Edn2 (endothelin 2) - Rat Genome Database

Name: Edn2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Edn2 (endothelin 2) Rattus norvegicus

Analyze

Symbol:

Edn2

Name:

endothelin 2

RGD ID:

2533

Description:

Predicted to enable endothelin B receptor binding activity and hormone activity. Involved in several processes, including ovarian follicle rupture; phospholipase C-activating G protein-coupled receptor signaling pathway; and regulation of hormone secretion. Located in extracellular space. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human EDN2 (endothelin 2); PARTICIPATES IN endothelin signaling pathway; INTERACTS WITH ammonium chloride; bisphenol A; BQ 123.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Endothelin isopeptide 2; endothelin-2; ET-2; Et2; PPET2; preproendothelin-2; RNEDN2S01; vasoactive intestinal contractor; VIC

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDN2 (endothelin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Edn2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Edn2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EDN2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EDN2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Edn2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EDN2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EDN2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Edn2 (endothelin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HTATIP2 (HIV-1 Tat interactive protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EDN2 (endothelin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Edn2 (endothelin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	edn2 (endothelin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Is Marker For:

QTLs: Bp7

Candidate Gene For:

Bp7

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	139,036,576 - 139,042,074 (+)	NCBI		GRCr8
mRatBN7.2	5	133,751,316 - 133,756,814 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	133,751,217 - 133,756,814 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	136,479,131 - 136,484,624 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	138,235,562 - 138,241,057 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	138,256,179 - 138,261,668 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	139,098,472 - 139,106,396 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	139,100,898 - 139,105,792 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,891,221 - 142,896,115 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	140,742,686 - 140,747,580 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	140,747,827 - 140,753,399 (+)	NCBI
Celera	5	132,309,615 - 132,315,113 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aortic Rupture (ISO)

Bradycardia (ISO)

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

Dissecting Aneurysm (ISO)

hypertension (ISO)

Hypotension (ISO)

myocardial infarction (IEP)

pre-eclampsia (ISO)

pulmonary hypertension (ISO)

Reperfusion Injury (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

afimoxifene (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

aspartame (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

BQ 123 (EXP)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP)

cadmium dichloride (ISO)

calcium atom (ISO)

calcium(0) (ISO)

cisplatin (ISO)

cobalt atom (ISO)

cobalt dichloride (EXP,ISO)

copper(II) chloride (ISO)

corticosterone (EXP)

cyclosporin A (ISO)

dextran sulfate (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

ethanol (ISO)

fenvalerate (EXP)

folic acid (ISO)

gemcitabine (ISO)

genistein (ISO)

hydroquinone (ISO)

ibuprofen (ISO)

lead diacetate (ISO)

mifepristone (EXP)

mono(2-ethylhexyl) phthalate (ISO)

naphthalene (ISO)

nickel dichloride (ISO)

paracetamol (ISO)

pentanal (ISO)

perfluorohexanesulfonic acid (ISO)

pirinixic acid (ISO)

propanal (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

tamibarotene (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

tricetin (ISO)

trichloroethene (EXP)

Tungsten carbide (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IEA,ISO)

artery smooth muscle contraction (IEA,ISO)

axon extension (IEA,ISO)

cell tip growth (IEA,ISO)

cytokine-mediated signaling pathway (IEA,ISO)

endothelial cell migration (IEA,ISO)

energy homeostasis (IEA,ISO)

intracellular calcium ion homeostasis (IBA)

lung alveolus development (IEA,ISO)

macrophage activation (IEA,ISO)

macrophage chemotaxis (IEA,ISO)

negative regulation of hormone secretion (IDA)

neuron projection development (ISO)

neutrophil chemotaxis (IEA,ISO)

ovarian follicle rupture (IDA)

phospholipase C-activating G protein-coupled receptor signaling pathway (IMP)

positive regulation of calcium-mediated signaling (IEA,ISO)

positive regulation of cell population proliferation (IEA,ISO)

positive regulation of heart rate (IEA,ISO)

positive regulation of hormone secretion (IDA)

positive regulation of leukocyte chemotaxis (IEA,ISO)

positive regulation of prostaglandin-endoperoxide synthase activity (ISO)

positive regulation of smooth muscle contraction (IBA,IDA,IEA,ISO)

prostaglandin biosynthetic process (IEA,ISO)

regulation of systemic arterial blood pressure by endothelin (IBA,IEA,ISO)

regulation of vasoconstriction (IEA)

smooth muscle contraction (ISO)

temperature homeostasis (IEA,ISO)

vasculature development (ISO)

vasoconstriction (ISO)

vein smooth muscle contraction (IBA,IEA,ISO)

Cellular Component

extracellular space (IBA,IDA,IEA,ISO)

Molecular Function

endothelin B receptor binding (IBA,IEA,ISO)

hormone activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endothelin signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	cDNA cloning and chromosomal assignment of the endothelin 2 gene: vasoactive intestinal contractor peptide is rat endothelin 2.	Bloch KD, etal., Genomics 1991 May;10(1):236-42.
2.	Association between diastolic blood pressure and variants of the endothelin-1 and endothelin-2 genes.	Brown MJ, etal., J Cardiovasc Pharmacol. 2000;35(4 Suppl 2):S41-43.
3.	Endothelin release during ischaemia and reperfusion of isolated perfused rat hearts.	Brunner F, etal., J Mol Cell Cardiol. 1992 Nov;24(11):1291-305.
4.	Broadly altered gene expression in blood leukocytes in essential hypertension is absent during treatment.	Chon H, etal., Hypertension. 2004 May;43(5):947-51. Epub 2004 Mar 8.
5.	Regional and maturation-associated expression of endothelin 2 in rat gastrointestinal tract.	de la Monte SM, etal., J Histochem Cytochem. 1995 Feb;43(2):203-9.
6.	Structure and organization of the rat endothelin-2 gene.	Deng AY Mamm Genome 1997 Feb;8(2):157.
7.	Genetic mapping of two new blood pressure quantitative trait loci in the rat by genotyping endothelin system genes.	Deng AY, etal., J Clin Invest 1994 Jun;93(6):2701-9
8.	The effect of endothelin-1, endothelin-2 and endothelin-3 in early cerulein-induced acute pancreatitis in rats.	Dlugosz JW, etal., Rocz Akad Med Bialymst. 2004;49:85-92.
9.	Inhibition by phosphoramidon of the regional haemodynamic effects of proendothelin-2 and -3 in conscious rats.	Gardiner SM, etal., Br J Pharmacol. 1992 Oct;107(2):584-90.
10.	Genome scan and congenic strains for blood pressure QTL using Dahl salt-sensitive rats.	Garrett MR, etal., Genome Res 1998 Jul;8(7):711-23
11.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
13.	Potent constrictor actions of endothelin-1, endothelin-2, and endothelin-3 in rat isolated portal vein.	Guimaraes CL, etal., Hypertension. 1992 Feb;19(2 Suppl):II79-86.
14.	Myocardial expression of endothelin-2 is altered reciprocally to that of endothelin-1 during ischemia of cardiomyocytes in vitro and during heart failure in vivo.	Kakinuma Y, etal., Life Sci. 1999;65(16):1671-83.
15.	Endothelin activation of an inwardly rectifying K+ current in atrial cells.	Kim D Circ Res. 1991 Jul;69(1):250-5.
16.	Endothelin-2 in ovarian follicle rupture.	Ko C, etal., Endocrinology. 2006 Apr;147(4):1770-9. Epub 2006 Jan 12.
17.	Serum level of endothelin-1 and -2 in pregnancies complicated by EPH gestosis.	Leszczynska-Gorzelak B, etal., Gynecol Obstet Invest. 1997;43(1):37-40.
18.	Comparison of the cardiovascular and neural activity of endothelin-1, -2, -3 and respective proendothelins: effects of phosphoramidon and thiorphan.	Mattera GG, etal., Br J Pharmacol. 1993 Sep;110(1):331-7.
19.	Endothelins stimulate deoxyribonucleic acid synthesis and cell proliferation in rat adrenal zona glomerulosa, acting through an endothelin A receptor coupled with protein kinase C- and tyrosine kinase-dependent signaling pathways.	Mazzocchi G, etal., Endocrinology. 1997 Jun;138(6):2333-7.
20.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
21.	Inhibitory and facilitatory presynaptic effects of endothelin on sympathetic cotransmission in the rat isolated tail artery.	Mutafova-Yambolieva VN and Westfall DP, Br J Pharmacol. 1998 Jan;123(1):136-42.
22.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.	Contractile responses of smooth muscle cells differentiated from rat neural stem cells.	Oishi K, etal., J Physiol. 2002 Apr 1;540(Pt 1):139-52.
24.	Contractile responses and myosin phosphorylation in reconstituted fibers of smooth muscle cells from the rat cerebral artery.	Oishi K, etal., Jpn J Pharmacol. 2002 Sep;90(1):36-50.
25.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.	Differential effects of ET-1, ET-2, and ET-3 on pancreatic microcirculation, tissue integrity, and inflammation.	Plusczyk T, etal., Dig Dis Sci. 2001 Jun;46(6):1343-51.
27.	GOA pipeline	RGD automated data pipeline
28.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	[Plasma concentrations of endothelin-1 and endothelin-2 in patients with pulmonary hypertension]	Salomon P, etal., Pol Merkuriusz Lek. 1999 Sep;7(39):111-3.
31.	Comparison of the pituitary effects of the mammalian endothelins: vasoactive intestinal contractor (endothelin-beta, rat endothelin-2) is a potent inhibitor of prolactin secretion.	Samson WK and Skala KD, Endocrinology. 1992 May;130(5):2964-70.
32.	Endothelin-mediated calcium signaling in preglomerular smooth muscle cells.	Schroeder AC, etal., Hypertension. 2000 Jan;35(1 Pt 2):280-6.
33.	Quantitative association between a newly identified molecular variant in the endothelin-2 gene and human essential hypertension.	Sharma P, etal., J Hypertens. 1999 Sep;17(9):1281-7.
34.	Endothelins induce Fos expression in neurons and glia in organotypic cultures of rat cerebellum.	Sullivan AM and Morton AJ, J Neurochem. 1996 Oct;67(4):1409-18.
35.	Plasma endothelin in patients with acute aortic disease.	Wagner A, etal., Resuscitation. 2002 Apr;53(1):71-6.
36.	Contribution of endogenous endothelin to the extension of myocardial infarct size in rats.	Watanabe T, etal., Circ Res. 1991 Aug;69(2):370-7.

Additional References at PubMed

PMID:1713452	PMID:1917960	PMID:2649896	PMID:2768235	PMID:8982507	PMID:9422810	PMID:9492062	PMID:9696419	PMID:12207323	PMID:15691296	PMID:15948191	PMID:20450830
PMID:22406300	PMID:22874467	PMID:22972036	PMID:23676500	PMID:23941276	PMID:25613530

Genomics

Comparative Map Data

Edn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	139,036,576 - 139,042,074 (+)	NCBI		GRCr8
mRatBN7.2	5	133,751,316 - 133,756,814 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	133,751,217 - 133,756,814 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	136,479,131 - 136,484,624 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	138,235,562 - 138,241,057 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	138,256,179 - 138,261,668 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	139,098,472 - 139,106,396 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	139,100,898 - 139,105,792 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,891,221 - 142,896,115 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	140,742,686 - 140,747,580 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	140,747,827 - 140,753,399 (+)	NCBI
Celera	5	132,309,615 - 132,315,113 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

EDN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	41,478,775 - 41,484,683 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	41,478,775 - 41,484,683 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	41,944,446 - 41,950,354 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	41,717,033 - 41,722,884 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	41,613,539 - 41,619,390	NCBI
Celera	1	40,227,695 - 40,233,596 (-)	NCBI		Celera
Cytogenetic Map	1	p34.2	NCBI
HuRef	1	40,062,640 - 40,068,539 (-)	NCBI		HuRef
CHM1_1	1	42,060,834 - 42,066,733 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	41,348,976 - 41,370,636 (-)	NCBI		T2T-CHM13v2.0

Edn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	120,018,403 - 120,024,557 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	120,018,403 - 120,024,557 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	120,161,206 - 120,167,360 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	120,161,206 - 120,167,360 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	119,834,029 - 119,839,965 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	119,659,068 - 119,664,996 (+)	NCBI		MGSCv36	mm8
Celera	4	118,876,990 - 118,882,911 (+)	NCBI		Celera
Cytogenetic Map	4	D2.1	NCBI
cM Map	4	55.77	NCBI

Edn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955537	1,228,070 - 1,233,797 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955537	1,228,062 - 1,233,784 (-)	NCBI	ChiLan1.0	ChiLan1.0

EDN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	185,326,860 - 185,334,257 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	184,468,920 - 184,476,318 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	40,777,582 - 40,783,410 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	42,092,811 - 42,098,721 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	42,092,811 - 42,098,721 (-)	Ensembl	panpan1.1		panPan2

EDN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	1,647,966 - 1,654,272 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	1,648,077 - 1,654,272 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	1,906,346 - 1,911,819 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	1,736,878 - 1,742,351 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	1,736,155 - 1,742,351 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	1,643,415 - 1,648,886 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	1,703,305 - 1,708,777 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	1,718,751 - 1,724,224 (+)	NCBI		UU_Cfam_GSD_1.0

Edn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	57,236,189 - 57,239,728 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	23,060,905 - 23,064,566 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	23,061,219 - 23,064,525 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EDN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	169,744,568 - 169,758,283 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	169,751,956 - 169,758,011 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

EDN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	91,425,979 - 91,432,609 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	91,426,747 - 91,431,973 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	25,447,580 - 25,453,538 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Edn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624892	870,259 - 877,387 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624892	861,976 - 879,044 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Edn2
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	82
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000012569
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128071929	134724733	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

D5Mco19

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5		RGD

D5Mit19

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	133,752,562 - 133,752,767 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	139,102,145 - 139,102,349	NCBI	Rnor6.0
Rnor_5.0	5	142,892,468 - 142,892,672	UniSTS	Rnor5.0
RGSC_v3.4	5	140,743,932 - 140,744,137	RGD	RGSC3.4
RGSC_v3.4	5	140,743,933 - 140,744,137	UniSTS	RGSC3.4
RGSC_v3.1	5	140,749,159 - 140,749,363	RGD
Celera	5	132,310,862 - 132,311,066	UniSTS
RH 3.4 Map	5	875.2	UniSTS
RH 3.4 Map	5	875.2	RGD
RH 2.0 Map	5	877.1	RGD
Cytogenetic Map	5	q36	UniSTS

D5Rat55

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	133,752,611 - 133,752,762 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	139,102,194 - 139,102,344	NCBI	Rnor6.0
Rnor_5.0	5	142,892,517 - 142,892,667	UniSTS	Rnor5.0
RGSC_v3.4	5	140,743,808 - 140,744,258	RGD	RGSC3.4
RGSC_v3.4	5	140,743,982 - 140,744,132	UniSTS	RGSC3.4
RGSC_v3.1	5	140,749,208 - 140,749,358	RGD
Celera	5	132,310,911 - 132,311,061	UniSTS
RH 3.4 Map	5	875.0	RGD
RH 3.4 Map	5	875.0	UniSTS
RH 2.0 Map	5	873.5	RGD
FHH x ACI Map	5	70.92	RGD
Cytogenetic Map	5	q36	UniSTS

D5Rat86

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	133,749,410 - 133,749,643 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	139,098,997 - 139,099,229	NCBI	Rnor6.0
Rnor_5.0	5	142,889,320 - 142,889,552	UniSTS	Rnor5.0
RGSC_v3.4	5	140,740,781 - 140,741,013	UniSTS	RGSC3.4
RGSC_v3.4	5	140,740,721 - 140,741,152	RGD	RGSC3.4
RGSC_v3.1	5	140,746,007 - 140,746,239	RGD
Celera	5	132,307,710 - 132,307,942	UniSTS
RH 3.4 Map	5	867.2	RGD
RH 3.4 Map	5	867.2	UniSTS
RH 2.0 Map	5	874.1	RGD
SHRSP x BN Map	5	71.7299	RGD
FHH x ACI Map	5	70.92	RGD
Cytogenetic Map	5	q36	UniSTS

RH142434

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	133,750,605 - 133,750,820 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	139,100,192 - 139,100,406	NCBI	Rnor6.0
Rnor_5.0	5	142,890,515 - 142,890,729	UniSTS	Rnor5.0
RGSC_v3.4	5	140,741,976 - 140,742,190	UniSTS	RGSC3.4
Celera	5	132,308,905 - 132,309,119	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	35	24	23	29	11	5	11	6	81	49	18	6	33	18

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH004890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U02091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012569 ⟹ ENSRNOP00000012569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	133,751,217 - 133,756,814 (+)	Ensembl
Rnor_6.0 Ensembl	5	139,100,898 - 139,105,792 (+)	Ensembl

RefSeq Acc Id:

NM_012549 ⟹ NP_036681

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	139,036,576 - 139,042,074 (+)	NCBI
mRatBN7.2	5	133,751,316 - 133,756,814 (+)	NCBI
Rnor_6.0	5	139,100,898 - 139,106,396 (+)	NCBI
Rnor_5.0	5	142,891,221 - 142,896,115 (+)	NCBI
RGSC_v3.4	5	140,742,686 - 140,747,580 (+)	RGD
Celera	5	132,309,615 - 132,315,113 (+)	NCBI

Sequence:

show sequence

ATGGTCTCCCCGGCCTGGTGTTCCATTGCTCTGGCCCTACTTTTGGCCCTGCATGAAGGGAAGG
GCCAGGCAGCTGCTACCATGGAGCAACCAGCCTCGGCACCCAAGGGCCGAGGACCCCACCTGCG
TTTTCGTCGTTGCTCCTGCAACTCCTGGCTTGACAAGGAATGTGTGTACTTCTGCCACCTGGAC
ATCATCTGGGTGAACACTGCAGGACAGACAGCTCCCTATGGCCTGGGAAACCCGCCAAGGCGCC
GGCGCCGCTCCCTGCCAAAGCGCTGCGAGTGCTCTTCTGCTGGGGACTCTGCCTGTGCCACCTT
CTGCCATCGAAGGCCCTGGCCTGAAGCTGAGGTCACCTCAAGTAGCCAGGGCCCTGCTGCTGTG
TTAGAGACTAGCAAGACGTGGACTGCTGCGGGAGACCTTCTCCAAAAGCTGAGGGACATCTCAG
CTGCCAAGCTCCAATTTGTCAGGCTACGGCCAGAGTTGACAAGAGAGGCCATCCCTGCACACTC
TAGACGGAGGAAGAGATAACACCATGAGCTGCAGGACCATTGAGAAAGACGCCCACGTGGAGAC
GGGAGGAAATGGGCAGCTACTGGGAGACCCTATGCCTATCTCCTGGGCCAAGGCCTCAGATCCT
GGTTAGCCAGACCAATCTGATGGGTTCAGCACAAGCTCTGGCCTCTCCTACAGCAGTTCTGTGC
CTTTTCACTGCCAGGGCTACCCTCAGCACCTGGACAGCAGTGCAGCCTGCTAGTGCTGGCTGCT
GGCTACCGTCCTGCTTGGAGGAGCTATGTGCAGGACAAATGAACATGCTACCTGTGTCCTACAG
AGTGTCCTGCAATCCAGGAGCAACCCCACAGCAGGACACAATTACCTAAGCCACACCTGGAGAC
TGGACAGTCATTAGGATGACTGGCATCATAGTCCTCTCTGGTTCCCCTTCCCTAGAGGCCTTGC
AACCTGTTCTCTTGGGACACTTTTGGGAACACAGAGCCTGCTATCCTTTGTTCGTCTGTATATA
ACTTATTTGCTCCGATAACGTTGAGATTCTTATTATTTATTTTAATGTATTTTTTTAGAGCCTC
AATTGTTTACTTATGAACTCATGTTTGTAATAAAGGATGAAACGATC

hide sequence

Protein Sequences


Protein RefSeqs	NP_036681	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB39213	(Get FASTA)	NCBI Sequence Viewer
	EDL80332	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012569.1
GenBank Protein	P23943	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036681 ⟸ NM_012549
- Peptide Label:	precursor
- UniProtKB:	P23943 (UniProtKB/Swiss-Prot), G3V771 (UniProtKB/TrEMBL), A6IRY1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVSPAWCSIALALLLALHEGKGQAAATMEQPASAPKGRGPHLRFRRCSCNSWLDKECVYFCHLD IIWVNTAGQTAPYGLGNPPRRRRRSLPKRCECSSAGDSACATFCHRRPWPEAEVTSSSQGPAAV LETSKTWTAAGDLLQKLRDISAAKLQFVRLRPELTREAIPAHSRRRKR hide sequence

Ensembl Acc Id:

ENSRNOP00000012569 ⟸ ENSRNOT00000012569

Protein Domains

Endothelin-like toxin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P23943-F1-model_v2	AlphaFold	P23943	1-176	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693988

Promoter ID:

EPDNEW_R4512

Type:

single initiation site

Name:

Edn2_1

Description:

endothelin 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	139,100,818 - 139,100,878	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2533	AgrOrtholog
BioCyc Gene	G2FUF-40073	BioCyc
Ensembl Genes	ENSRNOG00000009390	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012569.4	UniProtKB/TrEMBL
InterPro	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothelin_toxin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothln-like_toxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24324	UniProtKB/TrEMBL
NCBI Gene	24324	ENTREZGENE
PANTHER	PTHR13874	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13874:SF9	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Edn2	PhenoGen
PRINTS	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009390	RatGTEx
SMART	END	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IRY1	ENTREZGENE, UniProtKB/TrEMBL
	EDN2_RAT	UniProtKB/Swiss-Prot
	G3V771	ENTREZGENE, UniProtKB/TrEMBL
	P23943	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Edn2	Endothelin isopeptide 2			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in pituitary and medulla oblongata	734466

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)