Symbol:
Ggt1
Name:
gamma-glutamyltransferase 1
RGD ID:
2683
Description:
Enables aminoacyltransferase activity. Involved in several processes, including liver development; response to estradiol; and response to tumor necrosis factor. Located in extracellular space. Biomarker of aflatoxins-related hepatocellular carcinoma and alcohol dependence. Human ortholog(s) of this gene implicated in gamma-glutamyl transpeptidase deficiency. Orthologous to several human genes including GGT1 (gamma-glutamyltransferase 1); PARTICIPATES IN acetylsalicylic acid pharmacodynamics pathway; antipyrine drug pathway; arachidonic acid metabolic pathway; INTERACTS WITH (R)-lipoic acid; (S)-nicotine; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Gamma glutamyl-transferase 1; gamma-glutamyl transpeptidase; gamma-glutamyltransferase; gamma-glutamyltranspeptidase; gamma-glutamyltranspeptidase 1; GGLUT; Ggt; GGT 1; Ggtp; glutathione hydrolase 1; glutathione hydrolase 1 proenzyme; leukotriene-C4 hydrolase; RATGGLUT
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GGT1 (gamma-glutamyltransferase 1) HGNC
Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Ggt1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ggt1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GGT1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GGT1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ggt1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103223058 (glutathione hydrolase light chain 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ggt1 (gamma-glutamyltransferase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GGT2P (gamma-glutamyltransferase 2, pseudogene) HGNC
Inparanoid, Panther, PhylomeDB
Homo sapiens (human):
GGTLC1 (gamma-glutamyltransferase light chain 1) HGNC
Ensembl, OrthoDB, PhylomeDB
Homo sapiens (human):
GGTLC2 (gamma-glutamyltransferase light chain 2) HGNC
Ensembl, OrthoDB, PhylomeDB
Homo sapiens (human):
GGTLC3 (gamma-glutamyltransferase light chain family member 3) HGNC
EggNOG, Ensembl, PhylomeDB
Homo sapiens (human):
GGT5 (gamma-glutamyltransferase 5) HGNC
OrthoDB
Homo sapiens (human):
GGT3P (gamma-glutamyltransferase 3 pseudogene) HGNC
Panther
Homo sapiens (human):
ST8SIA6 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Ggt1 (gamma-glutamyltransferase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GGT1 (gamma-glutamyltransferase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GGTLC1 (gamma-glutamyltransferase light chain 1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Homo sapiens (human):
GGTLC2 (gamma-glutamyltransferase light chain 2)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Homo sapiens (human):
GGT3P (gamma-glutamyltransferase 3 pseudogene)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GGT2P (gamma-glutamyltransferase 2, pseudogene)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GGTLC3 (gamma-glutamyltransferase light chain family member 3)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Danio rerio (zebrafish):
si:ch73-59p9.2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
si:dkey-222h21.12
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
si:ch73-236c18.3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ggt1a (gamma-glutamyltransferase 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ggt1b (gamma-glutamyltransferase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ggt1l2.2 (gamma-glutamyltransferase 1 like 2.2)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
ggt1l2.1 (gamma-glutamyltransferase 1 like 2.1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
ECM38
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
H14N18.4
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T03D8.6
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y7A9A.1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG17636
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C53D5.5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4829
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Ggt-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ggt1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 13,074,141 - 13,103,551 (-) NCBI GRCr8 mRatBN7.2 20 13,074,695 - 13,104,095 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 13,074,700 - 13,108,442 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,781,279 - 13,802,241 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 13,142,223 - 13,163,185 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 13,614,726 - 13,635,690 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 14,019,723 - 14,045,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 14,019,723 - 14,025,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 16,209,337 - 16,231,303 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 20 14,560,916 - 14,581,414 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ggt1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ggt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GGT1 mRNA CTD PMID:36331819 Ggt1 Rat (R)-lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [Thioacetamide results in increased expression of GGT1 protein] CTD PMID:24704557 Ggt1 Rat (S)-colchicine multiple interactions ISO Ggt1 (Mus musculus) 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:38348705 Ggt1 Rat (S)-nicotine increases activity EXP 6480464 Nicotine results in increased activity of GGT1 protein CTD PMID:31857090 Ggt1 Rat (S)-nicotine multiple interactions EXP 6480464 Sodium Acetate inhibits the reaction [Nicotine results in increased activity of GGT1 protein] CTD PMID:31857090 Ggt1 Rat 1,2-dibromoethane increases activity ISO Ggt1 (Mus musculus) 6480464 Ethylene Dibromide results in increased activity of GGT1 protein CTD PMID:12628311 Ggt1 Rat 1,2-dibromoethane multiple interactions ISO Ggt1 (Mus musculus) 6480464 Phentolamine inhibits the reaction [Ethylene Dibromide results in increased activity of GGT1 protein] and Phenylephrine promotes the reaction [Ethylene Dibromide results in increased activity of GGT1 protein] CTD PMID:12628311 Ggt1 Rat 1,2-dichloroethane decreases expression ISO Ggt1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of GGT1 mRNA CTD PMID:28960355 Ggt1 Rat 1,2-dimethylhydrazine decreases expression ISO Ggt1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GGT1 mRNA CTD PMID:22206623 Ggt1 Rat 17alpha-ethynylestradiol increases expression ISO Ggt1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GGT1 mRNA CTD PMID:14976129 Ggt1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ggt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GGT1 mRNA CTD PMID:17942748 Ggt1 Rat 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with epomediol] results in increased activity of GGT1 protein CTD PMID:12071332 Ggt1 Rat 17alpha-ethynylestradiol increases activity EXP 6480464 Ethinyl Estradiol results in increased activity of GGT1 protein CTD PMID:12071332 Ggt1 Rat 17alpha-ethynylestradiol affects expression ISO Ggt1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of GGT1 mRNA CTD PMID:14976129 Ggt1 Rat 17beta-estradiol increases expression ISO Ggt1 (Mus musculus) 6480464 Estradiol results in increased expression of GGT1 mRNA CTD PMID:19484750 Ggt1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of GGT1 mRNA CTD PMID:32145629 Ggt1 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in decreased expression of GGT1 protein] CTD PMID:19634143 Ggt1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ggt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GGT1 mRNA CTD PMID:21570461 Ggt1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GGT1 mRNA CTD PMID:33387578 Ggt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ggt1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GGT1 mRNA CTD PMID:19770486 Ggt1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ggt1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GGT1 mRNA CTD PMID:17942748 Ggt1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of GGT1 mRNA CTD PMID:17187413 Ggt1 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased activity of GGT1 protein more ... CTD PMID:15554553 Ggt1 Rat 2-amino-6-diazo-5-oxohexanoic acid decreases activity EXP 6480464 Diazooxonorleucine results in decreased activity of GGT1 protein CTD PMID:6149445 Ggt1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:34256052 Ggt1 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR gene mutant form inhibits the reaction [3 more ... CTD PMID:34256052 Ggt1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Ggt1 (Mus musculus) 6480464 Oxazolone results in increased expression of GGT1 mRNA CTD PMID:21404309 Ggt1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of GGT1 mRNA CTD PMID:21346803 Ggt1 Rat 4-hydroxynon-2-enal multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [4-hydroxy-2-nonenal results in increased expression of GGT1 mRNA] more ... CTD PMID:16195535 Ggt1 Rat 5-aza-2'-deoxycytidine increases expression ISO GGT1 (Homo sapiens) 6480464 Decitabine results in increased expression of GGT1 mRNA CTD PMID:19194470 Ggt1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions EXP 6480464 [Omeprazole co-treated with Diethylnitrosamine] results in increased expression of GGT1 mRNA CTD PMID:22687989 Ggt1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:12376462 Ggt1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of GGT1 mRNA CTD PMID:31881176 Ggt1 Rat Acetaminophen cystein multiple interactions ISO Ggt1 (Mus musculus) 6480464 GGT1 protein affects the reaction [acetaminophen cysteine results in decreased abundance of Glutathione] CTD PMID:15629191 Ggt1 Rat acetylsalicylic acid decreases activity EXP 6480464 Aspirin analog results in decreased activity of GGT1 protein CTD PMID:20171274 Ggt1 Rat acivicin multiple interactions ISO Ggt1 (Mus musculus) 6480464 [acivicin results in decreased activity of GGT1 protein] which results in decreased susceptibility to Glutathione CTD PMID:19419996 Ggt1 Rat acivicin decreases activity ISO Ggt1 (Mus musculus) 6480464 acivicin results in decreased activity of GGT1 protein CTD PMID:15629191 Ggt1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GGT1 mRNA CTD PMID:28959563 Ggt1 Rat aflatoxin B1 decreases expression ISO Ggt1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GGT1 mRNA CTD PMID:19770486 Ggt1 Rat aflatoxin B1 increases expression ISO GGT1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of GGT1 mRNA CTD PMID:22100608 Ggt1 Rat Alisol A multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in decreased expression of GGT1 mRNA CTD PMID:33035272 Ggt1 Rat Alisol B multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in decreased expression of GGT1 mRNA CTD PMID:33035272 Ggt1 Rat Alisol C 23-acetate multiple interactions EXP 6480464 [alisol A co-treated with alisol A 24-acetate co-treated with alisol B co-treated with alisol B 23-acetate co-treated with alisol C 23-acetate co-treated with alisol F co-treated with alisol F 24-acetate] results in decreased expression of GGT1 mRNA CTD PMID:33035272 Ggt1 Rat all-trans-retinoic acid increases expression ISO GGT1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GGT1 mRNA CTD PMID:15498508 and PMID:33167477 Ggt1 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of GGT1 mRNA CTD PMID:20488242 Ggt1 Rat all-trans-retinoic acid increases expression ISO Ggt1 (Mus musculus) 6480464 Tretinoin results in increased expression of GGT1 mRNA CTD PMID:16788091 Ggt1 Rat anethole decreases activity EXP 6480464 anethole analog results in decreased activity of GGT1 protein CTD PMID:20171274 Ggt1 Rat anilines affects metabolic processing EXP 6480464 GGT1 protein affects the metabolism of Aniline Compounds analog CTD PMID:6149445 Ggt1 Rat antimonite multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of GGT1 mRNA CTD PMID:32076005 Ggt1 Rat aristolochic acid A decreases expression ISO GGT1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GGT1 protein CTD PMID:33212167 Ggt1 Rat Aroclor 1254 decreases activity EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased activity of GGT1 protein CTD PMID:15955608 more ... Ggt1 Rat Aroclor 1254 multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Chlorodiphenyl (54% Chlorine) results in decreased activity of GGT1 protein] and Vitamin E inhibits the reaction [Chlorodiphenyl (54% Chlorine) results in decreased activity of GGT1 protein] CTD PMID:16298753 Ggt1 Rat arsane decreases response to substance ISO GGT1 (Homo sapiens) 6480464 GGT1 mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Ggt1 Rat arsenic atom decreases response to substance ISO GGT1 (Homo sapiens) 6480464 GGT1 mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 Ggt1 Rat arsenite(3-) multiple interactions ISO GGT1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of GGT1 mRNA CTD PMID:32076005 Ggt1 Rat arsenous acid increases secretion EXP 6480464 Arsenic Trioxide results in increased secretion of GGT1 protein CTD PMID:24634002 Ggt1 Rat arsenous acid multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide results in increased secretion of GGT1 protein] CTD PMID:24634002 Ggt1 Rat asbestos decreases expression ISO GGT1 (Homo sapiens) 6480464 Asbestos results in decreased expression of GGT1 mRNA CTD PMID:22076105 Ggt1 Rat atazanavir sulfate multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA CTD PMID:33819548 Ggt1 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of GGT1 mRNA CTD PMID:36841081 Ggt1 Rat Augmentin increases expression ISO GGT1 (Homo sapiens) 6480464 Amoxicillin-Potassium Clavulanate Combination results in increased expression of GGT1 protein CTD PMID:34767876 Ggt1 Rat barium chloride increases activity EXP 6480464 barium chloride results in increased activity of GGT1 protein CTD PMID:28683652 Ggt1 Rat benzo[a]pyrene increases activity ISO Ggt1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased activity of GGT1 protein CTD PMID:18057710 and PMID:36193556 Ggt1 Rat benzo[a]pyrene affects methylation ISO GGT1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GGT1 5' UTR CTD PMID:27901495 Ggt1 Rat benzo[a]pyrene decreases expression ISO Ggt1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GGT1 mRNA CTD PMID:19770486 Ggt1 Rat benzo[a]pyrene multiple interactions ISO Ggt1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Benzo(a)pyrene results in increased activity of GGT1 protein] and thymoquinone inhibits the reaction [Benzo(a)pyrene results in increased activity of GGT1 protein] CTD PMID:18057710 and PMID:36193556 Ggt1 Rat beta-lapachone increases expression ISO GGT1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GGT1 mRNA CTD PMID:38218311 Ggt1 Rat beta-lapachone decreases expression ISO GGT1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GGT1 mRNA CTD PMID:38218311 Ggt1 Rat bifenthrin increases expression ISO Ggt1 (Mus musculus) 6480464 bifenthrin results in increased expression of GGT1 mRNA CTD PMID:26071804 Ggt1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GGT1 mRNA CTD PMID:25181051 Ggt1 Rat bisphenol A multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GGT1 mRNA CTD PMID:32145629 and PMID:35192832 Ggt1 Rat bisphenol A increases expression ISO Ggt1 (Mus musculus) 6480464 bisphenol A results in increased expression of GGT1 mRNA CTD PMID:34585602 Ggt1 Rat bisphenol F decreases expression ISO Ggt1 (Mus musculus) 6480464 bisphenol F results in decreased expression of GGT1 mRNA CTD PMID:38685157 Ggt1 Rat bisphenol F increases activity EXP 6480464 bisphenol F results in increased activity of GGT1 protein CTD PMID:37601897 Ggt1 Rat boric acids decreases activity EXP 6480464 Boric Acids analog results in decreased activity of GGT1 protein CTD PMID:6149445 Ggt1 Rat buta-1,3-diene increases expression ISO Ggt1 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of GGT1 mRNA CTD PMID:29038090 Ggt1 Rat Butylbenzyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat cadmium atom increases activity EXP 6480464 Cadmium results in increased activity of GGT1 protein CTD PMID:17165624 Ggt1 Rat cadmium atom multiple interactions ISO Ggt1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GGT1 mRNA CTD PMID:37325564 Ggt1 Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of GGT1 protein CTD PMID:23193971 Ggt1 Rat cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased activity of GGT1 protein more ... CTD PMID:17165624 more ... Ggt1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of GGT1 protein CTD PMID:23750309 Ggt1 Rat cadmium dichloride multiple interactions ISO Ggt1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GGT1 mRNA CTD PMID:37325564 Ggt1 Rat cadmium dichloride decreases expression ISO GGT1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GGT1 mRNA CTD PMID:38382870 Ggt1 Rat cadmium dichloride increases activity EXP 6480464 Cadmium Chloride results in increased activity of GGT1 protein CTD PMID:23961183 Ggt1 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased activity of GGT1 protein more ... CTD PMID:23750309 more ... Ggt1 Rat carbon nanotube decreases expression ISO GGT1 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of GGT1 mRNA CTD PMID:22076105 Ggt1 Rat CGP 52608 multiple interactions ISO GGT1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GGT1 gene] CTD PMID:28238834 Ggt1 Rat chenodeoxycholic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA more ... CTD PMID:33819548 Ggt1 Rat chlordecone decreases expression ISO Ggt1 (Mus musculus) 6480464 Chlordecone results in decreased expression of GGT1 mRNA CTD PMID:33711761 Ggt1 Rat Chlorobenzilate increases activity EXP 6480464 chlorobenzilate results in increased activity of GGT1 protein CTD PMID:2387028 Ggt1 Rat chloroprene increases expression ISO Ggt1 (Mus musculus) 6480464 Chloroprene results in increased expression of GGT1 mRNA CTD PMID:23125180 Ggt1 Rat chromium(6+) affects expression ISO Ggt1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of GGT1 mRNA CTD PMID:28472532 Ggt1 Rat cisplatin multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of GGT1 mRNA CTD PMID:27392435 Ggt1 Rat cisplatin increases expression ISO GGT1 (Homo sapiens) 6480464 Cisplatin results in increased expression of GGT1 mRNA CTD PMID:27392435 Ggt1 Rat coenzyme Q10 multiple interactions EXP 6480464 coenzyme Q10 inhibits the reaction [Risperidone results in increased expression of and results in increased secretion of GGT1 protein] CTD PMID:27387968 Ggt1 Rat copper atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat copper(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat crocidolite asbestos multiple interactions ISO GGT1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of and results in increased activity of GGT1 protein CTD PMID:31388672 Ggt1 Rat crotonaldehyde decreases activity EXP 6480464 2-butenal results in decreased activity of GGT1 protein CTD PMID:31345100 Ggt1 Rat CU-O LINKAGE multiple interactions EXP 6480464 [cupric oxide co-treated with lead oxide co-treated with Zinc Oxide] results in increased activity of GGT1 protein and [cupric oxide co-treated with lead oxide] results in increased activity of GGT1 protein CTD PMID:28212817 Ggt1 Rat curcumin increases expression EXP 6480464 Curcumin results in increased expression of GGT1 mRNA CTD PMID:18299980 Ggt1 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Thioacetamide results in increased expression of GGT1 protein] CTD PMID:24704557 Ggt1 Rat cyclosporin A decreases expression ISO Ggt1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of GGT1 mRNA CTD PMID:19770486 Ggt1 Rat cyclosporin A multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of GGT1 mRNA CTD PMID:33819548 Ggt1 Rat cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of GGT1 protein CTD PMID:11589784 Ggt1 Rat cyclosporin A multiple interactions EXP 6480464 Sirolimus promotes the reaction [Cyclosporine affects the expression of GGT1 protein] CTD PMID:11589784 Ggt1 Rat DDT decreases activity EXP 6480464 DDT results in decreased activity of GGT1 protein CTD PMID:9475050 Ggt1 Rat DDT increases activity EXP 6480464 DDT results in increased activity of GGT1 protein CTD PMID:2387028 Ggt1 Rat deoxycholic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA more ... CTD PMID:33819548 Ggt1 Rat Di-n-octyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat diarsenic trioxide multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Arsenic Trioxide results in increased secretion of GGT1 protein] CTD PMID:24634002 Ggt1 Rat diarsenic trioxide increases secretion EXP 6480464 Arsenic Trioxide results in increased secretion of GGT1 protein CTD PMID:24634002 Ggt1 Rat Dibutyl phosphate affects expression ISO GGT1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GGT1 mRNA CTD PMID:37042841 Ggt1 Rat dibutyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat diclofenac multiple interactions EXP 6480464 [lipopolysaccharide and E coli O55-B5 co-treated with Diclofenac] results in increased activity of GGT1 protein CTD PMID:23939143 Ggt1 Rat dicofol increases activity EXP 6480464 Dicofol results in increased activity of GGT1 protein CTD PMID:2387028 Ggt1 Rat diethyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat Diisodecyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat diisononyl phthalate multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GGT1 protein CTD PMID:35739755 Ggt1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Antimony Potassium Tartrate results in increased abundance of antimonite] which results in increased expression of GGT1 mRNA CTD PMID:32076005 Ggt1 Rat dorsomorphin multiple interactions ISO GGT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GGT1 mRNA CTD PMID:27188386 Ggt1 Rat doxorubicin decreases secretion EXP 6480464 Doxorubicin results in decreased secretion of GGT1 protein CTD PMID:28885000 Ggt1 Rat doxorubicin decreases expression ISO GGT1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GGT1 mRNA CTD PMID:29803840 Ggt1 Rat elemental selenium multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of GGT1 mRNA CTD PMID:19244175 Ggt1 Rat elemental selenium multiple interactions EXP 6480464 Acetylcysteine promotes the reaction [Selenium inhibits the reaction [Mercuric Chloride results in increased expression of GGT1 protein]] more ... CTD PMID:24485406 Ggt1 Rat endosulfan increases activity EXP 6480464 Endosulfan results in increased activity of GGT1 protein CTD PMID:8588293 Ggt1 Rat entinostat increases expression ISO GGT1 (Homo sapiens) 6480464 entinostat results in increased expression of GGT1 mRNA CTD PMID:26272509 Ggt1 Rat entinostat multiple interactions ISO GGT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GGT1 mRNA CTD PMID:27188386 Ggt1 Rat Epomediol multiple interactions EXP 6480464 [Ethinyl Estradiol co-treated with epomediol] results in increased activity of GGT1 protein CTD PMID:12071332 Ggt1 Rat estradiol increases activity EXP 152998935 estradiol increases Ggt1 enzyme activity in rat plasma and liver microsomes RGD Ggt1 Rat ethanol multiple interactions ISO Ggt1 (Mus musculus) 6480464 [Ethanol co-treated with Dietary Fats] results in increased expression of GGT1 protein CTD PMID:35863473 Ggt1 Rat ethyl methanesulfonate increases expression ISO GGT1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of GGT1 mRNA CTD PMID:23649840 Ggt1 Rat fenarimol increases activity EXP 6480464 fenarimol results in increased activity of GGT1 protein CTD PMID:2387028 Ggt1 Rat fenvalerate affects expression EXP 6480464 fenvalerate affects the expression of GGT1 CTD PMID:12479040 Ggt1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of GGT1 mRNA CTD PMID:30307764 Ggt1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of GGT1 mRNA CTD PMID:23962444 Ggt1 Rat folic acid affects activity EXP 6480464 Folic Acid affects the activity of GGT1 protein CTD PMID:16967759 Ggt1 Rat formaldehyde increases expression ISO GGT1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of GGT1 mRNA CTD PMID:23649840 Ggt1 Rat furan increases expression EXP 6480464 furan results in increased expression of GGT1 mRNA CTD PMID:27387713 Ggt1 Rat gamma-hexachlorocyclohexane multiple interactions ISO Ggt1 (Mus musculus) 6480464 Plant Extracts inhibits the reaction [Hexachlorocyclohexane results in increased activity of GGT1 protein] CTD PMID:11349524 Ggt1 Rat gamma-hexachlorocyclohexane affects activity EXP 6480464 Hexachlorocyclohexane affects the activity of GGT1 protein CTD PMID:8519523 Ggt1 Rat gamma-hexachlorocyclohexane decreases activity EXP 6480464 Hexachlorocyclohexane results in decreased activity of GGT1 protein CTD PMID:9475050 Ggt1 Rat gamma-hexachlorocyclohexane increases activity ISO Ggt1 (Mus musculus) 6480464 Hexachlorocyclohexane results in increased activity of GGT1 protein CTD PMID:11349524 Ggt1 Rat genistein decreases expression ISO Ggt1 (Mus musculus) 6480464 Genistein results in decreased expression of GGT1 mRNA CTD PMID:32186404 Ggt1 Rat glutathione multiple interactions ISO Ggt1 (Mus musculus) 6480464 [acivicin results in decreased activity of GGT1 protein] which results in decreased susceptibility to Glutathione more ... CTD PMID:15629191 and PMID:19419996 Ggt1 Rat glycochenodeoxycholic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA more ... CTD PMID:33819548 Ggt1 Rat glycocholic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA more ... CTD PMID:33819548 Ggt1 Rat glycodeoxycholic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in increased expression of GGT1 mRNA more ... CTD PMID:33819548 Ggt1 Rat glycyrrhetinate multiple interactions EXP 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Methotrexate results in increased activity of GGT1 protein] CTD PMID:28414158 Ggt1 Rat glycyrrhetinic acid multiple interactions EXP 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Methotrexate results in increased activity of GGT1 protein] CTD PMID:28414158 Ggt1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of GGT1 mRNA CTD PMID:29933104 Ggt1 Rat GW 4064 increases expression ISO Ggt1 (Mus musculus) 6480464 GW 4064 results in increased expression of GGT1 mRNA CTD PMID:26655953 Ggt1 Rat hexadecanoic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid] affects the expression of GGT1 mRNA CTD PMID:30547786 Ggt1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of GGT1 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of GGT1 mRNA CTD PMID:22129741 Ggt1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of GGT1 mRNA CTD PMID:21396975 Ggt1 Rat irinotecan decreases expression ISO GGT1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of GGT1 mRNA CTD PMID:18927307 Ggt1 Rat isoniazide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Isoniazid] results in increased activity of GGT1 protein CTD PMID:25331106 Ggt1 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Chlorodiphenyl (54% Chlorine) results in decreased activity of GGT1 protein] CTD PMID:16298753 Ggt1 Rat lead oxide multiple interactions EXP 6480464 [cupric oxide co-treated with lead oxide co-treated with Zinc Oxide] results in increased activity of GGT1 protein more ... CTD PMID:28212817 Ggt1 Rat lead oxide increases activity EXP 6480464 lead oxide results in increased activity of GGT1 protein CTD PMID:28212817 Ggt1 Rat lead(0) decreases activity EXP 6480464 Lead results in decreased activity of GGT1 protein CTD PMID:16092086 Ggt1 Rat lead(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat letrozole multiple interactions EXP 6480464 Spironolactone inhibits the reaction [Letrozole results in increased activity of GGT1 protein] CTD PMID:37328115 Ggt1 Rat letrozole increases activity EXP 6480464 Letrozole results in increased activity of GGT1 protein CTD PMID:37328115 Ggt1 Rat lipoic acid multiple interactions EXP 6480464 Thioctic Acid inhibits the reaction [Thioacetamide results in increased expression of GGT1 protein] CTD PMID:24704557 Ggt1 Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Isoniazid] results in increased activity of GGT1 protein CTD PMID:25331106 Ggt1 Rat manganese atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat manganese(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:15700767 Ggt1 Rat menadione decreases expression EXP 6480464 Vitamin K 3 results in decreased expression of GGT1 mRNA alternative form CTD PMID:12030384 Ggt1 Rat menadione multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Vitamin K 3 results in increased activity of GGT1 protein] and Vitamin K 3 results in increased expression of and results in increased activity of GGT1 protein CTD PMID:12030384 Ggt1 Rat mercury atom decreases expression ISO GGT1 (Homo sapiens) 6480464 Mercury results in decreased expression of GGT1 mRNA CTD PMID:19937285 Ggt1 Rat mercury atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat mercury dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Mercuric Chloride results in increased expression of GGT1 protein] more ... CTD PMID:24485406 Ggt1 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of GGT1 protein CTD PMID:24485406 Ggt1 Rat mercury(0) decreases expression ISO GGT1 (Homo sapiens) 6480464 Mercury results in decreased expression of GGT1 mRNA CTD PMID:19937285 Ggt1 Rat mercury(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat methotrexate multiple interactions EXP 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Methotrexate results in increased activity of GGT1 protein] CTD PMID:28414158 Ggt1 Rat methotrexate increases activity EXP 6480464 Methotrexate results in increased activity of GGT1 protein CTD PMID:28414158 Ggt1 Rat methoxychlor multiple interactions ISO Ggt1 (Mus musculus) 6480464 [bromfenvinphos co-treated with Methoxychlor] results in increased activity of GGT1 protein CTD PMID:8106090 Ggt1 Rat methyl methanesulfonate increases expression ISO GGT1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of GGT1 mRNA CTD PMID:23649840 Ggt1 Rat methylmercury chloride increases expression ISO GGT1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GGT1 mRNA CTD PMID:28001369 Ggt1 Rat microcystin-LR increases expression ISO Ggt1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of GGT1 mRNA CTD PMID:17654400 Ggt1 Rat N(5)-ethyl-L-glutamine multiple interactions EXP 6480464 theanine inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:25852135 Ggt1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of GGT1 mRNA more ... CTD PMID:12030384 more ... Ggt1 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Ggt1 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of GGT1 gene CTD PMID:16724327 Ggt1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased activity of GGT1 protein more ... CTD PMID:15554553 more ... Ggt1 Rat N-nitrosodiethylamine increases expression ISO Ggt1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of GGT1 mRNA CTD PMID:27746196 Ggt1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of GGT1 mRNA and Diethylnitrosamine results in increased expression of GGT1 protein CTD PMID:19126423 and PMID:19638242 Ggt1 Rat N-nitrosodiethylamine increases activity EXP 6480464 Diethylnitrosamine results in increased activity of GGT1 protein CTD PMID:15563447 Ggt1 Rat naphthalene increases expression EXP 6480464 naphthalene analog results in increased expression of GGT1 mRNA CTD PMID:24976557 Ggt1 Rat nefazodone multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of GGT1 mRNA CTD PMID:33819548 Ggt1 Rat nickel atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat nickel sulfate increases activity EXP 6480464 nickel sulfate results in increased activity of GGT1 protein CTD PMID:24112957 Ggt1 Rat nickel sulfate multiple interactions EXP 6480464 troxerutin inhibits the reaction [nickel sulfate results in increased activity of GGT1 protein] CTD PMID:24112957 Ggt1 Rat nicotine multiple interactions EXP 6480464 Sodium Acetate inhibits the reaction [Nicotine results in increased activity of GGT1 protein] CTD PMID:31857090 Ggt1 Rat nicotine increases activity EXP 6480464 Nicotine results in increased activity of GGT1 protein CTD PMID:31857090 Ggt1 Rat nicotinic acid increases expression EXP 6480464 Niacin results in increased expression of GGT1 mRNA CTD PMID:20303128 Ggt1 Rat nitrobenzenes decreases expression EXP 6480464 Nitrobenzenes analog results in decreased expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat nitrogen dioxide increases expression EXP 6480464 Nitrogen Dioxide results in increased expression of GGT1 mRNA CTD PMID:16049373 and PMID:9144455 Ggt1 Rat nitrogen dioxide multiple interactions EXP 6480464 Nitrogen Dioxide results in increased expression of and results in increased activity of GGT1 protein CTD PMID:9144455 Ggt1 Rat novobiocin increases activity ISO Ggt1 (Mus musculus) 6480464 Novobiocin results in increased activity of GGT1 protein CTD PMID:1739614 Ggt1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GGT1 mRNA CTD PMID:12700408 more ... Ggt1 Rat ochratoxin A decreases activity EXP 6480464 ochratoxin A results in decreased activity of GGT1 protein CTD PMID:2569870 Ggt1 Rat oleic acid multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid] affects the expression of GGT1 mRNA CTD PMID:30547786 Ggt1 Rat omeprazole multiple interactions EXP 6480464 [Omeprazole co-treated with Diethylnitrosamine] results in increased expression of GGT1 mRNA CTD PMID:22687989 Ggt1 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of GGT1 mRNA CTD PMID:23665939 Ggt1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GGT1 mRNA CTD PMID:25729387 Ggt1 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of GGT1 mRNA CTD PMID:32680482 Ggt1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ggt1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GGT1 mRNA CTD PMID:36331819 Ggt1 Rat permethrin increases activity EXP 6480464 Permethrin results in increased activity of GGT1 protein CTD PMID:2902710 Ggt1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of GGT1 mRNA CTD PMID:2563599 Ggt1 Rat phentolamine multiple interactions ISO Ggt1 (Mus musculus) 6480464 Phentolamine inhibits the reaction [Ethylene Dibromide results in increased activity of GGT1 protein] CTD PMID:12628311 Ggt1 Rat phenylephrine multiple interactions ISO Ggt1 (Mus musculus) 6480464 Phenylephrine promotes the reaction [Ethylene Dibromide results in increased activity of GGT1 protein] CTD PMID:12628311 Ggt1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of GGT1 mRNA CTD PMID:12376462 Ggt1 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of GGT1 mRNA CTD PMID:33945839 Ggt1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of GGT1 mRNA CTD PMID:22008526 Ggt1 Rat potassium dichromate multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of GGT1 mRNA CTD PMID:19162173 Ggt1 Rat prochloraz increases expression EXP 6480464 prochloraz results in increased expression of GGT1 mRNA CTD PMID:25182419 Ggt1 Rat quercetin multiple interactions ISO Ggt1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Benzo(a)pyrene results in increased activity of GGT1 protein] CTD PMID:18057710 Ggt1 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of GGT1 mRNA CTD PMID:25905778 Ggt1 Rat risperidone multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Risperidone results in increased expression of and results in increased secretion of GGT1 protein] more ... CTD PMID:27387968 Ggt1 Rat S-hexylglutathione multiple interactions ISO Ggt1 (Mus musculus) 6480464 [hexylglutathione results in decreased activity of GGT1 protein] which results in decreased susceptibility to Glutathione CTD PMID:19419996 Ggt1 Rat sanguinarine increases expression ISO Ggt1 (Mus musculus) 6480464 sanguinarine results in increased expression of GGT1 protein CTD PMID:15981203 Ggt1 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [4-hydroxy-2-nonenal results in increased expression of GGT1 mRNA] CTD PMID:16195535 Ggt1 Rat SB 431542 multiple interactions ISO GGT1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GGT1 mRNA CTD PMID:27188386 Ggt1 Rat selenium atom multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of GGT1 mRNA CTD PMID:19244175 Ggt1 Rat selenium atom multiple interactions EXP 6480464 Acetylcysteine promotes the reaction [Selenium inhibits the reaction [Mercuric Chloride results in increased expression of GGT1 protein]] more ... CTD PMID:24485406 Ggt1 Rat silicon dioxide increases expression ISO Ggt1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of GGT1 mRNA CTD PMID:29341224 Ggt1 Rat sirolimus multiple interactions EXP 6480464 Sirolimus promotes the reaction [Cyclosporine affects the expression of GGT1 protein] CTD PMID:11589784 Ggt1 Rat sodium acetate trihydrate multiple interactions EXP 6480464 Sodium Acetate inhibits the reaction [Nicotine results in increased activity of GGT1 protein] CTD PMID:31857090 Ggt1 Rat sodium arsenite multiple interactions ISO GGT1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] which results in increased expression of GGT1 mRNA CTD PMID:32076005 Ggt1 Rat sodium arsenite increases expression ISO Ggt1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GGT1 mRNA CTD PMID:37682722 Ggt1 Rat sodium arsenite increases expression ISO GGT1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GGT1 mRNA CTD PMID:38568856 Ggt1 Rat sodium arsenite decreases activity ISO Ggt1 (Mus musculus) 6480464 sodium arsenite results in decreased activity of GGT1 protein CTD PMID:30207182 Ggt1 Rat spironolactone multiple interactions EXP 6480464 Spironolactone inhibits the reaction [Letrozole results in increased activity of GGT1 protein] CTD PMID:37328115 Ggt1 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of GGT1 mRNA and Trientine inhibits the reaction [Streptozocin results in decreased expression of GGT1 protein] CTD PMID:19634143 and PMID:25905778 Ggt1 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of GGT1 protein CTD PMID:19634143 Ggt1 Rat succimer multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of GGT1 mRNA CTD PMID:26378955 Ggt1 Rat tamibarotene increases expression ISO GGT1 (Homo sapiens) 6480464 tamibarotene results in increased expression of GGT1 mRNA CTD PMID:15498508 Ggt1 Rat Tanshinone I multiple interactions ISO Ggt1 (Mus musculus) 6480464 tanshinone inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:38348705 Ggt1 Rat telmisartan multiple interactions EXP 6480464 telmisartan inhibits the reaction [Cadmium Chloride results in increased expression of GGT1 protein] CTD PMID:23750309 Ggt1 Rat tetrachloromethane increases activity EXP 6480464 Carbon Tetrachloride results in increased activity of GGT1 protein CTD PMID:15700767 and PMID:25852135 Ggt1 Rat tetrachloromethane increases activity ISO Ggt1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased activity of GGT1 protein CTD PMID:38348705 Ggt1 Rat tetrachloromethane multiple interactions ISO Ggt1 (Mus musculus) 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] and tanshinone inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:38348705 Ggt1 Rat tetrachloromethane increases expression ISO Ggt1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GGT1 mRNA CTD PMID:27746196 Ggt1 Rat tetrachloromethane multiple interactions EXP 6480464 Melatonin inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] and theanine inhibits the reaction [Carbon Tetrachloride results in increased activity of GGT1 protein] CTD PMID:15700767 and PMID:25852135 Ggt1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GGT1 mRNA CTD PMID:19784758 Ggt1 Rat thioacetamide increases activity EXP 6480464 Thioacetamide results in increased activity of GGT1 protein CTD PMID:22899499 and PMID:38504479 Ggt1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of GGT1 mRNA more ... CTD PMID:22899499 more ... Ggt1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GGT1 mRNA and Thioacetamide results in increased expression of GGT1 protein CTD PMID:23411599 and PMID:24704557 Ggt1 Rat thymoquinone multiple interactions ISO Ggt1 (Mus musculus) 6480464 thymoquinone inhibits the reaction [Benzo(a)pyrene results in increased activity of GGT1 protein] CTD PMID:36193556 Ggt1 Rat thymoquinone multiple interactions EXP 6480464 thymoquinone inhibits the reaction [Thioacetamide results in increased activity of GGT1 protein] CTD PMID:38504479 Ggt1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GGT1 mRNA CTD PMID:25729387 Ggt1 Rat trans-anethole decreases activity EXP 6480464 anethole analog results in decreased activity of GGT1 protein CTD PMID:20171274 Ggt1 Rat trichloroethene decreases expression ISO Ggt1 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of GGT1 mRNA CTD PMID:28973375 Ggt1 Rat trichostatin A increases activity EXP 6480464 trichostatin A results in increased activity of GGT1 protein CTD PMID:12030384 Ggt1 Rat trimellitic anhydride increases expression ISO Ggt1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of GGT1 mRNA CTD PMID:19042947 Ggt1 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of GGT1 mRNA CTD PMID:30589522 Ggt1 Rat triphenyl phosphate affects expression ISO GGT1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GGT1 mRNA CTD PMID:37042841 Ggt1 Rat triptonide increases expression ISO Ggt1 (Mus musculus) 6480464 triptonide results in increased expression of GGT1 mRNA CTD PMID:33045310 Ggt1 Rat tris(2-butoxyethyl) phosphate increases activity EXP 6480464 tris(2-butoxyethyl) phosphate results in increased activity of GGT1 protein CTD PMID:24685621 Ggt1 Rat valproic acid increases methylation ISO GGT1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GGT1 gene CTD PMID:29154799 Ggt1 Rat vancomycin increases expression ISO Ggt1 (Mus musculus) 6480464 Vancomycin results in increased expression of GGT1 mRNA CTD PMID:18930951 Ggt1 Rat vitamin E multiple interactions ISO GGT1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of GGT1 mRNA CTD PMID:19244175 Ggt1 Rat vitamin E multiple interactions EXP 6480464 Vitamin E inhibits the reaction [Chlorodiphenyl (54% Chlorine) results in decreased activity of GGT1 protein] CTD PMID:16298753 Ggt1 Rat zinc atom multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat zinc oxide multiple interactions EXP 6480464 [cupric oxide co-treated with lead oxide co-treated with Zinc Oxide] results in increased activity of GGT1 protein and [lead oxide co-treated with Zinc Oxide] results in increased activity of GGT1 protein CTD PMID:28212817 Ggt1 Rat zinc(0) multiple interactions EXP 6480464 [Zinc co-treated with Copper co-treated with Manganese co-treated with Potassium Dichromate co-treated with Nickel co-treated with Cadmium co-treated with Lead co-treated with Mercury] affects the expression of GGT1 protein CTD PMID:30090589 Ggt1 Rat zoledronic acid decreases expression ISO GGT1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of GGT1 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) (R)-lipoic acid (EXP) (S)-colchicine (ISO) (S)-nicotine (EXP) 1,2-dibromoethane (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (EXP) 2-amino-6-diazo-5-oxohexanoic acid (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (EXP) 5-aza-2'-deoxycytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) Acetaminophen cystein (ISO) acetylsalicylic acid (EXP) acivicin (ISO) acrylamide (EXP) aflatoxin B1 (ISO) Alisol A (EXP) Alisol B (EXP) Alisol C 23-acetate (EXP) all-trans-retinoic acid (EXP,ISO) anethole (EXP) anilines (EXP) antimonite (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP) asbestos (ISO) atazanavir sulfate (ISO) atrazine (EXP) Augmentin (ISO) barium chloride (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) boric acids (EXP) buta-1,3-diene (ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) Chlorobenzilate (EXP) chloroprene (ISO) chromium(6+) (ISO) cisplatin (ISO) coenzyme Q10 (EXP) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) crotonaldehyde (EXP) CU-O LINKAGE (EXP) curcumin (EXP) cyclosporin A (EXP,ISO) DDT (EXP) deoxycholic acid (ISO) Di-n-octyl phthalate (ISO) diarsenic trioxide (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (EXP) dicofol (EXP) diethyl phthalate (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) elemental selenium (EXP,ISO) endosulfan (EXP) entinostat (ISO) Epomediol (EXP) estradiol (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) fenarimol (EXP) fenvalerate (EXP) fipronil (EXP) folic acid (EXP) formaldehyde (ISO) furan (EXP) gamma-hexachlorocyclohexane (EXP,ISO) genistein (ISO) glutathione (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glycyrrhetinate (EXP) glycyrrhetinic acid (EXP) graphite (EXP) GW 4064 (ISO) hexadecanoic acid (ISO) indole-3-methanol (EXP) irinotecan (ISO) isoniazide (EXP) L-ascorbic acid (EXP) lead oxide (EXP) lead(0) (EXP) letrozole (EXP) lipoic acid (EXP) lipopolysaccharide (EXP) manganese atom (EXP) manganese(0) (EXP) melatonin (EXP) menadione (EXP) mercury atom (EXP,ISO) mercury dichloride (EXP) mercury(0) (EXP,ISO) methotrexate (EXP) methoxychlor (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) microcystin-LR (ISO) N(5)-ethyl-L-glutamine (EXP) N-acetyl-L-cysteine (EXP) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP,ISO) naphthalene (EXP) nefazodone (ISO) nickel atom (EXP) nickel sulfate (EXP) nicotine (EXP) nicotinic acid (EXP) nitrobenzenes (EXP) nitrogen dioxide (EXP) novobiocin (ISO) ochratoxin A (EXP) oleic acid (ISO) omeprazole (EXP) orphenadrine (EXP) oxaliplatin (EXP) paracetamol (EXP) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenobarbital (EXP) phentolamine (ISO) phenylephrine (ISO) PhIP (EXP) piperonyl butoxide (EXP) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (EXP) prochloraz (EXP) quercetin (ISO) resveratrol (EXP) risperidone (EXP) S-hexylglutathione (ISO) sanguinarine (ISO) SB 203580 (EXP) SB 431542 (ISO) selenium atom (EXP,ISO) silicon dioxide (ISO) sirolimus (EXP) sodium acetate trihydrate (EXP) sodium arsenite (ISO) spironolactone (EXP) streptozocin (EXP) succimer (ISO) tamibarotene (ISO) Tanshinone I (ISO) telmisartan (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thymoquinone (EXP,ISO) topotecan (EXP) trans-anethole (EXP) trichloroethene (ISO) trichostatin A (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (EXP) valproic acid (ISO) vancomycin (ISO) vitamin E (EXP,ISO) zinc atom (EXP) zinc oxide (EXP) zinc(0) (EXP) zoledronic acid (ISO)
Biological Process
amino acid metabolic process (ISO) cellular response to oxidative stress (IEP) cysteine biosynthetic process (IEA,ISO) fatty acid metabolic process (ISO) glutamate metabolic process (ISO,ISS) glutathione biosynthetic process (IEA,ISO) glutathione catabolic process (IBA,IEA,ISO,ISS) glutathione metabolic process (IEA) hepatoblast differentiation (IEP) hepatocyte differentiation (IEP) leukotriene D4 biosynthetic process (ISO) leukotriene metabolic process (ISO) liver regeneration (IEP) peptide modification (IBA,IDA) proteolysis (IEA,ISO) regulation of immune system process (IBA,IEA,ISO) regulation of inflammatory response (IBA,IEA,ISO) response to alcohol (IEP) response to estradiol (IEP) response to lipopolysaccharide (IEP) response to tumor necrosis factor (IEP) spermatogenesis (IEA,ISO) zymogen activation (ISO,ISS)
1.
Characteristics of adults with and without cystic fibrosis-related diabetes.
Adler AI, etal., Diabet Med. 2007 Oct;24(10):1143-8.
2.
Modulatory role of lipoic acid on lipopolysaccharide-induced oxidative stress in adult rat Sertoli cells in vitro.
Aly HA, etal., Chem Biol Interact. 2009 Dec 10;182(2-3):112-8. Epub 2009 Aug 21.
3.
Expression of rat renal gamma-glutamyltransferase cDNA in Escherichia coli.
Angele C, etal., Biochem Biophys Res Commun. 1989 May 15;160(3):1040-6.
4.
Diabetic complications are associated with liver enzyme activities in people with type 1 diabetes.
Arkkila PE, etal., Diabetes Res Clin Pract. 2001 May;52(2):113-8.
5.
Enhanced gamma-glutamyl transpeptidase expression and selective loss of CuZn superoxide dismutase in hepatic iron overload.
Brown KE, etal., Free Radic Biol Med. 1998 Mar 1;24(4):545-55. doi: 10.1016/s0891-5849(97)00284-0.
6.
Tissue-specific expression of two gamma-glutamyl transpeptidase mRNAs with alternative 5' ends encoded by a single copy gene in the rat.
Chobert MN, etal., J Biol Chem 1990 Feb 5;265(4):2352-7.
7.
The relation between liver histopathology and GGT levels in viral hepatitis: more important in hepatitis B.
Eminler AT, etal., Turk J Gastroenterol. 2014 Aug;25(4):411-5. doi: 10.5152/tjg.2014.3693.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Risk factors for incident type 2 diabetes in individuals with a BMI of <27 kg/m(2): the role of gamma-glutamyltransferase. Data from an Epidemiological Study on the Insulin Resistance Syndrome (DESIR).
Gautier A, etal., Diabetologia. 2009 Nov 20.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
The Serum Gamma Glutamyl Transpeptidase - A Non invasive Diagnostic Bio Marker of Chronic Anicteric Non Alcoholic Liver Diseases.
H A K, J Clin Diagn Res. 2013 Apr;7(4):691-4. doi: 10.7860/JCDR/2013/5569.2883. Epub 2013 Mar 9.
12.
Protective effect of 17beta-estradiol on oxidative stress and liver dysfunction in aged male rats.
Hamden K, etal., J Physiol Biochem. 2007 Sep;63(3):195-201.
13.
Hyperglycaemia, stress oxidant, liver dysfunction and histological changes in diabetic male rat pancreas and liver: protective effect of 17 beta-estradiol.
Hamden K, etal., Steroids. 2008 May;73(5):495-501. Epub 2008 Jan 4.
14.
[The value of gamma-glutamyl transpeptidase mRNA typing in monitoring carcinogensis of heptocytes].
Han G, etal., Zhonghua Nei Ke Za Zhi. 2002 Mar;41(3):160-2.
15.
Ultrasonographic hepatic steatosis increases prediction of mortality risk from elevated serum gamma-glutamyl transpeptidase levels.
Haring R, etal., Hepatology. 2009 Nov;50(5):1403-11. doi: 10.1002/hep.23135.
16.
Differential expression of the rat gamma-glutamyl transpeptidase gene promoters along with differentiation of hepatoblasts into biliary or hepatocytic lineage.
Holic N, etal., Am J Pathol. 2000 Aug;157(2):537-48. doi: 10.1016/s0002-9440(10)64564-6.
17.
Clinical, virologic and pathologic significance of elevated serum gamma-glutamyl transpeptidase in patients with chronic hepatitis C.
Hwang SJ, etal., Zhonghua Yi Xue Za Zhi (Taipei). 2000 Jul;63(7):527-35.
18.
Correlation between gamma-glutamyl transpeptidase activity and outcomes after Kasai portoenterostomy for biliary atresia.
Ihn K, etal., J Pediatr Surg. 2018 Mar;53(3):461-467. doi: 10.1016/j.jpedsurg.2017.10.001. Epub 2017 Oct 6.
19.
Significance of serum gamma glutamyl transpeptidase as a marker of alcoholism.
Ishii H, etal., Pharmacol Biochem Behav. 1980;13 Suppl 1:95-9. doi: 10.1016/s0091-3057(80)80015-3.
20.
Gamma-glutamyl transpeptidase in leprosy.
Jain VK, etal., Indian J Lepr. 1991 Jan-Mar;63(1):93-6.
21.
Gamma-glutamyl transpeptidase level associated with metabolic syndrome and proinflammatory parameters in the young Roma population in eastern Slovakia: a population-based study.
Jarcuska P, etal., Cent Eur J Public Health. 2014 Mar;22 Suppl:S43-50. doi: 10.21101/cejph.a3901.
22.
Induced hepatotoxicity in female rats by aflatoxin B1 and ethynylestradiol interaction.
Kamdem L, etal., Toxicol Appl Pharmacol. 1983 Jan;67(1):26-40. doi: 10.1016/0041-008x(83)90241-7.
23.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
24.
Molecular cloning and nucleotide sequence of rat kidney gamma-glutamyl transpeptidase cDNA.
Laperche Y, etal., Proc Natl Acad Sci U S A 1986 Feb;83(4):937-41.
25.
[Serum gamma-glutamyl transpeptidase activity in children with chronic hepatitis B].
Lebensztejn DM, etal., Pol Merkur Lekarski. 2005 Mar;18(105):271-4.
26.
Serum gamma-glutamyltransferase was differently associated with microalbuminuria by status of hypertension or diabetes: the Coronary Artery Risk Development in Young Adults (CARDIA) Study.
Lee DH, etal., Clin Chem. 2005 Jul;51(7):1185-91. Epub 2005 May 12.
27.
Serum gamma-glutamyltransferase predicts non-fatal myocardial infarction and fatal coronary heart disease among 28,838 middle-aged men and women.
Lee DH, etal., Eur Heart J. 2006 Sep;27(18):2170-6. Epub 2006 Jun 13.
28.
Gamma glutamyl transferase and metabolic syndrome, cardiovascular disease, and mortality risk: the Framingham Heart Study.
Lee DS, etal., Arterioscler Thromb Vasc Biol. 2007 Jan;27(1):127-33. Epub 2006 Nov 9.
29.
Nonlinear free energy relationship in the general-acid-catalyzed acylation of rat kidney gamma-glutamyl transpeptidase by a series of gamma-glutamyl anilide substrate analogues.
Menard A, etal., Biochemistry 2001 Oct 23;40(42):12678-85.
30.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
31.
The expression of gamma-glutamyltransferase in rat colon carcinoma cells is distinctly regulated during differentiation and oxidative stress.
Mikkelsen IM, etal., Mol Cell Biochem. 2002 Mar;232(1-2):87-95.
32.
Elevated gamma-glutamyl transpeptidase levels in malignant melanoma.
Murray JL, etal., Cancer. 1982 Apr 1;49(7):1439-43. doi: 10.1002/1097-0142(19820401)49:7<1439::aid-cncr2820490721>3.0.co;2-1.
33.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
34.
Gamma-glutamyltransferase is upregulated after oxidative stress through the Ras signal transduction pathway in rat colon carcinoma cells.
Pandur S, etal., Free Radic Res. 2007 Dec;41(12):1376-84.
35.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
36.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
37.
Cloning and analysis of the rat gamma-glutamyltransferase gene.
Rajagopalan S, etal., J Biol Chem 1990 Jul 15;265(20):11721-5.
38.
GOA pipeline
RGD automated data pipeline
39.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
42.
Gamma-glutamyltransferase level in pregnancy is an independent risk factor for gestational diabetes mellitus.
Tan PC, etal., J Obstet Gynaecol Res. 2008 Aug;34(4):512-7.
43.
Prognostic value of alkaline phosphatase, gamma-glutamyl transpeptidase and lactate dehydrogenase in hepatocellular carcinoma patients treated with liver resection.
Wu SJ, etal., Int J Surg. 2016 Dec;36(Pt A):143-151. doi: 10.1016/j.ijsu.2016.10.033. Epub 2016 Oct 25.
44.
[Relationship between methylation status of gamma-glutamyl transpeptidase (GGT) genes and abnormal expression of its enzyme proteins in tissues of human hepatomas].
Yao D, etal., Zhonghua Gan Zang Bing Za Zhi. 1999 Sep;7(3):132-4.
45.
Gamma glutamyl transpeptidase is a dynamic indicator of endothelial response to stroke.
Yu C, etal., Exp Neurol. 2007 Jan;203(1):116-22. Epub 2006 Sep 14.
Ggt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 13,074,141 - 13,103,551 (-) NCBI GRCr8 mRatBN7.2 20 13,074,695 - 13,104,095 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 13,074,700 - 13,108,442 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,781,279 - 13,802,241 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 13,142,223 - 13,163,185 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 13,614,726 - 13,635,690 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 14,019,723 - 14,045,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 14,019,723 - 14,025,068 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 16,209,337 - 16,231,303 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 20 14,560,916 - 14,581,414 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
GGT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 24,583,750 - 24,628,996 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 24,594,811 - 24,629,005 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 24,979,718 - 25,024,963 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 23,309,718 - 23,354,972 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 23,304,271 - 23,349,489 NCBI Celera 22 8,779,459 - 8,824,717 (+) NCBI Celera Cytogenetic Map 22 q11.23 NCBI HuRef 22 7,929,404 - 7,974,708 (+) NCBI HuRef CHM1_1 22 24,938,527 - 24,983,991 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 25,045,351 - 25,090,447 (+) NCBI T2T-CHM13v2.0
Ggt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 75,396,910 - 75,422,027 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 75,397,438 - 75,422,034 (+) Ensembl GRCm39 Ensembl GRCm38 10 75,561,076 - 75,586,193 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 75,561,604 - 75,586,200 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 75,036,338 - 75,048,927 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 75,017,309 - 75,029,898 (+) NCBI MGSCv36 mm8 Celera 10 76,618,288 - 76,630,876 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 38.55 NCBI
Ggt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955455 8,082,578 - 8,099,523 (+) NCBI ChiLan1.0 ChiLan1.0
GGT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 34,377,966 - 34,418,498 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 37,108,395 - 37,149,276 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 5,424,334 - 5,469,705 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
GGT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 28,301,455 - 28,315,029 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 27,360,247 - 27,389,912 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 29,689,666 - 29,719,314 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 29,692,972 - 29,719,310 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 27,773,590 - 27,803,271 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 27,390,370 - 27,420,073 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 28,380,459 - 28,410,164 (+) NCBI UU_Cfam_GSD_1.0
Ggt1
LOC103223058
Ggt1
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
20
13076326
13076327
C
T
snv
European Variation Archive Release 3 , FXLE14/StmMcwi (2023), European Variation Archive Release 6, LEXF7C/StmMcwi (2022), FXLE21/StmMcwi (2023), FXLE16/Stm (2020), LEW/Crl (2019), LEXF2B/Stm (2019), LEXF4/Stm (2020), LE/Stm (2019), LEXF10A/StmMcwi (2020), MR/N (2020), FXLE14/Stm (2019NG), FXLE15/StmMcwi (2021), FXLE15/Stm (2019NG), FXLE17/Stm (2019NG), FXLE26/Stm (2022), LEW/Crl (2019NG), LEXF10B/StmMcwi (2022), LEXF10C/Stm (2022), LEXF2A/Stm (2022), LEXF2C/StmMcwi (2022), LEXF5/Stm (2019NG), LEXF7A/Stm (2019NG), LEXF9/StmMcwi (2022), MR/NRrrc (2022), LEXF2A/StmMcwi (2023), FXLE26/StmMcwi (2023), LEXF5/StmMcwi (2023), LEXF10C/StmMcwi (2023), FXLE17/StmMcwi (2023), FXLE15/StmMcwi (2023), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 118 Count of miRNA genes: 91 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000074533 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
D20Arb3
Rat Assembly Chr Position (strand) Source JBrowse Celera 20 14,573,002 - 14,573,152 UniSTS FHH x ACI Map 20 6.9298 UniSTS FHH x ACI Map 20 6.9298 RGD Cytogenetic Map 20 RGD
D20Arb4
Rat Assembly Chr Position (strand) Source JBrowse Celera 20 14,573,014 - 14,573,231 UniSTS RH 2.0 Map 20 189.0 RGD FHH x ACI Map 20 6.8999 RGD Cytogenetic Map 20 RGD
D20Wox9
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 13,092,820 - 13,093,043 (+) MAPPER mRatBN7.2 Rnor_6.0 20 14,038,923 - 14,039,145 NCBI Rnor6.0 Rnor_5.0 20 16,228,149 - 16,228,371 UniSTS Rnor5.0 Celera 20 14,578,646 - 14,578,868 UniSTS
338D4-Sp6
Rat Assembly Chr Position (strand) Source JBrowse Celera 20 14,567,588 - 14,567,864 UniSTS
Ggt1
Rat Assembly Chr Position (strand) Source JBrowse Celera 20 14,561,656 - 14,562,583 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
48
113
91
90
59
25
59
6
216
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074533 ⟹ ENSRNOP00000065923
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 13,074,700 - 13,108,442 (-) Ensembl Rnor_6.0 Ensembl 20 14,019,861 - 14,025,068 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093430 ⟹ ENSRNOP00000076324
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 14,020,917 - 14,025,067 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093521 ⟹ ENSRNOP00000076317
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 14,019,723 - 14,020,007 (-) Ensembl
RefSeq Acc Id:
NM_053840 ⟹ NP_446292
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,095,104 (-) NCBI mRatBN7.2 20 13,074,700 - 13,095,664 (-) NCBI Rnor_6.0 20 14,019,723 - 14,045,781 (-) NCBI Rnor_5.0 20 16,209,337 - 16,231,303 (-) NCBI Celera 20 14,560,916 - 14,581,414 (-) RGD
Sequence:
GACCATCCTGGAGGACCACACACTTGGCTACGTAAAGGCTCCACTCACACCAAAGGAGTACCAGCCTGCTCTAACGGTTTCAGGGAAGATTGGCTGTGGGTTTCCGCAGAGTGTGGGGGAGTTCCTGC
hide sequence
RefSeq Acc Id:
XM_039098382 ⟹ XP_038954310
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,091,767 (-) NCBI mRatBN7.2 20 13,074,695 - 13,091,994 (-) NCBI
RefSeq Acc Id:
XM_039098383 ⟹ XP_038954311
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,098,174 (-) NCBI mRatBN7.2 20 13,074,695 - 13,098,726 (-) NCBI
RefSeq Acc Id:
XM_039098384 ⟹ XP_038954312
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,088,329 (-) NCBI mRatBN7.2 20 13,074,695 - 13,088,613 (-) NCBI
RefSeq Acc Id:
XM_039098385 ⟹ XP_038954313
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,103,551 (-) NCBI mRatBN7.2 20 13,074,695 - 13,104,095 (-) NCBI
RefSeq Acc Id:
XM_063278931 ⟹ XP_063135001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,095,859 (-) NCBI
RefSeq Acc Id:
XM_063278932 ⟹ XP_063135002
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,095,686 (-) NCBI
RefSeq Acc Id:
XM_063278933 ⟹ XP_063135003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,103,551 (-) NCBI
RefSeq Acc Id:
XM_063278934 ⟹ XP_063135004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,095,846 (-) NCBI
RefSeq Acc Id:
XM_063278935 ⟹ XP_063135005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 13,074,141 - 13,095,609 (-) NCBI
RefSeq Acc Id:
NP_446292 ⟸ NM_053840
- UniProtKB:
Q6AZ32 (UniProtKB/Swiss-Prot), Q63218 (UniProtKB/Swiss-Prot), Q63217 (UniProtKB/Swiss-Prot), P07314 (UniProtKB/Swiss-Prot), A6JKJ2 (UniProtKB/TrEMBL)
- Sequence:
MKNRFLVLGLVAVVLVFVIIGLCIWLPTTSGKPDHVYSRAAVATDAKRCSEIGRDMLQEGGSVVDAAIASLLCMGLINAHSMGIGGGLFFTIYNSTTRKAEVINAREMAPRLANTSMFNNSKDSEEGG
hide sequence
Ensembl Acc Id:
ENSRNOP00000076317 ⟸ ENSRNOT00000093521
Ensembl Acc Id:
ENSRNOP00000076324 ⟸ ENSRNOT00000093430
Ensembl Acc Id:
ENSRNOP00000065923 ⟸ ENSRNOT00000074533
RefSeq Acc Id:
XP_038954313 ⟸ XM_039098385
- Peptide Label:
isoform X1
- UniProtKB:
Q6AZ32 (UniProtKB/Swiss-Prot), Q63218 (UniProtKB/Swiss-Prot), Q63217 (UniProtKB/Swiss-Prot), P07314 (UniProtKB/Swiss-Prot), A6JKJ2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038954311 ⟸ XM_039098383
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038954310 ⟸ XM_039098382
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038954312 ⟸ XM_039098384
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135003 ⟸ XM_063278933
- Peptide Label:
isoform X1
- UniProtKB:
Q6AZ32 (UniProtKB/Swiss-Prot), Q63218 (UniProtKB/Swiss-Prot), Q63217 (UniProtKB/Swiss-Prot), P07314 (UniProtKB/Swiss-Prot), A6JKJ2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135001 ⟸ XM_063278931
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135004 ⟸ XM_063278934
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135002 ⟸ XM_063278932
- Peptide Label:
isoform X1
- UniProtKB:
Q6AZ32 (UniProtKB/Swiss-Prot), Q63218 (UniProtKB/Swiss-Prot), Q63217 (UniProtKB/Swiss-Prot), P07314 (UniProtKB/Swiss-Prot), A6JKJ2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135005 ⟸ XM_063278935
- Peptide Label:
isoform X1
- UniProtKB:
Q6AZ32 (UniProtKB/Swiss-Prot), Q63218 (UniProtKB/Swiss-Prot), Q63217 (UniProtKB/Swiss-Prot), P07314 (UniProtKB/Swiss-Prot), A6JKJ2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-08-29
Ggt1
gamma-glutamyltransferase 1
Ggtp
gamma-glutamyl transpeptidase
Data merged from RGD:628784
737654 APPROVED
2004-09-10
Ggt1
gamma-glutamyltransferase 1
Gamma glutamyl-transferase 1
Name updated
1299863 APPROVED
2003-02-27
Ggtp
gamma-glutamyl transpeptidase
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Ggt1
Gamma glutamyl-transferase 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in the proximal convolutions of the renal tubule of the kidney
632765
gene_regulation
mRNAs increases from birth to the adult stage
632765
gene_transcript
contains 8 exons and has two CCAAT boxes
632655
