Symbol:
Nfatc1
Name:
nuclear factor of activated T-cells 1
RGD ID:
2319357
Description:
Enables RNA polymerase II transcription regulatory region sequence-specific DNA binding activity and transcription coactivator binding activity. Involved in several processes, including cellular response to transforming growth factor beta stimulus; cellular response to tumor necrosis factor; and positive regulation of nucleobase-containing compound metabolic process. Located in nucleus; perinuclear region of cytoplasm; and sarcoplasm. Biomarker of kidney disease and osteoarthritis. Human ortholog(s) of this gene implicated in congenital heart disease and ventricular septal defect. Orthologous to human NFATC1 (nuclear factor of activated T cells 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100361818; nuclear factor of activated T-cells, cytoplasmic 1; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NFATC1 (nuclear factor of activated T cells 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Mus musculus (house mouse):
Nfatc1 (nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nfatc1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NFATC1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NFATC1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nfatc1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NFATC1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NFATC1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nfatc1 (nuclear factor of activated T cells 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NFATC1 (nuclear factor of activated T cells 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nfatc1 (nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nfatc1 (nuclear factor of activated T cells 1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
NFAT
Alliance
DIOPT (OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nfatc1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 76,321,386 - 76,430,997 (-) NCBI GRCr8 mRatBN7.2 18 74,046,422 - 74,156,041 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 74,046,904 - 74,156,028 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 76,149,324 - 76,258,603 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 76,818,657 - 76,927,924 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 74,664,215 - 74,773,420 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 77,203,517 - 77,322,690 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 77,203,525 - 77,322,690 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 76,309,900 - 76,426,095 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 77,498,654 - 77,581,231 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 72,704,426 - 72,813,069 (-) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nfatc1 Rat (-)-matairesinol multiple interactions ISO RGD:1557692 6480464 matairesinol inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:24444335 Nfatc1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1557692 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NFATC1 mRNA CTD PMID:36331819 Nfatc1 Rat 1,2-dichloroethane decreases expression ISO RGD:1557692 6480464 ethylene dichloride results in decreased expression of NFATC1 mRNA CTD PMID:28960355 Nfatc1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1557692 6480464 1,2-Dimethylhydrazine results in increased expression of NFATC1 mRNA CTD PMID:22206623 Nfatc1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of NFATC1 mRNA CTD PMID:27291303 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1557692 6480464 Tetrachlorodibenzodioxin results in increased expression of NFATC1 mRNA CTD PMID:20819909|PMID:24058054 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NFATC1 mRNA CTD PMID:33387578 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1557692 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to NFATC1 gene] CTD PMID:20819909 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1557692 6480464 Tetrachlorodibenzodioxin affects the expression of NFATC1 mRNA CTD PMID:21570461 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects localization ISO RGD:1346235 6480464 Tetrachlorodibenzodioxin affects the localization of NFATC1 protein CTD PMID:19028555 Nfatc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1346235 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin affects the localization of NFATC1 protein]; Cyclosporine inhibits the reaction more ... CTD PMID:19028555 Nfatc1 Rat 2-aminopurine multiple interactions ISO RGD:1557692 6480464 2-Aminopurine inhibits the reaction [TNF protein affects the localization of NFATC1 protein]; 2-Aminopurine inhibits the more ... CTD PMID:25739386 Nfatc1 Rat 2-tert-butylhydroquinone multiple interactions ISO RGD:1557692 6480464 [TNFSF11 protein co-treated with CSF1 protein co-treated with 2-tert-butylhydroquinone] results in decreased expression of NFATC1 more ... CTD PMID:23112101 Nfatc1 Rat 3'-O-(4-Benzoyl)benzoyl ATP affects localization ISO RGD:1557692 6480464 3'-O-(4-benzoyl)benzoyladenosine 5'-triphosphate affects the localization of NFATC1 protein CTD PMID:26522449 Nfatc1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1557692 6480464 4,4'-diaminodiphenylmethane results in decreased expression of NFATC1 mRNA CTD PMID:18648102 Nfatc1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1557692 6480464 bisphenol S results in decreased expression of NFATC1 mRNA CTD PMID:39298647 Nfatc1 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1346235 6480464 bisphenol S results in increased methylation of NFATC1 gene CTD PMID:31601247 Nfatc1 Rat 4-amino-5-chloro-N-[1-[3-(4-fluorophenoxy)propyl]-3-methoxy-4-piperidinyl]-2-methoxybenzamide multiple interactions ISO RGD:1557692 6480464 Cisapride inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:31150804 Nfatc1 Rat 4-hydroxynon-2-enal decreases expression ISO RGD:1346235 6480464 4-hydroxy-2-nonenal results in decreased expression of NFATC1 mRNA CTD PMID:12419474 Nfatc1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1557692 6480464 Fenretinide results in decreased expression of NFATC1 mRNA CTD PMID:16467112 Nfatc1 Rat 5-aza-2'-deoxycytidine decreases expression ISO RGD:1346235 6480464 Decitabine results in decreased expression of NFATC1 mRNA CTD PMID:17785578 Nfatc1 Rat 5-azacytidine increases expression ISO RGD:1346235 6480464 Azacitidine results in increased expression of NFATC1 mRNA CTD PMID:20823114 Nfatc1 Rat 8-bromo-3',5'-cyclic GMP affects localization ISO RGD:1557692 6480464 8-bromocyclic GMP affects the localization of NFATC1 protein CTD PMID:16533816 Nfatc1 Rat 9-phenanthrol multiple interactions ISO RGD:1557692 6480464 9-phenanthrol inhibits the reaction [Lipopolysaccharides affects the localization of NFATC1 protein] CTD PMID:27246103 Nfatc1 Rat aflatoxin B1 affects methylation ISO RGD:1346235 6480464 Aflatoxin B1 affects the methylation of NFATC1 intron CTD PMID:30157460 Nfatc1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1346235 6480464 aflatoxin B2 results in increased methylation of NFATC1 intron CTD PMID:30157460 Nfatc1 Rat Alisol B multiple interactions ISO RGD:1557692 6480464 alisol B inhibits the reaction [[RANK Ligand co-treated with Macrophage Colony-Stimulating Factor] results in increased more ... CTD PMID:20412788 Nfatc1 Rat all-trans-retinoic acid multiple interactions ISO RGD:1557692 6480464 Ro 41-5253 inhibits the reaction [Tretinoin inhibits the reaction [TNFSF11 protein results in increased expression more ... CTD PMID:17291456 Nfatc1 Rat alpha-naphthoflavone multiple interactions ISO RGD:1346235 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin affects the localization of NFATC1 protein] CTD PMID:19028555 Nfatc1 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of NFATC1 mRNA CTD PMID:35163327 Nfatc1 Rat apocynin multiple interactions ISO RGD:1346235 6480464 acetovanillone inhibits the reaction [[sodium arsenite results in increased abundance of arsenite] which affects the more ... CTD PMID:22564430 Nfatc1 Rat arsane affects methylation ISO RGD:1346235 6480464 Arsenic affects the methylation of NFATC1 gene CTD PMID:25304211 Nfatc1 Rat arsane decreases methylation ISO RGD:1346235 6480464 Arsenic results in decreased methylation of NFATC1 gene CTD PMID:27838757 Nfatc1 Rat arsenic atom affects methylation ISO RGD:1346235 6480464 Arsenic affects the methylation of NFATC1 gene CTD PMID:25304211 Nfatc1 Rat arsenic atom decreases methylation ISO RGD:1346235 6480464 Arsenic results in decreased methylation of NFATC1 gene CTD PMID:27838757 Nfatc1 Rat arsenite(3-) multiple interactions ISO RGD:1346235 6480464 [sodium arsenite results in increased abundance of arsenite] which affects the localization of NFATC1 protein; more ... CTD PMID:22564430 Nfatc1 Rat arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of NFATC1 mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:34037972 Nfatc1 Rat arsenous acid multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in increased expression of NFATC1 mRNA]; Phloretin inhibits more ... CTD PMID:34037972 Nfatc1 Rat ATP affects localization EXP 6480464 Adenosine Triphosphate affects the localization of NFATC1 protein CTD PMID:21464294 Nfatc1 Rat ATP multiple interactions ISO RGD:1557692 6480464 azetidine analog inhibits the reaction [Adenosine Triphosphate affects the localization of NFATC1 protein] CTD PMID:26522449 Nfatc1 Rat ATP affects localization ISO RGD:1557692 6480464 Adenosine Triphosphate affects the localization of NFATC1 protein CTD PMID:26522449 Nfatc1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of NFATC1 gene CTD PMID:28931070|PMID:35440735 Nfatc1 Rat azetidine multiple interactions ISO RGD:1557692 6480464 azetidine analog inhibits the reaction [Adenosine Triphosphate affects the localization of NFATC1 protein] CTD PMID:26522449 Nfatc1 Rat benzamide multiple interactions ISO RGD:1557692 6480464 benzamide analog inhibits the reaction [[CSF1 protein co-treated with TNFSF11 protein] results in increased expression more ... CTD PMID:29935282 Nfatc1 Rat benzene increases expression ISO RGD:1346235 6480464 Benzene results in increased expression of NFATC1 mRNA CTD PMID:19162166 Nfatc1 Rat benzo[a]pyrene decreases expression ISO RGD:1346235 6480464 Benzo(a)pyrene results in decreased expression of NFATC1 mRNA CTD PMID:20064835 Nfatc1 Rat benzo[a]pyrene affects methylation ISO RGD:1346235 6480464 Benzo(a)pyrene affects the methylation of NFATC1 3' UTR; Benzo(a)pyrene affects the methylation of NFATC1 intron CTD PMID:27901495|PMID:30157460 Nfatc1 Rat benzo[a]pyrene increases methylation ISO RGD:1346235 6480464 Benzo(a)pyrene results in increased methylation of NFATC1 exon; Benzo(a)pyrene results in increased methylation of NFATC1 more ... CTD PMID:27901495 Nfatc1 Rat benzo[a]pyrene multiple interactions ISO RGD:1557692 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Nfatc1 Rat benzo[a]pyrene increases expression ISO RGD:1557692 6480464 Benzo(a)pyrene results in increased expression of NFATC1 mRNA CTD PMID:22228805 Nfatc1 Rat benzo[b]fluoranthene multiple interactions ISO RGD:1557692 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Nfatc1 Rat benzo[e]pyrene increases methylation ISO RGD:1346235 6480464 benzo(e)pyrene results in increased methylation of NFATC1 intron CTD PMID:30157460 Nfatc1 Rat benzyl isothiocyanate multiple interactions ISO RGD:1557692 6480464 benzyl isothiocyanate inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:35920443 Nfatc1 Rat bisphenol A decreases expression ISO RGD:1557692 6480464 bisphenol A results in decreased expression of NFATC1 mRNA CTD PMID:23900028|PMID:26063408 Nfatc1 Rat bisphenol A decreases methylation ISO RGD:1346235 6480464 bisphenol A results in decreased methylation of NFATC1 gene CTD PMID:31601247 Nfatc1 Rat bisphenol A multiple interactions ISO RGD:1346235 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NFATC1 gene CTD PMID:31601247 Nfatc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NFATC1 mRNA CTD PMID:34947998 Nfatc1 Rat bisphenol A increases expression ISO RGD:1557692 6480464 bisphenol A results in increased expression of NFATC1 mRNA CTD PMID:32156529|PMID:34585602 Nfatc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NFATC1 mRNA CTD PMID:30816183|PMID:32528016 Nfatc1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NFATC1 gene CTD PMID:28505145 Nfatc1 Rat bisphenol A affects methylation ISO RGD:1557692 6480464 bisphenol A affects the methylation of NFATC1 promoter CTD PMID:27334623 Nfatc1 Rat buta-1,3-diene decreases expression ISO RGD:1557692 6480464 1,3-butadiene results in decreased expression of NFATC1 mRNA CTD PMID:29038090 Nfatc1 Rat cadmium atom multiple interactions ISO RGD:1557692 6480464 1,2-bis(2-aminophenoxy)ethane N,N,N',N'-tetraacetic acid acetoxymethyl ester affects the reaction [[Cadmium co-treated with TNFSF11 protein co-treated with more ... CTD PMID:32522522|PMID:38896780 Nfatc1 Rat cadmium atom increases expression ISO RGD:1557692 6480464 Cadmium results in increased expression of NFATC1 protein CTD PMID:38896780 Nfatc1 Rat Calcimycin multiple interactions ISO RGD:1346235 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] affects the localization of NFATC1 protein; [Tetradecanoylphorbol Acetate co-treated with more ... CTD PMID:21603612|PMID:24244623 Nfatc1 Rat Calcimycin affects localization ISO RGD:1557692 6480464 Calcimycin affects the localization of NFATC1 protein CTD PMID:27246103 Nfatc1 Rat carbon nanotube decreases expression ISO RGD:1557692 6480464 Nanotubes, Carbon analog results in decreased expression of NFATC1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Nfatc1 Rat chlordecone decreases expression ISO RGD:1557692 6480464 Chlordecone results in decreased expression of NFATC1 mRNA CTD PMID:29980752 Nfatc1 Rat chlorpromazine multiple interactions ISO RGD:1557692 6480464 Chlorpromazine inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:21869564 Nfatc1 Rat choline multiple interactions ISO RGD:1557692 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Nfatc1 Rat chromium(3+) trichloride multiple interactions ISO RGD:1557692 6480464 [cobaltous chloride co-treated with chromic chloride] results in increased expression of NFATC1 mRNA CTD PMID:25966675 Nfatc1 Rat chrysene multiple interactions ISO RGD:1557692 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Nfatc1 Rat cisapride multiple interactions ISO RGD:1557692 6480464 Cisapride inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:31150804 Nfatc1 Rat cisplatin decreases expression ISO RGD:1346235 6480464 Cisplatin results in decreased expression of NFATC1 mRNA CTD PMID:27392435 Nfatc1 Rat cobalt dichloride multiple interactions ISO RGD:1557692 6480464 [cobaltous chloride co-treated with chromic chloride] results in increased expression of NFATC1 mRNA CTD PMID:25966675 Nfatc1 Rat cobalt dichloride increases expression ISO RGD:1557692 6480464 cobaltous chloride results in increased expression of NFATC1 mRNA CTD PMID:25966675 Nfatc1 Rat coenzyme Q10 multiple interactions ISO RGD:1557692 6480464 [coenzyme Q10 co-treated with TNFSF11 protein] affects the expression of NFATC1 mRNA; [coenzyme Q10 co-treated more ... CTD PMID:33754447 Nfatc1 Rat copper(II) sulfate increases expression ISO RGD:1346235 6480464 Copper Sulfate results in increased expression of NFATC1 mRNA CTD PMID:19549813 Nfatc1 Rat corilagin multiple interactions ISO RGD:1557692 6480464 corilagin inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA]; corilagin inhibits more ... CTD PMID:35307913 Nfatc1 Rat CU-O LINKAGE increases expression ISO RGD:1346235 6480464 cupric oxide results in increased expression of NFATC1 mRNA CTD PMID:22077320 Nfatc1 Rat cyclosporin A multiple interactions EXP 6480464 Cyclosporine inhibits the reaction [Isoproterenol affects the localization of NFATC1 protein]; Cyclosporine inhibits the reaction more ... CTD PMID:11435416|PMID:19349967 Nfatc1 Rat cyclosporin A decreases expression ISO RGD:1346235 6480464 Cyclosporine results in decreased expression of NFATC1 protein CTD PMID:24244623 Nfatc1 Rat cyclosporin A multiple interactions ISO RGD:1346235 6480464 [Cyclosporine co-treated with NGF protein] affects the localization of NFATC1 protein; [Tetradecanoylphorbol Acetate co-treated with more ... CTD PMID:19028555|PMID:24244623 Nfatc1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of NFATC1 mRNA CTD PMID:23640034 Nfatc1 Rat deoxynivalenol affects localization ISO RGD:1346235 6480464 deoxynivalenol affects the localization of NFATC1 protein CTD PMID:22846391 Nfatc1 Rat deoxynivalenol affects localization ISO RGD:1557692 6480464 deoxynivalenol affects the localization of NFATC1 protein CTD PMID:21074547 Nfatc1 Rat diarsenic trioxide multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in increased expression of NFATC1 mRNA]; Phloretin inhibits more ... CTD PMID:34037972 Nfatc1 Rat diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of NFATC1 mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:34037972 Nfatc1 Rat dibenziodolium multiple interactions ISO RGD:1346235 6480464 diphenyleneiodonium inhibits the reaction [[sodium arsenite results in increased abundance of arsenite] which affects the more ... CTD PMID:22564430 Nfatc1 Rat diosmetin multiple interactions ISO RGD:1557692 6480464 diosmetin inhibits the reaction [RANK Ligand affects the expression of NFATC1 mRNA] CTD PMID:36563736 Nfatc1 Rat dioxygen affects localization ISO RGD:1346235 6480464 Oxygen deficiency affects the localization of NFATC1 protein CTD PMID:19028555 Nfatc1 Rat dioxygen multiple interactions ISO RGD:1346235 6480464 Cyclosporine inhibits the reaction [Oxygen deficiency affects the localization of NFATC1 protein] CTD PMID:19028555 Nfatc1 Rat dorsomorphin multiple interactions ISO RGD:1346235 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nfatc1 Rat doxorubicin decreases expression ISO RGD:1346235 6480464 Doxorubicin results in decreased expression of NFATC1 mRNA CTD PMID:29803840 Nfatc1 Rat ellagic acid multiple interactions ISO RGD:1557692 6480464 Ellagic Acid inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA]; Ellagic more ... CTD PMID:32971123 Nfatc1 Rat entinostat increases expression ISO RGD:1346235 6480464 entinostat results in increased expression of NFATC1 mRNA CTD PMID:26272509|PMID:27188386 Nfatc1 Rat entinostat multiple interactions ISO RGD:1346235 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nfatc1 Rat ethanol increases expression ISO RGD:1557692 6480464 Ethanol results in increased expression of NFATC1 mRNA CTD PMID:30319688 Nfatc1 Rat folic acid multiple interactions ISO RGD:1557692 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Nfatc1 Rat formaldehyde decreases expression ISO RGD:1346235 6480464 Formaldehyde results in decreased expression of NFATC1 mRNA CTD PMID:17938736 Nfatc1 Rat formononetin multiple interactions ISO RGD:1557692 6480464 formononetin inhibits the reaction [Streptozocin results in increased expression of NFATC1 mRNA]; formononetin inhibits the more ... CTD PMID:35315182 Nfatc1 Rat FR900359 affects phosphorylation ISO RGD:1346235 6480464 FR900359 affects the phosphorylation of NFATC1 protein CTD PMID:37730182 Nfatc1 Rat fulvestrant multiple interactions ISO RGD:1346235 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NFATC1 gene CTD PMID:31601247 Nfatc1 Rat genistein multiple interactions ISO RGD:1557692 6480464 Genistein promotes the reaction [[CSF1 protein co-treated with TNFSF11 protein co-treated with Zinc Sulfate] results more ... CTD PMID:17295206 Nfatc1 Rat ginsenoside Rb1 multiple interactions ISO RGD:1557692 6480464 ginsenoside Rb1 inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:22386813 Nfatc1 Rat glyburide multiple interactions ISO RGD:1557692 6480464 Glyburide inhibits the reaction [Lipopolysaccharides affects the localization of NFATC1 protein]; Glyburide inhibits the reaction more ... CTD PMID:27246103 Nfatc1 Rat GSK-J4 increases expression ISO RGD:1346235 6480464 GSK-J4 results in increased expression of NFATC1 mRNA CTD PMID:29301935 Nfatc1 Rat harmine affects localization ISO RGD:1346235 6480464 Harmine affects the localization of NFATC1 protein CTD PMID:25751815 Nfatc1 Rat hydrogen peroxide multiple interactions ISO RGD:1557692 6480464 [Hydrogen Peroxide co-treated with TNFSF11 protein] affects the expression of NFATC1 mRNA; [Hydrogen Peroxide co-treated more ... CTD PMID:12203019|PMID:33754447 Nfatc1 Rat hydrogen peroxide decreases activity ISO RGD:1557692 6480464 Hydrogen Peroxide results in decreased activity of NFATC1 protein CTD PMID:12203019 Nfatc1 Rat hydroxychloroquine affects expression ISO RGD:1346235 6480464 Hydroxychloroquine affects the expression of NFATC1 protein CTD PMID:28793932 Nfatc1 Rat hypoxanthine decreases activity ISO RGD:1557692 6480464 Hypoxanthine results in decreased activity of NFATC1 protein CTD PMID:12203019 Nfatc1 Rat inulin multiple interactions ISO RGD:1557692 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of NFATC1 mRNA CTD PMID:36331819 Nfatc1 Rat ionomycin multiple interactions ISO RGD:1557692 6480464 Hydrogen Peroxide inhibits the reaction [Ionomycin results in decreased phosphorylation of NFATC1 protein] CTD PMID:12203019 Nfatc1 Rat ionomycin decreases phosphorylation ISO RGD:1557692 6480464 Ionomycin results in decreased phosphorylation of NFATC1 protein CTD PMID:12203019 Nfatc1 Rat isoprenaline affects localization EXP 6480464 Isoproterenol affects the localization of NFATC1 protein CTD PMID:11435416 Nfatc1 Rat isoprenaline multiple interactions EXP 6480464 Cyclosporine inhibits the reaction [Isoproterenol affects the localization of NFATC1 protein]; Isoproterenol promotes the reaction more ... CTD PMID:11435416 Nfatc1 Rat KN-93 multiple interactions ISO RGD:1557692 6480464 KN 93 affects the reaction [[Cadmium co-treated with TNFSF11 protein co-treated with CSF1R protein] affects more ... CTD PMID:32522522 Nfatc1 Rat L-methionine multiple interactions ISO RGD:1557692 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Nfatc1 Rat lead(0) increases expression ISO RGD:1557692 6480464 Lead results in increased expression of NFATC1 mRNA CTD PMID:26518054 Nfatc1 Rat Licochalcone B increases expression ISO RGD:1346235 6480464 licochalcone B results in increased expression of NFATC1 mRNA CTD PMID:33647349 Nfatc1 Rat lipopolysaccharide decreases expression ISO RGD:1557692 6480464 Lipopolysaccharides results in decreased expression of NFATC1 mRNA CTD PMID:22185406 Nfatc1 Rat lipopolysaccharide affects localization ISO RGD:1557692 6480464 Lipopolysaccharides affects the localization of NFATC1 protein CTD PMID:27246103 Nfatc1 Rat lipopolysaccharide multiple interactions ISO RGD:1346235 6480464 EIF2AK2 protein affects the reaction [Lipopolysaccharides promotes the reaction [TNFSF11 protein results in increased expression more ... CTD PMID:27718290 Nfatc1 Rat lipopolysaccharide multiple interactions ISO RGD:1557692 6480464 1-(2-(3-(4-methoxyphenyl)propoxy)-4-methoxyphenylethyl)-1H-imidazole inhibits the reaction [Lipopolysaccharides affects the localization of NFATC1 protein]; 9-phenanthrol inhibits the reaction more ... CTD PMID:27246103|PMID:30048646 Nfatc1 Rat lipopolysaccharide increases expression ISO RGD:1557692 6480464 Lipopolysaccharides results in increased expression of NFATC1 mRNA; Lipopolysaccharides results in increased expression of NFATC1 more ... CTD PMID:27246103|PMID:30048646 Nfatc1 Rat methapyrilene increases methylation ISO RGD:1346235 6480464 Methapyrilene results in increased methylation of NFATC1 intron CTD PMID:30157460 Nfatc1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of NFATC1 gene CTD PMID:35440735 Nfatc1 Rat methylglyoxal multiple interactions ISO RGD:1557692 6480464 [TNFSF11 protein co-treated with Pyruvaldehyde] affects the expression of NFATC1 mRNA CTD PMID:30217477 Nfatc1 Rat Mitoquinone multiple interactions ISO RGD:1557692 6480464 mitoquinone affects the reaction [[NFE2L2 protein affects the susceptibility to Cadmium] which affects the expression more ... CTD PMID:38896780 Nfatc1 Rat Morroniside decreases expression ISO RGD:1557692 6480464 morroniside results in decreased expression of NFATC1 mRNA CTD PMID:34638983 Nfatc1 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1557692 6480464 Acetylcysteine affects the reaction [[NFE2L2 protein affects the susceptibility to Cadmium] which affects the expression more ... CTD PMID:30742845|PMID:38896780 Nfatc1 Rat niclosamide multiple interactions ISO RGD:1557692 6480464 Niclosamide inhibits the reaction [[CSF1 protein co-treated with TNFSF11 protein] results in increased expression of more ... CTD PMID:28824321 Nfatc1 Rat niclosamide multiple interactions ISO RGD:1346235 6480464 Niclosamide inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA]; Niclosamide inhibits more ... CTD PMID:26792726 Nfatc1 Rat ochratoxin A increases expression ISO RGD:1346235 6480464 ochratoxin A results in increased expression of NFATC1 mRNA CTD PMID:29098329 Nfatc1 Rat ochratoxin A multiple interactions ISO RGD:1346235 6480464 [ochratoxin A results in increased acetylation of NFATC1 promoter] which results in increased expression of more ... CTD PMID:29098329 Nfatc1 Rat ochratoxin A increases acetylation ISO RGD:1346235 6480464 ochratoxin A results in increased acetylation of NFATC1 promoter CTD PMID:29098329 Nfatc1 Rat okadaic acid increases expression ISO RGD:1346235 6480464 Okadaic Acid results in increased expression of NFATC1 mRNA CTD PMID:38832940 Nfatc1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NFATC1 mRNA CTD PMID:25729387 Nfatc1 Rat p-menthan-3-ol increases expression ISO RGD:1346235 6480464 Menthol results in increased expression of NFATC1 mRNA CTD PMID:26760959 Nfatc1 Rat paracetamol affects expression ISO RGD:1557692 6480464 Acetaminophen affects the expression of NFATC1 mRNA CTD PMID:17562736 Nfatc1 Rat paracetamol decreases expression ISO RGD:1557692 6480464 Acetaminophen results in decreased expression of NFATC1 mRNA CTD PMID:37741353 Nfatc1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NFATC1 mRNA CTD PMID:33387578 Nfatc1 Rat paracetamol increases expression ISO RGD:1557692 6480464 Acetaminophen results in increased expression of NFATC1 mRNA CTD PMID:17585979 Nfatc1 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:1346235 6480464 perfluorohexanesulfonic acid results in decreased expression of NFATC1 mRNA CTD PMID:25812627 Nfatc1 Rat perfluorononanoic acid decreases expression ISO RGD:1346235 6480464 perfluoro-n-nonanoic acid results in decreased expression of NFATC1 mRNA CTD PMID:25812627 Nfatc1 Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:1346235 6480464 perfluorooctane sulfonic acid affects the expression of NFATC1 mRNA CTD PMID:30738844 Nfatc1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1346235 6480464 perfluorooctane sulfonic acid results in decreased expression of NFATC1 mRNA CTD PMID:25812627 Nfatc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1557692 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NFATC1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Nfatc1 Rat perfluorooctanoic acid decreases expression ISO RGD:1346235 6480464 perfluorooctanoic acid results in decreased expression of NFATC1 mRNA CTD PMID:25812627 Nfatc1 Rat phenobarbital affects expression ISO RGD:1557692 6480464 Phenobarbital affects the expression of NFATC1 mRNA CTD PMID:23091169 Nfatc1 Rat phenylephrine multiple interactions EXP 6480464 Cyclosporine inhibits the reaction [Phenylephrine results in increased localization of and results in increased activity more ... CTD PMID:12403671|PMID:19349967|PMID:28849031 Nfatc1 Rat phenylephrine affects localization EXP 6480464 Phenylephrine affects the localization of NFATC1 protein CTD PMID:28849031 Nfatc1 Rat phloretin multiple interactions EXP 6480464 Phloretin inhibits the reaction [Arsenic Trioxide results in increased expression of NFATC1 mRNA]; Phloretin inhibits more ... CTD PMID:34037972 Nfatc1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1346235 6480464 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] affects the localization of NFATC1 protein; [Tetradecanoylphorbol Acetate co-treated with more ... CTD PMID:21603612|PMID:24244623 Nfatc1 Rat platycodin D multiple interactions ISO RGD:1557692 6480464 platycodin D affects the expression of and affects the localization of NFATC1 protein CTD PMID:26184636 Nfatc1 Rat platycodin D multiple interactions EXP 6480464 platycodin D inhibits the reaction [TNFSF11 protein results in increased expression of and results in more ... CTD PMID:27739107 Nfatc1 Rat quercetin decreases expression ISO RGD:1557692 6480464 Quercetin results in decreased expression of NFATC1 mRNA CTD PMID:22185406 Nfatc1 Rat quercetin multiple interactions ISO RGD:1557692 6480464 Quercetin inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 protein] CTD PMID:19495926 Nfatc1 Rat raloxifene multiple interactions ISO RGD:1346235 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of NFATC1 mRNA CTD PMID:19059307 Nfatc1 Rat resveratrol multiple interactions ISO RGD:1346235 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of NFATC1 mRNA; Resveratrol inhibits the more ... CTD PMID:16267019|PMID:23557933 Nfatc1 Rat Ro 41-5253 multiple interactions ISO RGD:1557692 6480464 Ro 41-5253 inhibits the reaction [Tretinoin inhibits the reaction [TNFSF11 protein results in increased expression more ... CTD PMID:17291456 Nfatc1 Rat rotenone multiple interactions ISO RGD:1346235 6480464 Rotenone inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA]; Rotenone inhibits more ... CTD PMID:19900598 Nfatc1 Rat ruxolitinib multiple interactions ISO RGD:1346235 6480464 ruxolitinib promotes the reaction [TNF protein affects the localization of NFATC1 protein] CTD PMID:22941906 Nfatc1 Rat Sanggenon C multiple interactions EXP 6480464 sanggenone C inhibits the reaction [Phenylephrine affects the localization of NFATC1 protein] CTD PMID:28849031 Nfatc1 Rat Sanggenon C multiple interactions ISO RGD:1557692 6480464 sanggenone C affects the localization of and affects the phosphorylation of and affects the expression more ... CTD PMID:28849031 Nfatc1 Rat SB 203580 multiple interactions ISO RGD:1557692 6480464 SB 203580 affects the reaction [NFE2L2 protein affects the reaction [sodium arsenite affects the expression more ... CTD PMID:30742845 Nfatc1 Rat SB 431542 multiple interactions ISO RGD:1346235 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nfatc1 Rat sclareol multiple interactions ISO RGD:1557692 6480464 sclareol inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA]; sclareol inhibits more ... CTD PMID:33423118 Nfatc1 Rat sclareol decreases expression ISO RGD:1557692 6480464 sclareol results in decreased expression of NFATC1 mRNA; sclareol results in decreased expression of NFATC1 more ... CTD PMID:33423118 Nfatc1 Rat silicon dioxide decreases expression ISO RGD:1346235 6480464 Silicon Dioxide analog results in decreased expression of NFATC1 mRNA CTD PMID:25895662 Nfatc1 Rat silicon dioxide increases expression ISO RGD:1346235 6480464 Silicon Dioxide analog results in increased expression of NFATC1 mRNA CTD PMID:23806026 Nfatc1 Rat silver atom increases expression ISO RGD:1557692 6480464 Silver results in increased expression of NFATC1 mRNA CTD PMID:27131904 Nfatc1 Rat silver(0) increases expression ISO RGD:1557692 6480464 Silver results in increased expression of NFATC1 mRNA CTD PMID:27131904 Nfatc1 Rat SKF-96365 hydrochloride multiple interactions ISO RGD:1557692 6480464 1-(2-(3-(4-methoxyphenyl)propoxy)-4-methoxyphenylethyl)-1H-imidazole inhibits the reaction [Lipopolysaccharides affects the localization of NFATC1 protein] CTD PMID:27246103 Nfatc1 Rat sodium arsenite increases expression ISO RGD:1346235 6480464 sodium arsenite results in increased expression of NFATC1 mRNA CTD PMID:29528074 Nfatc1 Rat sodium arsenite multiple interactions ISO RGD:1557692 6480464 Acetylcysteine affects the reaction [NFE2L2 protein affects the reaction [sodium arsenite affects the expression of more ... CTD PMID:30742845 Nfatc1 Rat sodium arsenite affects expression ISO RGD:1557692 6480464 sodium arsenite affects the expression of NFATC1 protein CTD PMID:30742845 Nfatc1 Rat sodium arsenite multiple interactions ISO RGD:1346235 6480464 [sodium arsenite results in increased abundance of arsenite] which affects the localization of NFATC1 protein; more ... CTD PMID:22564430|PMID:29528074 Nfatc1 Rat sodium arsenite affects localization ISO RGD:1346235 6480464 sodium arsenite affects the localization of NFATC1 protein CTD PMID:29528074 Nfatc1 Rat sodium fluoride increases expression ISO RGD:1557692 6480464 Sodium Fluoride results in increased expression of NFATC1 mRNA CTD PMID:32156525 Nfatc1 Rat sodium fluoride multiple interactions ISO RGD:1557692 6480464 PTH protein inhibits the reaction [Sodium Fluoride results in increased expression of NFATC1 mRNA] CTD PMID:32156525 Nfatc1 Rat streptozocin increases expression ISO RGD:1557692 6480464 Streptozocin results in increased expression of NFATC1 mRNA; Streptozocin results in increased expression of NFATC1 more ... CTD PMID:35315182 Nfatc1 Rat streptozocin multiple interactions ISO RGD:1557692 6480464 formononetin inhibits the reaction [Streptozocin results in increased expression of NFATC1 mRNA]; formononetin inhibits the more ... CTD PMID:35315182 Nfatc1 Rat tamoxifen multiple interactions ISO RGD:1346235 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of NFATC1 mRNA CTD PMID:19059307 Nfatc1 Rat tamoxifen increases expression ISO RGD:1557692 6480464 Tamoxifen results in increased expression of NFATC1 mRNA CTD PMID:19031437 Nfatc1 Rat tert-butyl hydroperoxide decreases expression ISO RGD:1346235 6480464 tert-Butylhydroperoxide results in decreased expression of NFATC1 mRNA CTD PMID:12419474 Nfatc1 Rat tetraphene multiple interactions ISO RGD:1557692 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Nfatc1 Rat thapsigargin multiple interactions ISO RGD:1346235 6480464 Thapsigargin promotes the reaction [PPP3CA protein results in decreased phosphorylation of NFATC1 protein] CTD PMID:10898953 Nfatc1 Rat thymol multiple interactions ISO RGD:1557692 6480464 Thymol inhibits the reaction [Lipopolysaccharides results in increased expression of NFATC1 mRNA]; Thymol inhibits the more ... CTD PMID:30048646 Nfatc1 Rat thymol sulfate(1-) multiple interactions ISO RGD:1557692 6480464 Thymol inhibits the reaction [Lipopolysaccharides results in increased expression of NFATC1 mRNA]; Thymol inhibits the more ... CTD PMID:30048646 Nfatc1 Rat titanium dioxide decreases methylation ISO RGD:1557692 6480464 titanium dioxide results in decreased methylation of NFATC1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Nfatc1 Rat titanium dioxide increases methylation ISO RGD:1557692 6480464 titanium dioxide results in increased methylation of NFATC1 gene; titanium dioxide results in increased methylation more ... CTD PMID:35295148 Nfatc1 Rat tofacitinib multiple interactions ISO RGD:1346235 6480464 tofacitinib promotes the reaction [TNF protein affects the localization of NFATC1 protein] CTD PMID:22941906 Nfatc1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NFATC1 mRNA CTD PMID:25729387 Nfatc1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of NFATC1 mRNA CTD PMID:25729387 Nfatc1 Rat tributylstannane multiple interactions ISO RGD:1557692 6480464 Ro 41-5253 inhibits the reaction [tributyltin inhibits the reaction [TNFSF11 protein results in increased expression more ... CTD PMID:17291456 Nfatc1 Rat Tributyltin oxide affects localization ISO RGD:1346235 6480464 bis(tri-n-butyltin)oxide affects the localization of NFATC1 protein CTD PMID:21601586 Nfatc1 Rat Tributyltin oxide affects localization ISO RGD:1557692 6480464 bis(tri-n-butyltin)oxide affects the localization of NFATC1 protein CTD PMID:22434021 Nfatc1 Rat trimellitic anhydride increases expression ISO RGD:1557692 6480464 trimellitic anhydride results in increased expression of NFATC1 mRNA CTD PMID:19042947 Nfatc1 Rat triphenyl phosphate affects expression ISO RGD:1346235 6480464 triphenyl phosphate affects the expression of NFATC1 mRNA CTD PMID:37042841 Nfatc1 Rat triphenylstannane multiple interactions ISO RGD:1557692 6480464 triphenyltin inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 protein] CTD PMID:17291456 Nfatc1 Rat troglitazone decreases expression ISO RGD:1557692 6480464 troglitazone results in decreased expression of NFATC1 mRNA CTD PMID:28973697 Nfatc1 Rat trovafloxacin increases expression ISO RGD:1557692 6480464 trovafloxacin results in increased expression of NFATC1 mRNA CTD PMID:35537566 Nfatc1 Rat tungsten decreases expression ISO RGD:1557692 6480464 Tungsten results in decreased expression of NFATC1 mRNA CTD PMID:30912803 Nfatc1 Rat tungsten multiple interactions ISO RGD:1557692 6480464 Tungsten promotes the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:33146397 Nfatc1 Rat valproic acid affects expression ISO RGD:1346235 6480464 Valproic Acid affects the expression of NFATC1 mRNA CTD PMID:25979313 Nfatc1 Rat valproic acid affects methylation ISO RGD:1346235 6480464 Valproic Acid affects the methylation of NFATC1 gene CTD PMID:29501571 Nfatc1 Rat valproic acid increases expression ISO RGD:1346235 6480464 Valproic Acid results in increased expression of NFATC1 mRNA CTD PMID:28001369 Nfatc1 Rat valproic acid increases methylation ISO RGD:1346235 6480464 Valproic Acid results in increased methylation of NFATC1 gene CTD PMID:28853863|PMID:29154799|PMID:29201983 Nfatc1 Rat xanthohumol multiple interactions ISO RGD:1557692 6480464 xanthohumol inhibits the reaction [TNFSF11 protein results in increased expression of NFATC1 mRNA] CTD PMID:23994090 Nfatc1 Rat zinc atom multiple interactions ISO RGD:1346235 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NFATC1 mRNA CTD PMID:18593933 Nfatc1 Rat zinc sulfate multiple interactions ISO RGD:1557692 6480464 [Cryptoxanthins co-treated with Zinc Sulfate] results in decreased expression of NFATC1 mRNA; [CSF1 protein co-treated more ... CTD PMID:17295206|PMID:18636177 Nfatc1 Rat zinc(0) multiple interactions ISO RGD:1346235 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NFATC1 mRNA CTD PMID:18593933
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
Nfatc1 Rat chromatin located_in ISO RGD:1346235 1624291 PMID:15304486 RGD PMID:15304486 Nfatc1 Rat cytoplasm located_in ISO RGD:1557692 1624291 PMID:10903175, PMID:12091710, PMID:12469121, PMID:15304486, PMID:19463978, PMID:19626032, PMID:21982707, PMID:24970700, PMID:32741026 RGD PMID:10903175|PMID:12091710|PMID:12469121|PMID:15304486|PMID:19463978|PMID:19626032|PMID:21982707|PMID:24970700|PMID:32741026 Nfatc1 Rat cytoplasm located_in IEA ARBA:ARBA00026971 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Nfatc1 Rat cytoplasm is_active_in ISO RGD:1557692 1624291 PMID:23259949 RGD PMID:23259949 Nfatc1 Rat cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Nfatc1 Rat nuclear body located_in ISO RGD:1346235|UniProtKB:O95644-1|UniProtKB:O95644-10|UniProtKB:O95644-11|UniProtKB:O95644-2|UniProtKB:O95644-3|UniProtKB:O95644-4|UniProtKB:O95644-5|UniProtKB:O95644-6 1624291 RGD GO_REF:0000052 Nfatc1 Rat nucleoplasm located_in ISO RGD:1346235|UniProtKB:O95644-1|UniProtKB:O95644-10|UniProtKB:O95644-11|UniProtKB:O95644-2|UniProtKB:O95644-3|UniProtKB:O95644-4|UniProtKB:O95644-5|UniProtKB:O95644-6 1624291 RGD GO_REF:0000052 Nfatc1 Rat nucleus located_in ISO RGD:1346235 1624291 PMID:12370307 RGD PMID:12370307 Nfatc1 Rat nucleus located_in IEA UniProtKB-SubCell:SL-0191 1600115 GO_REF:0000044 UniProt GO_REF:0000044 Nfatc1 Rat nucleus is_active_in ISO RGD:1557692 1624291 PMID:23259949, PMID:32569872 RGD PMID:23259949|PMID:32569872 Nfatc1 Rat nucleus located_in IDA 10047233 PMID:14979875 UniProt Nfatc1 Rat nucleus is_active_in IBA MGI:102463|MGI:102469|MGI:103296|MGI:1859333|MGI:1920431|PANTHER:PTN000969601|RGD:1308692|RGD:1310749|RGD:2319357|UniProtKB:O94916|UniProtKB:O95644|UniProtKB:Q12968|UniProtKB:Q13469|UniProtKB:Q14934 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nfatc1 Rat nucleus located_in IEA ARBA:ARBA00026330 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Nfatc1 Rat nucleus IDA 273321615 MMO:0000679 RGD Nfatc1 Rat nucleus located_in ISO RGD:1557692 1624291 PMID:10903175, PMID:11782539, PMID:12970181, PMID:15304486, PMID:15850572, PMID:18243104, PMID:18978355, PMID:19233265, PMID:19463978, PMID:19626032, PMID:21464233, PMID:21514407, PMID:21982707, more ... RGD PMID:10903175|PMID:11782539|PMID:12970181|PMID:15304486|PMID:15850572|PMID:18243104|PMID:18978355|PMID:19233265|PMID:19463978|PMID:19626032|PMID:21464233|PMID:21514407|PMID:21982707|PMID:23990468|PMID:24039232|PMID:26644563|PMID:32741026|PMID:9515963|PMID:9515964 Nfatc1 Rat perinuclear region of cytoplasm IDA 273321615 MMO:0000679 RGD Nfatc1 Rat sarcoplasm IDA 329337341 MMO:0000679 RGD Nfatc1 Rat transcription regulator complex part_of ISO RGD:1557692 1624291 PR:Q60591|UniProtKB:Q8CD15 PMID:19561615 RGD PMID:19561615 Nfatc1 Rat transcription regulator complex part_of IBA MGI:102463|MGI:102469|MGI:1920431|PANTHER:PTN000969601|UniProtKB:Q13469 1600115 GO_REF:0000033 GO_Central GO_REF:0000033
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Nfatc1 Rat chromatin binding enables ISO RGD:1557692 1624291 PMID:24301466 RGD PMID:24301466 Nfatc1 Rat DNA binding enables ISO RGD:1557692 1624291 PMID:23980096 RGD PMID:23980096 Nfatc1 Rat DNA binding enables IEA InterPro:IPR011539|InterPro:IPR037059 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nfatc1 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO RGD:1557692 1624291 PMID:15304486 RGD PMID:15304486 Nfatc1 Rat DNA-binding transcription factor activity enables IEA InterPro:IPR008366|InterPro:IPR008967|InterPro:IPR011539|InterPro:IPR037059 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nfatc1 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables ISO RGD:1557692 1624291 PMID:15304486 RGD PMID:15304486 Nfatc1 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IBA MGI:102463|MGI:102469|MGI:103296|MGI:1920431|PANTHER:PTN000969601|UniProtKB:O94916|UniProtKB:Q12968|UniProtKB:Q14934 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nfatc1 Rat DNA-binding transcription factor binding enables ISO RGD:1557692 1624291 UniProtKB:Q92908 PMID:11889139 RGD PMID:11889139 Nfatc1 Rat DNA-binding transcription repressor activity, RNA polymerase II-specific enables ISO RGD:1557692 1624291 PMID:18408153 RGD PMID:18408153 Nfatc1 Rat mitogen-activated protein kinase p38 binding enables ISO RGD:1557692 1624291 UniProtKB:P47811 PMID:15304486 RGD PMID:15304486 Nfatc1 Rat protein binding IPI RGD:2664 9587809 RGD Nfatc1 Rat protein binding enables ISO RGD:1557692 1624291 PR:O88895|UniProtKB:P51141|UniProtKB:Q913V3-PRO_0000278754|UniProtKB:Q9WVB3 PMID:15380363, PMID:19463978, PMID:21880741, PMID:23990468 RGD PMID:15380363|PMID:19463978|PMID:21880741|PMID:23990468 Nfatc1 Rat protein binding enables ISO RGD:1346235 1624291 UniProtKB:O15294|UniProtKB:P05412|UniProtKB:P15336|UniProtKB:P16220|UniProtKB:P18846|UniProtKB:P18847|UniProtKB:P31276|UniProtKB:P51141|UniProtKB:Q08209-1|UniProtKB:Q9NSB8|UniProtKB:Q9NSC5 PMID:17882263, PMID:18218901, PMID:21880741, PMID:23468591, PMID:24954618, PMID:25609649 RGD PMID:17882263|PMID:18218901|PMID:21880741|PMID:23468591|PMID:24954618|PMID:25609649 Nfatc1 Rat protein phosphatase 2B binding enables ISO RGD:1346235 1624291 UniProtKB:P63098|UniProtKB:Q08209 PMID:10860980 RGD PMID:10860980 Nfatc1 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO RGD:1557692 1624291 PMID:15304486, PMID:18625840 RGD PMID:15304486|PMID:18625840 Nfatc1 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IBA MGI:102463|MGI:102469|MGI:1920431|PANTHER:PTN000969601|UniProtKB:O94916|UniProtKB:Q12968 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nfatc1 Rat RNA polymerase II transcription regulatory region sequence-specific DNA binding enables IMP 10047233 PMID:14979875 UniProt Nfatc1 Rat RNA polymerase II-specific DNA-binding transcription factor binding enables ISO RGD:1557692 1624291 UniProtKB:P17433 PMID:15304486 RGD PMID:15304486 Nfatc1 Rat sequence-specific DNA binding enables ISO RGD:1557692 1624291 PMID:15058383, PMID:7650004 RGD PMID:15058383|PMID:7650004 Nfatc1 Rat sequence-specific double-stranded DNA binding enables ISO RGD:1346235 1624291 PMID:28473536 RGD PMID:28473536 Nfatc1 Rat transcription coactivator binding IPI RGD:620036 7327214 RGD
(-)-matairesinol (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-aminopurine (ISO) 2-tert-butylhydroquinone (ISO) 3'-O-(4-Benzoyl)benzoyl ATP (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-5-chloro-N-[1-[3-(4-fluorophenoxy)propyl]-3-methoxy-4-piperidinyl]-2-methoxybenzamide (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 8-bromo-3',5'-cyclic GMP (ISO) 9-phenanthrol (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) Alisol B (ISO) all-trans-retinoic acid (ISO) alpha-naphthoflavone (ISO) alpha-Zearalanol (EXP) apocynin (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP) ATP (EXP,ISO) atrazine (EXP) azetidine (ISO) benzamide (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) benzyl isothiocyanate (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium atom (ISO) Calcimycin (ISO) carbon nanotube (ISO) chlordecone (ISO) chlorpromazine (ISO) choline (ISO) chromium(3+) trichloride (ISO) chrysene (ISO) cisapride (ISO) cisplatin (ISO) cobalt dichloride (ISO) coenzyme Q10 (ISO) copper(II) sulfate (ISO) corilagin (ISO) CU-O LINKAGE (ISO) cyclosporin A (EXP,ISO) decabromodiphenyl ether (EXP) deoxynivalenol (ISO) diarsenic trioxide (EXP) dibenziodolium (ISO) diosmetin (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) ellagic acid (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) formononetin (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) ginsenoside Rb1 (ISO) glyburide (ISO) GSK-J4 (ISO) harmine (ISO) hydrogen peroxide (ISO) hydroxychloroquine (ISO) hypoxanthine (ISO) inulin (ISO) ionomycin (ISO) isoprenaline (EXP) KN-93 (ISO) L-methionine (ISO) lead(0) (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) methapyrilene (ISO) methoxychlor (EXP) methylglyoxal (ISO) Mitoquinone (ISO) Morroniside (ISO) N-acetyl-L-cysteine (ISO) niclosamide (ISO) ochratoxin A (ISO) okadaic acid (ISO) oxaliplatin (EXP) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylephrine (EXP) phloretin (EXP) phorbol 13-acetate 12-myristate (ISO) platycodin D (EXP,ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) Ro 41-5253 (ISO) rotenone (ISO) ruxolitinib (ISO) Sanggenon C (EXP,ISO) SB 203580 (ISO) SB 431542 (ISO) sclareol (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) SKF-96365 hydrochloride (ISO) sodium arsenite (ISO) sodium fluoride (ISO) streptozocin (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetraphene (ISO) thapsigargin (ISO) thymol (ISO) thymol sulfate(1-) (ISO) titanium dioxide (ISO) tofacitinib (ISO) topotecan (EXP) tributylstannane (ISO) Tributyltin oxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triphenylstannane (ISO) troglitazone (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) xanthohumol (ISO) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
1.
Co-operative interactions between NFAT (nuclear factor of activated T cells) c1 and the zinc finger transcription factors Sp1/Sp3 and Egr-1 regulate MT1-MMP (membrane type 1 matrix metalloproteinase) transcription by glomerular mesangial cells.
Alfonso-Jaume MA, etal., Biochem J. 2004 Jun 15;380(Pt 3):735-47.
2.
Inhibition of calcineurin/NFAT pathway plays an essential role in renoprotective effect of tropisetron in early stage of diabetic nephropathy.
Barzegar-Fallah A, etal., Eur J Pharmacol. 2015 Nov 15;767:152-9. doi: 10.1016/j.ejphar.2015.10.019. Epub 2015 Oct 21.
3.
Upregulation of nuclear factor of activated T-cells by nerve injury contributes to development of neuropathic pain.
Cai YQ, etal., J Pharmacol Exp Ther. 2013 Apr;345(1):161-8. doi: 10.1124/jpet.112.202192. Epub 2013 Feb 5.
4.
Glycogen synthase kinase 3beta regulation of nuclear factor of activated T-cells isoform c1 in the vascular smooth muscle cell response to injury.
Chow W, etal., Exp Cell Res. 2008 Oct 1;314(16):2919-29. doi: 10.1016/j.yexcr.2008.07.010. Epub 2008 Jul 22.
5.
Dihydroartemisinin attenuates osteoclast formation and bone resorption via inhibiting the NF‑κB, MAPK and NFATc1 signaling pathways and alleviates osteoarthritis.
Ding D, etal., Int J Mol Med. 2022 Jan;49(1):4. doi: 10.3892/ijmm.2021.5059. Epub 2021 Nov 5.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Association of a tandem repeat polymorphism in NFATc1 with increased risk of perimembranous ventricular septal defect in a Chinese population.
Gu H, etal., Biochem Genet. 2011 Oct;49(9-10):592-600. doi: 10.1007/s10528-011-9434-8. Epub 2011 Apr 17.
8.
NFATc1 targets cyclin A in the regulation of vascular smooth muscle cell multiplication during restenosis.
Karpurapu M, etal., J Biol Chem. 2008 Sep 26;283(39):26577-90. doi: 10.1074/jbc.M800423200. Epub 2008 Jul 29.
9.
Endothelin-1-dependent nuclear factor of activated T lymphocyte signaling associates with transcriptional coactivator p300 in the activation of the B cell leukemia-2 promoter in cardiac myocytes.
Kawamura T, etal., Circ Res. 2004 Jun 11;94(11):1492-9. Epub 2004 Apr 29.
10.
Novel interactions between NFATc1 (Nuclear Factor of Activated T cells c1) and STAT-3 (Signal Transducer and Activator of Transcription-3) mediate G protein-coupled receptor agonist, thrombin-induced biphasic expression of cyclin D1, with first phase influencing cell migration and second phase directing cell proliferation.
Kundumani-Sridharan V, etal., J Biol Chem. 2012 Jun 29;287(27):22463-82. doi: 10.1074/jbc.M112.362996. Epub 2012 May 6.
11.
Water extract of Cnidii Rhizoma suppresses RANKL-induced osteoclastogenesis in RAW 264.7 cell by inhibiting NFATc1/c-Fos signaling and prevents ovariectomized bone loss in SD-rat.
Lee KY, etal., BMC Complement Altern Med. 2019 Aug 9;19(1):207. doi: 10.1186/s12906-019-2611-8.
12.
Correlation between NFATC1 gene polymorphisms and congenital heart disease in children.
Li CL, etal., Eur Rev Med Pharmacol Sci. 2017 Aug;21(15):3441-3446.
13.
Recombinant human erythropoietin pretreatment alleviates renal glomerular injury induced by cardiopulmonary bypass by reducing transient receptor potential channel 6-nuclear factor of activated T-cells pathway activation.
Liu X, etal., J Thorac Cardiovasc Surg. 2013 Mar 24. pii: S0022-5223(13)00274-2. doi: 10.1016/j.jtcvs.2013.02.076.
14.
PIAS1 Alleviates Hepatic Ischemia-Reperfusion Injury in Mice through a Mechanism Involving NFATc1 SUMOylation.
Luo J, etal., Dis Markers. 2022 Aug 31;2022:4988539. doi: 10.1155/2022/4988539. eCollection 2022.
15.
Increased myofiber remodelling and NFATc1-myonuclear translocation in rat postural skeletal muscle after experimental vestibular deafferentation.
Luxa N, etal., J Vestib Res. 2013;23(4-5):187-93. doi: 10.3233/VES-130499.
16.
Characterization and identification of subpopulations of mononuclear preosteoclasts induced by TNF-α in combination with TGF-β in rats.
Matsubara R, etal., PLoS One. 2012;7(10):e47930. doi: 10.1371/journal.pone.0047930. Epub 2012 Oct 24.
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Calcineurin is a potent regulator for skeletal muscle regeneration by association with NFATc1 and GATA-2.
Sakuma K, etal., Acta Neuropathol. 2003 Mar;105(3):271-80. Epub 2002 Dec 19.
20.
Association of NFATc1 gene polymorphism with ventricular septal defect in the Chinese Han population.
Shen L, etal., Chin Med J (Engl). 2013 Jan;126(1):78-81.
21.
Acute Skeletal Muscle Contractions Orchestrate Signaling Mechanisms to Trigger Nuclear NFATc1 Shuttling and Epigenetic Histone Modifications.
Suhr F, etal., Cell Physiol Biochem. 2019;52(3):633-652. doi: 10.33594/000000045.
22.
[Histopathologic features of degenerative aortic valve and its mechanisms].
Sun J, etal., Zhonghua Yi Xue Za Zhi. 2013 Jan 22;93(4):280-4.
Nfatc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 76,321,386 - 76,430,997 (-) NCBI GRCr8 mRatBN7.2 18 74,046,422 - 74,156,041 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 74,046,904 - 74,156,028 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 76,149,324 - 76,258,603 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 76,818,657 - 76,927,924 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 74,664,215 - 74,773,420 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 77,203,517 - 77,322,690 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 77,203,525 - 77,322,690 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 76,309,900 - 76,426,095 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 77,498,654 - 77,581,231 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 72,704,426 - 72,813,069 (-) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
NFATC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 79,395,930 - 79,529,323 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 79,395,856 - 79,529,325 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 77,155,930 - 77,289,323 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 75,256,760 - 75,390,311 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 75,256,759 - 75,329,165 NCBI Celera 18 73,929,368 - 74,061,687 (+) NCBI Celera Cytogenetic Map 18 q23 NCBI HuRef 18 73,783,058 - 73,914,637 (+) NCBI HuRef CHM1_1 18 77,150,992 - 77,284,501 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 79,649,928 - 79,782,943 (+) NCBI T2T-CHM13v2.0
Nfatc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 80,649,418 - 80,756,286 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 80,649,420 - 80,756,286 (-) Ensembl GRCm39 Ensembl GRCm38 18 80,606,205 - 80,713,071 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 80,606,205 - 80,713,071 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 80,802,944 - 80,909,810 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 80,768,264 - 80,875,117 (-) NCBI MGSCv36 mm8 Celera 18 81,715,612 - 81,822,471 (-) NCBI Celera Cytogenetic Map 18 E3 NCBI cM Map 18 53.66 NCBI
Nfatc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 62,558,286 - 62,674,457 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 62,558,392 - 62,674,347 (+) NCBI ChiLan1.0 ChiLan1.0
NFATC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 96,966,431 - 97,102,776 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 82,659,055 - 82,795,399 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 72,948,067 - 73,083,180 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 76,020,443 - 76,133,790 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 76,017,454 - 76,094,453 (+) Ensembl panpan1.1 panPan2
NFATC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 1,027,021 - 1,121,362 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 1,028,695 - 1,121,588 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 2,030,800 - 2,126,866 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 826,991 - 923,076 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 827,017 - 923,153 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 879,585 - 975,578 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 825,423 - 922,065 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 996,485 - 1,092,567 (-) NCBI UU_Cfam_GSD_1.0
Nfatc1
NFATC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 145,911,046 - 146,008,139 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 145,940,099 - 146,002,897 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 161,528,147 - 161,632,555 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NFATC1
Nfatc1
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 42 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000058382 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 634333 Pia19 Pristane induced arthritis QTL 19 3.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 73997140 79532029 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat
D18Rat45
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 76,330,583 - 76,330,704 (+) Marker Load Pipeline mRatBN7.2 18 74,055,619 - 74,055,742 (+) MAPPER mRatBN7.2 Rnor_6.0 18 77,212,212 - 77,212,332 NCBI Rnor6.0 Rnor_5.0 18 76,318,595 - 76,318,715 UniSTS Rnor5.0 RGSC_v3.4 18 77,510,828 - 77,511,190 RGD RGSC3.4 RGSC_v3.4 18 77,510,855 - 77,510,975 UniSTS RGSC3.4 RGSC_v3.1 18 77,584,128 - 77,584,248 RGD Celera 18 72,713,123 - 72,713,243 UniSTS RH 3.4 Map 18 794.7 RGD RH 3.4 Map 18 794.7 UniSTS RH 2.0 Map 18 106.0 RGD SHRSP x BN Map 18 47.8399 RGD FHH x ACI Map 18 58.5499 RGD Cytogenetic Map 18 q12.3 UniSTS
RH131617
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 74,088,353 - 74,088,569 (+) MAPPER mRatBN7.2 Rnor_6.0 18 77,245,143 - 77,245,358 NCBI Rnor6.0 Rnor_5.0 18 76,351,526 - 76,351,741 UniSTS Rnor5.0 RGSC_v3.4 18 77,543,588 - 77,543,803 UniSTS RGSC3.4 Celera 18 72,746,026 - 72,746,241 UniSTS RH 3.4 Map 18 794.7 UniSTS Cytogenetic Map 18 q12.3 UniSTS
RH135219
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 74,047,154 - 74,047,336 (+) MAPPER mRatBN7.2 Rnor_6.0 18 77,203,748 - 77,203,929 NCBI Rnor6.0 Rnor_5.0 18 76,310,131 - 76,310,312 UniSTS Rnor5.0 RGSC_v3.4 18 77,502,389 - 77,502,570 UniSTS RGSC3.4 Celera 18 72,704,657 - 72,704,838 UniSTS RH 3.4 Map 18 798.2 UniSTS Cytogenetic Map 18 q12.3 UniSTS
RH138517
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 74,145,749 - 74,145,905 (+) MAPPER mRatBN7.2 Rnor_6.0 18 77,312,412 - 77,312,567 NCBI Rnor6.0 Rnor_5.0 18 76,415,817 - 76,415,972 UniSTS Rnor5.0 RGSC_v3.4 18 77,583,577 - 77,583,732 UniSTS RGSC3.4 Celera 18 72,802,791 - 72,802,946 UniSTS RH 3.4 Map 18 813.4 UniSTS Cytogenetic Map 18 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058382 ⟹ ENSRNOP00000055183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 74,046,904 - 74,156,028 (-) Ensembl Rnor_6.0 Ensembl 18 77,203,525 - 77,322,690 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090369 ⟹ ENSRNOP00000070317
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 74,046,904 - 74,151,335 (-) Ensembl Rnor_6.0 Ensembl 18 77,250,850 - 77,317,969 (-) Ensembl
RefSeq Acc Id:
NM_001244933 ⟹ NP_001231862
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,430,990 (-) NCBI mRatBN7.2 18 74,046,422 - 74,156,030 (-) NCBI Rnor_6.0 18 77,203,517 - 77,322,690 (-) NCBI Rnor_5.0 18 76,309,900 - 76,426,095 (-) NCBI Celera 18 72,704,426 - 72,813,069 (-) NCBI
Sequence:
GTCAGAGTGAGACCGAGAGGCTCCGAACTGGGCGACAGAGTCGCCTCGCGGATCCGAGCGGCGGGGCACGAGCTCCCCGGCGCCGCACACACCTCCTCCCCTGGGGCGAGTCCCGGGCCGCAAGCAGG
hide sequence
RefSeq Acc Id:
NM_001415721 ⟹ NP_001402650
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,430,990 (-) NCBI mRatBN7.2 18 74,046,422 - 74,156,030 (-) NCBI
RefSeq Acc Id:
XM_063277044 ⟹ XP_063133114
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,426,309 (-) NCBI
RefSeq Acc Id:
XM_063277045 ⟹ XP_063133115
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,426,309 (-) NCBI
RefSeq Acc Id:
XM_063277046 ⟹ XP_063133116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,426,309 (-) NCBI
RefSeq Acc Id:
XR_010059532
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,430,997 (-) NCBI
RefSeq Acc Id:
XR_010059533
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,426,309 (-) NCBI
RefSeq Acc Id:
XR_010059534
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 76,321,386 - 76,430,997 (-) NCBI
RefSeq Acc Id:
NP_001231862 ⟸ NM_001244933
- Peptide Label:
isoform 1
- Sequence:
MPSTSFPVPSKFPLGPPAAVCGSGETLRPAPLAGGTMKAAEEEHYSYASPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPSGYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYL
hide sequence
Ensembl Acc Id:
ENSRNOP00000070317 ⟸ ENSRNOT00000090369
Ensembl Acc Id:
ENSRNOP00000055183 ⟸ ENSRNOT00000058382
RefSeq Acc Id:
NP_001402650 ⟸ NM_001415721
- Peptide Label:
isoform 2
- UniProtKB:
D3ZE20 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133116 ⟸ XM_063277046
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063133115 ⟸ XM_063277045
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063133114 ⟸ XM_063277044
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JXL2 (UniProtKB/TrEMBL)
RGD ID: 13700899 Promoter ID: EPDNEW_R11413 Type: multiple initiation site Name: Nfatc1_2 Description: nuclear factor of activated T-cells 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11414 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 77,317,955 - 77,318,015 EPDNEW
RGD ID: 13700890 Promoter ID: EPDNEW_R11414 Type: multiple initiation site Name: Nfatc1_1 Description: nuclear factor of activated T-cells 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11413 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 77,322,692 - 77,322,752 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-29
Nfatc1
nuclear factor of activated T-cells 1
Nfatc1
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-12-13
Nfatc1
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
LOC100361818
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-05
LOC100361818
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Symbol and Name status set to provisional
70820 PROVISIONAL
