Nr2c1	Rat	entinostat	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NR2C1 mRNA	CTD	PMID:27188386
Nr2c1	Rat	folic acid	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NR2C1 mRNA	CTD	PMID:20938992
Nr2c1	Rat	FR900359	increases phosphorylation	ISO	NR2C1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of NR2C1 protein	CTD	PMID:37730182
Nr2c1	Rat	fulvestrant	increases methylation	ISO	NR2C1 (Homo sapiens)	6480464	Fulvestrant results in increased methylation of NR2C1 gene	CTD	PMID:31601247
Nr2c1	Rat	inulin	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NR2C1 mRNA	CTD	PMID:36331819
Nr2c1	Rat	L-methionine	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of NR2C1 mRNA	CTD	PMID:20938992
Nr2c1	Rat	manganese atom	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	manganese(0)	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	manganese(II) chloride	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	methapyrilene	decreases methylation	ISO	NR2C1 (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of NR2C1 intron	CTD	PMID:30157460
Nr2c1	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of NR2C1 mRNA	CTD	PMID:30467583
Nr2c1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of NR2C1 mRNA	CTD	PMID:30047161
Nr2c1	Rat	methyl methanesulfonate	increases expression	ISO	NR2C1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of NR2C1 mRNA	CTD	PMID:23649840
Nr2c1	Rat	methylmercury chloride	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of NR2C1 mRNA	CTD	PMID:28001369
Nr2c1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NR2C1 mRNA	CTD	PMID:25729387
Nr2c1	Rat	paracetamol	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of NR2C1 mRNA	CTD	PMID:21420995 and PMID:29067470
Nr2c1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of NR2C1 mRNA	CTD	PMID:33387578
Nr2c1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NR2C1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NR2C1 mRNA	CTD	PMID:36331819
Nr2c1	Rat	phenylmercury acetate	increases expression	ISO	NR2C1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in increased expression of NR2C1 mRNA	CTD	PMID:26272509
Nr2c1	Rat	phenylmercury acetate	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NR2C1 mRNA	CTD	PMID:27188386
Nr2c1	Rat	pirinixic acid	multiple interactions	ISO	Nr2c1 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of NR2C1 mRNA and PPARA protein promotes the reaction [pirinixic acid results in increased expression of NR2C1 mRNA]	CTD	PMID:19710929 and PMID:20059764
Nr2c1	Rat	pirinixic acid	increases expression	ISO	Nr2c1 (Mus musculus)	6480464	pirinixic acid results in increased expression of NR2C1 mRNA	CTD	PMID:17426115 more ...
Nr2c1	Rat	potassium dichromate	decreases expression	ISO	Nr2c1 (Mus musculus)	6480464	Potassium Dichromate results in decreased expression of NR2C1 mRNA	CTD	PMID:23608068
Nr2c1	Rat	SB 431542	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Nr2c1	Rat	selenium atom	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Selenium results in decreased expression of NR2C1 mRNA	CTD	PMID:19244175
Nr2c1	Rat	sodium arsenite	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NR2C1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NR2C1 mRNA	CTD	PMID:39836092
Nr2c1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of NR2C1 mRNA	CTD	PMID:30047161
Nr2c1	Rat	sunitinib	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Sunitinib results in decreased expression of NR2C1 mRNA	CTD	PMID:31533062
Nr2c1	Rat	tamoxifen	affects expression	ISO	Nr2c1 (Mus musculus)	6480464	Tamoxifen affects the expression of NR2C1 mRNA	CTD	PMID:17555576
Nr2c1	Rat	temozolomide	increases expression	ISO	NR2C1 (Homo sapiens)	6480464	Temozolomide results in increased expression of NR2C1 mRNA	CTD	PMID:31758290
Nr2c1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of NR2C1 mRNA	CTD	PMID:23411599
Nr2c1	Rat	titanium dioxide	increases methylation	ISO	Nr2c1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of NR2C1 promoter	CTD	PMID:35295148
Nr2c1	Rat	titanium dioxide	decreases methylation	ISO	Nr2c1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NR2C1 promoter	CTD	PMID:35295148
Nr2c1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NR2C1 mRNA	CTD	PMID:25729387
Nr2c1	Rat	trichostatin A	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	trichostatin A results in decreased expression of NR2C1 mRNA	CTD	PMID:26272509
Nr2c1	Rat	trichostatin A	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NR2C1 mRNA	CTD	PMID:27188386
Nr2c1	Rat	triphenyl phosphate	affects expression	ISO	NR2C1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of NR2C1 mRNA	CTD	PMID:37042841
Nr2c1	Rat	valproic acid	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of NR2C1 mRNA	CTD	PMID:23179753 and PMID:28001369
Nr2c1	Rat	valproic acid	increases expression	ISO	NR2C1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of NR2C1 mRNA	CTD	PMID:28001369
Nr2c1	Rat	valproic acid	multiple interactions	ISO	NR2C1 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NR2C1 mRNA	CTD	PMID:27188386
Nr2c1	Rat	valproic acid	affects expression	ISO	NR2C1 (Homo sapiens)	6480464	Valproic Acid affects the expression of NR2C1 mRNA	CTD	PMID:25979313
Nr2c1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of NR2C1 mRNA	CTD	PMID:23034163
Nr2c1	Rat	vitamin E	decreases expression	ISO	NR2C1 (Homo sapiens)	6480464	Vitamin E results in decreased expression of NR2C1 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	cell differentiation	involved_in	IBA	FB:FBgn0003651 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nr2c1	Rat	intracellular receptor signaling pathway	involved_in	IEA	GO:0004879	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Nr2c1	Rat	negative regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	negative regulation of DNA-templated transcription	involved_in	ISO	Nr2c1 (Mus musculus)	1624291	PMID:8858600 more ...	RGD	PMID:8858600 more ...
Nr2c1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	NR2C1 (Homo sapiens)	1624291	UniProtKB:P49116 and PMID:17974920	RGD	PMID:17974920
Nr2c1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P13056 and ensembl:ENSP00000333275	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	Nr2c1 (Mus musculus)	1624291	PMID:8858600 more ...	RGD	PMID:8858600 more ...
Nr2c1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	positive regulation of retinoic acid receptor signaling pathway	involved_in	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	positive regulation of retinoic acid receptor signaling pathway	involved_in	ISO	Nr2c1 (Mus musculus)	1624291	PMID:16130175	RGD	PMID:16130175
Nr2c1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR001628 and InterPro:IPR013088	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nr2c1	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0003720 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Nr2c1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nr2c1	Rat	nucleus	located_in	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	nucleus	located_in	ISO	Nr2c1 (Mus musculus)	1624291	PMID:9795341	RGD	PMID:9795341
Nr2c1	Rat	PML body	located_in	ISO	Nr2c1 (Mus musculus)	1624291	PMID:18682553	RGD	PMID:18682553
Nr2c1	Rat	PML body	located_in	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	PML body	located_in	IEA	UniProtKB-SubCell:SL-0465	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nr2c1	Rat	DNA binding	enables	ISO	Nr2c1 (Mus musculus)	1624291	PMID:9071982 more ...	RGD	PMID:9071982 more ...
Nr2c1	Rat	DNA binding	enables	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nr2c1	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR001628	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nr2c1	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	Nr2c1 (Mus musculus)	1624291	PMID:9369481	RGD	PMID:9369481
Nr2c1	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	histone deacetylase binding	enables	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	histone deacetylase binding	enables	ISO	Nr2c1 (Mus musculus)	1624291	UniProtKB:P56524 and PMID:11463856	RGD	PMID:11463856
Nr2c1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nr2c1	Rat	nuclear receptor activity	enables	IBA	FB:FBgn0015239 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nr2c1	Rat	protein binding	enables	ISO	Nr2c1 (Mus musculus)	1624291	PR:Q8CBD1 more ...	RGD	PMID:17187077 more ...
Nr2c1	Rat	protein binding	enables	ISO	NR2C1 (Homo sapiens)	1624291	UniProtKB:P03372 more ...	RGD	PMID:12093804 and PMID:17974920
Nr2c1	Rat	protein binding	enables	ISO	NR2C1 (Homo sapiens) and UniProtKB:P13056-2	1624291	UniProtKB:P10276 and PMID:32296183	RGD	PMID:32296183
Nr2c1	Rat	protein homodimerization activity	enables	ISO	Nr2c1 (Mus musculus)	1624291	UniProtKB:Q505F1 and PMID:9369481	RGD	PMID:9369481
Nr2c1	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	Nr2c1 (Mus musculus)	1624291	PMID:9369481	RGD	PMID:9369481
Nr2c1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:109128 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nr2c1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q505F1 and ensembl:ENSMUSP00000100927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	sequence-specific DNA binding	enables	IEA	InterPro:IPR001628	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Nr2c1	Rat	sequence-specific double-stranded DNA binding	enables	ISO	NR2C1 (Homo sapiens)	1624291	PMID:28473536	RGD	PMID:28473536
Nr2c1	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:P13056 and ensembl:ENSP00000333275	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Nr2c1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nr2c1	Rat	zinc ion binding	enables	IEA	InterPro:IPR001628 and InterPro:IPR013088	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Mouse Genome Database (MGD)	Mouse Genome Database (MGD)
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7794280	PMID:8858600	PMID:9071982	PMID:9369481	PMID:9774688	PMID:9795341	PMID:11463856	PMID:12477932	PMID:16130175	PMID:17974920	PMID:18682553

Nr2c1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	30,602,338 - 30,655,610 (+)	NCBI		GRCr8
mRatBN7.2	7	28,715,347 - 28,768,624 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	28,715,562 - 28,767,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	30,713,646 - 30,765,220 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	32,875,895 - 32,927,468 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	32,646,428 - 32,698,239 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	35,069,807 - 35,122,810 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	35,069,814 - 35,122,796 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	35,137,598 - 35,189,641 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	31,293,180 - 31,345,189 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	31,313,973 - 31,365,460 (+)	NCBI
Celera	7	25,816,321 - 25,858,083 (+)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

NR2C1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	95,020,229 - 95,073,618 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	95,020,229 - 95,073,628 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	95,414,005 - 95,467,394 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	93,939,802 - 93,991,487 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	93,918,138 - 93,969,676	NCBI
Celera	12	95,085,340 - 95,138,686 (-)	NCBI		Celera
Cytogenetic Map	12	q22	NCBI
HuRef	12	92,481,137 - 92,534,428 (-)	NCBI		HuRef
CHM1_1	12	95,378,558 - 95,432,374 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	95,000,934 - 95,054,323 (-)	NCBI		T2T-CHM13v2.0

Nr2c1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	93,983,491 - 94,033,078 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	93,983,885 - 94,033,073 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	94,147,542 - 94,197,216 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	94,148,023 - 94,197,211 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	93,610,676 - 93,659,959 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	93,586,085 - 93,625,150 (+)	NCBI		MGSCv36	mm8
Celera	10	96,123,279 - 96,172,755 (+)	NCBI		Celera
Cytogenetic Map	10	C2	NCBI
cM Map	10	48.81	NCBI

Nr2c1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	31,635,113 - 31,691,465 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	31,637,832 - 31,693,621 (-)	NCBI	ChiLan1.0	ChiLan1.0

NR2C1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	103,094,441 - 103,146,827 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	103,090,832 - 103,144,945 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	92,611,459 - 92,664,405 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	96,007,293 - 96,060,878 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	96,007,293 - 96,060,878 (-)	Ensembl	panpan1.1		panPan2

NR2C1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	35,003,658 - 35,049,812 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	35,005,066 - 35,038,968 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	35,390,524 - 35,436,592 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	35,668,122 - 35,714,259 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	35,668,136 - 35,714,227 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	34,941,455 - 34,987,561 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	35,036,660 - 35,082,732 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	35,299,269 - 35,345,360 (-)	NCBI		UU_Cfam_GSD_1.0

Nr2c1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	24,915,800 - 24,968,872 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936507	11,264,737 - 11,319,642 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936507	11,266,408 - 11,319,642 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NR2C1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	88,231,274 - 88,277,997 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	88,231,180 - 88,278,803 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	92,480,138 - 92,527,231 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NR2C1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	90,430,307 - 90,481,269 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	90,430,194 - 90,481,493 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	154,685,782 - 154,738,815 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nr2c1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	11,981,783 - 12,023,282 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	11,972,826 - 12,022,603 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Nr2c1
331 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	21
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000009578
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	20555705	29891047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	15795565	38073970	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
61369	Mcs2	Mammary carcinoma susceptibility QTL 2	3.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	19032807	35526300	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_145780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005486547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ515798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L26398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009578 ⟹ ENSRNOP00000009578

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	28,716,093 - 28,767,160 (+)	Ensembl
Rnor_6.0 Ensembl	7	35,070,284 - 35,121,346 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089228 ⟹ ENSRNOP00000071901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	28,715,562 - 28,767,071 (+)	Ensembl
Rnor_6.0 Ensembl	7	35,069,814 - 35,122,796 (+)	Ensembl

RefSeq Acc Id:

NM_145780 ⟹ NP_665723

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	30,602,607 - 30,654,148 (+)	NCBI
mRatBN7.2	7	28,715,616 - 28,767,162 (+)	NCBI
Rnor_6.0	7	35,069,807 - 35,121,348 (+)	NCBI
Rnor_5.0	7	35,137,598 - 35,189,641 (+)	NCBI
RGSC_v3.4	7	31,293,180 - 31,345,189 (+)	RGD
Celera	7	25,816,321 - 25,858,083 (+)	RGD

Sequence:

show sequence

GAATTCGGGGCAGGCGCCAAGAGCACCGCGCACCGCCAAGCCGAGGGTGGGGTCACGAACTCTGACCCCCACCCCCAAATACACAAACCCAGAAAGCTCTCCTGTCCCCTTGGCCTCGGGTCCCCTCG
CCTCTGCTCTCTCCAGCCCAGCGGCCGCCACGGCGGGAGGGATATTTTGACAATTAGATCATGGCGACCATAGAAGAAATTGCACATCAGATTATTGACCAACAGATGGGTGAGATTGTTACAGAGCA
GCAGACTGGACAGAAAATCCAGATCGTGACAGCACTTGACCACAGCACACAGGGCAAGCAGTTCATTCTAGCAAACCATGAGGGATCCACCCCAGGGAAAGTCTTCCTCACGACACCAGATGCTGCAG
GTGTCAACCAGTTGTTTTTTGCCAGTCCTGATCTGTCCACACCACACCTCCAGCTCTTAACAGAAAATTCTCCTGACCAGGGACCAAATAAGGTCTTTGACCTTTGCGTTGTGTGTGGAGACAAAGCA
TCAGGCCGCCATTACGGAGCAATAACTTGTGAGGGCTGCAAAGGGTTTTTTAAAAGAAGCATCCGGAAGAATCTAGTGTACTCGTGCCGGGGGTCCAAAGACTGCATCATTAACAAGCACCACCGGAA
CCGCTGCCAATACTGCCGGCTGCAGCGGTGCATAGCCTTCGGGATGAAGCAAGACTCCGTTCAGTGTGAAAGAAAGCCCATTGAAGTGTCCCGAGAAAAGTCTTCCAACTGTGCAGCTTCTACAGAGA
AAATCTACATCCGCAAAGACCTCCGAAGCCCTCTGGCTGCAACGCCAACCTTTGTAACGGACAGCGAGACTGCCAGGTCAACTGGACTGTTGGATTCGGGGATGTTTGTGAATATTCATCCATCTGGA
ATAAAGACAGAACCAGCTCTGCTAATGACACCAGATAAGGCTGAGTCCTGTCAGGGAGACTTGGGCACATTGGCCAGTGTGGTCACGTCATTAGCGAATCTCGGCAAGGCTAAAGACCTTTCTCACTG
TGGTGGCGATCTGCCTGTGGTGCAGAGCTTGCGCAATGGAGATACATCCTTTGGTGCATTTCATCAGGATATCCAGACCAATGGTGATGTGTCAAGGGCATTTGACAATCTTGCAAAAGCATTGACTC
CCGGAGAAAACCCAGCCTGCCAGAGCCCAGGAGAGAGCATGGAAGGAAGCACACATCTAATCGCTGGAGAGCCAAGCTGCATGGAGAGAGAGGGGCCACTGCTCAGCGATTCGCATGTCGTTTTCAGG
CTCACCATGCCTTCTCCTATGCCCGAGTACCTGAATGTGCACTACATTGGGGAGTCGGCCTCCAGACTGCTGTTCTTATCGATGCACTGGGCGCTTTCCATACCTTCTTTCCAGGCGCTCGGGCAAGA
AAACAGCATATCACTGGTAAAAGCCTATTGGAATGAACTCTTTACCCTCGGTCTCGCCCAGTGCTGGCAAGTGATGAACGTCGCAACTATATTAGCAACGTTTGTCAACTGTCTTCACAATAGCCTTC
AGCAAGATAAAATGTCCCCGGAGAGGAGGAAGTTGTTGATGGAGCACATCTTCAAGCTGCAGGAGTTCTGTAATAGCATGGTGAAGCTCTGCATAGACGGGCATGAGTACGCCTACCTCAAGGCCATC
GTTCTCTTCAGTCCCGACCATCCAGGCCTGGAGAACATGGAGCTGATTGAGAAATTTCAGGAAAAGGCCTATGTGGAATTCCAAGATTACATCACCAGGACATATCCAGATGACACCTACAGGCTGTC
TAGATTACTTCTCAGACTGCCGGCCTTGCGGCTGATGAATGCCACCATCACTGAGGAATTGTTCTTCAAAGGTCTCATTGGCAACGTACGGATCGACAGTGTCATCCCACACATTTTAAAAATGGAGC
CTGCAGATTACAACTCTCAAATAATTGGTCACAGCCTTTGAAAGTGGAGGTCACCCTGCTCCAGGCTAAGTTTACCGTTCCTTCTCGGAACACATGAAACCAAATCGAACTGTTTCTTCCAGGGCATC
TGCGAATATTAACTTTAAGAGTAACCAAAATCAAAAGTATTTTTCTTTTGGATTCCTTAAGAAGAATTTAAGTGACCAGGCAGGGGTCAGGAATTATACTACCCTGTCTGTCCTATAGGAATGAATCA
ACAATGGTACGGGGCTGTTCTTGGGGAGGATGACACTTAAGACTCTCTCCTCCTGACTGTCTACACTAAGCTTTCTCATTCTATTTTATAAAACAAATAAACTAGTCTTTCCCCCCTG

hide sequence

RefSeq Acc Id:

XM_017594671 ⟹ XP_017450160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	30,602,794 - 30,655,610 (+)	NCBI
mRatBN7.2	7	28,715,802 - 28,768,624 (+)	NCBI
Rnor_6.0	7	35,069,973 - 35,122,810 (+)	NCBI

Sequence:

show sequence

CGGGTGCTGGGCGGCCCAACCGCCAAGCGTCGTGGCCCGAGCGCCCGTGTCCCCAAGTGTCCCAGCTCCCGGTTACCCGAGTGCCGGGTGGTAGCGGACAGCTCAATGCCGCGGGAGGCCGGGCGGGG
ACGGTGACCTTTCACCCACAGGGAACGCTTCCGTATCGGCGCCGCTTCCCCCGCCCCGGGGCTGCGCGCGTGTACTCAGGAGGCTAAAGCAGCAAAGGTCACCTGGAGTTCTTGGCGAGACTGGCTTG
GAAACCATGTATCCAAACCCCAGAAGACGTATGGAAGATAAAGGAAAGATATTTTGACAATTAGATCATGGCGACCATAGAAGAAATTGCACATCAGATTATTGACCAACAGATGGGTGAGATTGTTA
CAGAGCAGCAGACTGGACAGAAAATCCAGATCGTGACAGCACTTGACCACAGCACACAGGGCAAGCAGTTCATTCTAGCAAACCATGAGGGATCCACCCCAGGGAAAGTCTTCCTCACGACACCAGAT
GCTGCAGGTGTCAACCAGTTGTTTTTTGCCAGTCCTGATCTGTCCACACCACACCTCCAGCTCTTAACAGAAAATTCTCCTGACCAGGGACCAAATAAGGTCTTTGACCTTTGCGTTGTGTGTGGAGA
CAAAGCATCAGGCCGCCATTACGGAGCAATAACTTGTGAGGGCTGCAAAGGGTTTTTTAAAAGAAGCATCCGGAAGAATCTAGTGTACTCGTGCCGGGGGTCCAAAGACTGCATCATTAACAAGCACC
ACCGGAACCGCTGCCAATACTGCCGGCTGCAGCGGTGCATAGCCTTCGGGATGAAGCAAGACTCCGTTCAGTGTGAAAGAAAGCCCATTGAAGTGTCCCGAGAAAAGTCTTCCAACTGTGCAGCTTCT
ACAGAGAAAATCTACATCCGCAAAGACCTCCGAAGCCCTCTGGCTGCAACGCCAACCTTTGTAACGGACAGCGAGACTGCCAGGTCAACTGGACTGTTGGATTCGGGGATGTTTGTGAATATTCATCC
ATCTGGAATAAAGACAGAACCAGCTCTGCTAATGACACCAGATAAGGCTGAGTCCTGTCAGGGAGACTTGGGCACATTGGCCAGTGTGGTCACGTCATTAGCGAATCTCGGCAAGGCTAAAGACCTTT
CTCACTGTGGTGGCGATCTGCCTGTGGTGCAGAGCTTGCGCAATGGAGATACATCCTTTGGTGCATTTCATCAGGATATCCAGACCAATGGTGATGTGTCAAGGGCATTTGACAATCTTGCAAAAGCA
TTGACTCCCGGAGAAAACCCAGCCTGCCAGAGCCCAGGAGAGAGCATGGAAGGAAGCACACATCTAATCGCTGGAGAGCCAAGCTGCATGGAGAGAGAGGGGCCACTGCTCAGCGATTCGCATGTCGT
TTTCAGGCTCACCATGCCTTCTCCTATGCCCGAGTACCTGAATGTGCACTACATTGGGGAGTCGGCCTCCAGACTGCTGTTCTTATCGATGCACTGGGCGCTTTCCATACCTTCTTTCCAGGCGCTCG
GGCAAGAAAACAGCATATCACTGGTAAAAGCCTATTGGAATGAACTCTTTACCCTCGGTCTCGCCCAGTGCTGGCAAGTGATGAACGTCGCAACTATATTAGCAACGTTTGTCAACTGTCTTCACAAT
AGCCTTCAGCAAGATAAAATGTCCCCGGAGAGGAGGAAGTTGTTGATGGAGCACATCTTCAAGCTGCAGGAGTTCTGTAATAGCATGGTGAAGCTCTGCATAGACGGGCATGAGTACGCCTACCTCAA
GGCCATCGTTCTCTTCAGTCCCGACCATCCAGGCCTGGAGAACATGGAGCTGATTGAGAAATTTCAGGAAAAGGCTTATGTGGAATTCCAAGATTACATCACCAGGACATATCCAGATGACACCTACA
GGCTGTCTAGATTACTTCTCAGACTGCCGGCCTTGCGGCTGATGAATGCCACCATCACTGAGGAATTGTTCTTCAAAGGTCTCATTGGCAACGTACGGATCGACAGTGTCATCCCACACATTTTAAAA
ATGGAGCCTGCAGATTACAACTCTCAAATAATTGGTCACAGCCTTTGAAAGTGGAGGTCACCCTGCTCCAGGCTAAGTTTACCGTTCCTTCTCGGAACACATGAAACCAAATCGAACTGTTTCTTCCA
GGGCATCTGCGAATATTAACTTTAAGAGTAACCAAAATCAAAAGTATTTTTCTTTTGGATTCCTTAAGAAGAATTTAAGTGACCAGGCAGGGGTCAGGAATTATACTACCCTGTCTGTCCTATAGGAA
TGAATCAACAATGGTACGGGGCTGTTCTTGGGGAGGATGACACTTAAGACTCTCTCCTCCTGACTGTCTACACTAAGCTTTCTCATTCTATTTTATAAAACAAATAAACTAGTCTTTCCCCCCTGAAT
TGTGTTTTTTTCCTGTTTAATGCCACTGGGCCTGTATACTGTAACAATGAGATACCTAAGCAGAAACTTCTTACGTCTGACTCATCCATGGTTATCTTAGTTACCAGGCCAAAAGGTTATTTTATGCT
CAATGATGTAATGATAATGCCAGAGCTATAGGAAATAAATATATATATGCTTTTATACACATCAAGGTGCCCGTTAGCATATAACACTCGTTGCTGGCAATGAGACATGAGCCATTTGTATTTTTTTT
AGTGTAGTAGATTATTAGTTACAAGCACTTTTATTCGTTGTGGTAGAAAATTACTCTTGAGAATAGGATGAGGATCCTGTTTTAAAATTTGGGATTTACTGTGTTTTAAACATAGTAGAGACGCCCCC
GGGCTGTGTTAGTATTTTAGAATAGATAGTAAAATAGTTGTTTTTTTTCATCCCACAGAAAGCCTCTGTCCTCTTCTCAGATGCAGGCTCAGCTTCTCCACCCTACTCTGGCCTTTAGCCATTTTTAT
GAGGTCTTTTAAAAAGACTCACCCAGTTTGTTAAGTAATGCAGTTATCAAAGCCCATATGGTTCCAAGGTTGAGTTAAATAATTAAAGCAAGTAATAATTTGTAAAAGCAAAAGAATCTGCACCGGTT
CTTTTCACTGCAAAGTCGAGGAGGGCTGCTGTCACAACCTCACGTCTCATTATTTGCTACAACCAAAGCATTTCAGACTCCTCGGTCTTCCATGCCGCTGTGACAATCAGTATTTATACTGATTTTAT
AATGGATTCCTTCAGTGCATCTATTCATCTATTGGCTGATATTCTCCTCCCCTCCCTCTCCCCCTCCCTCCTTTCCACATCTCCATTTTGTTTTCTTGAGACAGGATCTTGTCACCCAGCCAGACTGA
ACTCAAGTTTGCGGTAACCTTCCTGCCTCCAGCTCCCTATTGCTGGGATTATAGACACGCATCACATCCTAATATTTATTTTTAAAACACAAATGTAGAGATTTTACTGCAACCAGAATACATTTTTA
TTATTAATAGTTTTGCTGAATTTTTCTATTGGGGGTGGTGGATTTTACCACTAATAGTAGTAATTAAAAGTGTAGTCTTGCAAATGTTATGGACTTACTACGAGAGCTTTATTTTCTGTTTCATTTTG
TCAACAGCTCGATTTATAATAAGCTTCTGGGGGAGAACTTCATAGAGTGTAAAATGCTCAAACGGAATATTTCAGTAGGGCATGTGTAACCTGCATCCTAACACATCTGTAGATGACGACGTCTTATC
AGTGTCAAAACGGTGGGCGCCTTTGATACTTTTAACGTCTCAAGACAGTAAGCCAAGGATTCACACACATAAAAAACTGTCCTCGCGGTTATTTCTTTGAGATATTTTTCCTGATGAAATTTGTAGTT
ACATTGGGAAGTCTTTTGGAAACTGCATTAAAATGTGACTTGCCTTACAAA

hide sequence

RefSeq Acc Id:

XM_039078458 ⟹ XP_038934386

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	30,602,338 - 30,655,610 (+)	NCBI
mRatBN7.2	7	28,715,347 - 28,768,624 (+)	NCBI

RefSeq Acc Id:

XM_039078459 ⟹ XP_038934387

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	30,602,953 - 30,655,610 (+)	NCBI
mRatBN7.2	7	28,715,990 - 28,768,624 (+)	NCBI

RefSeq Acc Id:

XR_005486547

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	30,602,338 - 30,648,237 (+)	NCBI
mRatBN7.2	7	28,715,347 - 28,761,249 (+)	NCBI


Protein RefSeqs	NP_665723	(Get FASTA)	NCBI Sequence Viewer
	XP_017450160	(Get FASTA)	NCBI Sequence Viewer
	XP_038934386	(Get FASTA)	NCBI Sequence Viewer
	XP_038934387	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61822	(Get FASTA)	NCBI Sequence Viewer
	AAL31316	(Get FASTA)	NCBI Sequence Viewer
	ABF70961	(Get FASTA)	NCBI Sequence Viewer
	EDM16889	(Get FASTA)	NCBI Sequence Viewer
	EDM16890	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009578
	ENSRNOP00000009578.1
	ENSRNOP00000071901
GenBank Protein	Q8VIJ4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_665723 ⟸ NM_145780

- UniProtKB:

Q8VIJ4 (UniProtKB/Swiss-Prot), A0A8L2R4T2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLTTPDAAGVNQLFFASPDLSTPHLQLLTENSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRS
IRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSTGLLDSGMFVNIHPSGIKTEPALLMTPDKAESCQGD
LGTLASVVTSLANLGKAKDLSHCGGDLPVVQSLRNGDTSFGAFHQDIQTNGDVSRAFDNLAKALTPGENPACQSPGESMEGSTHLIAGEPSCMEREGPLLSDSHVVFRLTMPSPMPEYLNVHYIGESA
SRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSPERRKLLMEHIFKLQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELIEKFQ
EKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL

hide sequence

RefSeq Acc Id:	XP_017450160 ⟸ XM_017594671
- Peptide Label:	isoform X1
- UniProtKB:	Q8VIJ4 (UniProtKB/Swiss-Prot), A0A8L2R4T2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLTTPDAAGVNQLFFASPDLSTPHLQLLTENSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRS IRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSTGLLDSGMFVNIHPSGIKTEPALLMTPDKAESCQGD LGTLASVVTSLANLGKAKDLSHCGGDLPVVQSLRNGDTSFGAFHQDIQTNGDVSRAFDNLAKALTPGENPACQSPGESMEGSTHLIAGEPSCMEREGPLLSDSHVVFRLTMPSPMPEYLNVHYIGESA SRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSPERRKLLMEHIFKLQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELIEKFQ EKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL hide sequence

Ensembl Acc Id:

ENSRNOP00000071901 ⟸ ENSRNOT00000089228

Ensembl Acc Id:

ENSRNOP00000009578 ⟸ ENSRNOT00000009578

RefSeq Acc Id:	XP_038934386 ⟸ XM_039078458
- Peptide Label:	isoform X1
- UniProtKB:	Q8VIJ4 (UniProtKB/Swiss-Prot), A0A8L2R4T2 (UniProtKB/TrEMBL)

Protein Domains

NR LBD Nuclear receptor

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8VIJ4-F1-model_v2	AlphaFold	Q8VIJ4	1-590	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695154

Promoter ID:

EPDNEW_R5678

Type:

initiation region

Name:

Nr2c1_1

Description:

nuclear receptor subfamily 2, group C, member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	35,069,816 - 35,069,876	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34372	BioCyc
Ensembl Genes	ENSRNOG00000006983	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009578	ENTREZGENE
	ENSRNOT00000009578.5	UniProtKB/Swiss-Prot
	ENSRNOT00000089228	ENTREZGENE
Gene3D-CATH	1.10.565.10	UniProtKB/Swiss-Prot
	3.30.50.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5599041	IMAGE-MGC_LOAD
InterPro	NHR-like_dom_sf	UniProtKB/Swiss-Prot
	NR2C1/2-like_DBD	UniProtKB/Swiss-Prot
	NR2C1/2-like_LBD	UniProtKB/Swiss-Prot
	Nucl_hrmn_rcpt_lig-bd	UniProtKB/Swiss-Prot
	Nuclear_hormone_rcpt_NR2	UniProtKB/Swiss-Prot
	Nuclear_hrmn_rcpt	UniProtKB/Swiss-Prot
	Znf_hrmn_rcpt	UniProtKB/Swiss-Prot
	Znf_NHR/GATA	UniProtKB/Swiss-Prot
KEGG Report	rno:252924	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72289	IMAGE-MGC_LOAD
NCBI Gene	Nr2c1	ENTREZGENE
PANTHER	NUCLEAR HORMONE RECEPTOR	UniProtKB/Swiss-Prot
Pfam	Hormone_recep	UniProtKB/Swiss-Prot
	zf-C4	UniProtKB/Swiss-Prot
PhenoGen	Nr2c1	PhenoGen
PRINTS	STRDHORMONER	UniProtKB/Swiss-Prot
	STROIDFINGER	UniProtKB/Swiss-Prot
PROSITE	NR_LBD	UniProtKB/Swiss-Prot
	NUCLEAR_REC_DBD_1	UniProtKB/Swiss-Prot
	NUCLEAR_REC_DBD_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006983	RatGTEx
SMART	HOLI	UniProtKB/Swiss-Prot
	ZnF_C4	UniProtKB/Swiss-Prot
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot
	SSF48508	UniProtKB/Swiss-Prot
UniProt	A0A8L2R4T2	ENTREZGENE, UniProtKB/TrEMBL
	A6IG09_RAT	UniProtKB/TrEMBL
	NR2C1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-06	Nr2c1	nuclear receptor subfamily 2, group C, member 1	Psg4	pregnancy specific beta-1-glycoprotein 4	Data merged from RGD:628790	737654	APPROVED
2003-02-27	Psg4	pregnancy specific beta-1-glycoprotein 4			Symbol and Name status set to provisional	70820	PROVISIONAL
2001-06-20	Tr2	Orphan receptor, TR2-11			Symbol withdrawn, duplicate of Nr2c1 (RGD:3200)	67952	WITHDRAWN
2001-06-20	Nr2c1	Nuclear receptor subfamily 2, group C, member 1			Name updated	67952	APPROVED

Note Type	Note	Reference
gene_homology	mouse Nr2c1 exhibits transcription factor, subtilase, ligand-dependent nuclear receptor and steroid hormone activities	704405

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD