Symbol:
Chsy3
Name:
chondroitin sulfate synthase 3
RGD ID:
1560819
Description:
Predicted to enable N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity and glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity. Predicted to be involved in chondroitin sulfate biosynthetic process. Predicted to be located in Golgi cisterna membrane. Predicted to be active in Golgi apparatus. Orthologous to human CHSY3 (chondroitin sulfate synthase 3); PARTICIPATES IN chondroitin sulfate biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
chondroitin sulfate synthase 3-like; Chsy3l; LOC291577; RGD1560819; similar to chondroitin sulfate synthase 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 54,842,260 - 55,096,008 (+) NCBI GRCr8 mRatBN7.2 18 52,644,356 - 52,901,257 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 52,644,461 - 52,898,098 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 18 54,243,626 - 54,497,475 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 54,243,949 - 54,496,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 53,477,339 - 53,731,655 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 54,963,517 - 55,273,226 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 50,748,557 - 51,001,455 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Chsy3 Rat (1->4)-beta-D-glucan multiple interactions ISO Chsy3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CHSY3 mRNA CTD PMID:36331819 Chsy3 Rat 17beta-estradiol multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of CHSY3 mRNA CTD PMID:20660070 Chsy3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CHSY3 mRNA CTD PMID:22298810 Chsy3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CHSY3 mRNA CTD PMID:32109520 Chsy3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Chsy3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CHSY3 mRNA CTD PMID:26290441 Chsy3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Chsy3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CHSY3 mRNA CTD PMID:19770486 Chsy3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Chsy3 Rat 4,4'-sulfonyldiphenol increases expression ISO Chsy3 (Mus musculus) 6480464 bisphenol S results in increased expression of CHSY3 mRNA CTD PMID:30951980 Chsy3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO CHSY3 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CHSY3 gene CTD PMID:31601247 Chsy3 Rat aristolochic acid A decreases expression ISO CHSY3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CHSY3 mRNA CTD PMID:33212167 Chsy3 Rat benzo[a]pyrene increases mutagenesis ISO CHSY3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of CHSY3 gene CTD PMID:25435355 Chsy3 Rat benzo[a]pyrene affects methylation ISO CHSY3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CHSY3 promoter CTD PMID:27901495 Chsy3 Rat benzo[a]pyrene increases methylation ISO CHSY3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CHSY3 exon CTD PMID:27901495 Chsy3 Rat benzo[a]pyrene decreases expression ISO Chsy3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CHSY3 mRNA CTD PMID:19770486 Chsy3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CHSY3 mRNA CTD PMID:25181051 Chsy3 Rat bisphenol A decreases methylation ISO CHSY3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CHSY3 gene CTD PMID:31601247 Chsy3 Rat bisphenol A decreases expression ISO CHSY3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CHSY3 mRNA and bisphenol A results in decreased expression of CHSY3 protein CTD PMID:29275510 and PMID:33376534 Chsy3 Rat bisphenol A increases expression ISO Chsy3 (Mus musculus) 6480464 bisphenol A results in increased expression of CHSY3 mRNA CTD PMID:30951980 and PMID:34585602 Chsy3 Rat bisphenol F increases expression ISO Chsy3 (Mus musculus) 6480464 bisphenol F results in increased expression of CHSY3 mRNA CTD PMID:38685157 Chsy3 Rat butanal decreases expression ISO CHSY3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CHSY3 mRNA CTD PMID:26079696 Chsy3 Rat carbon nanotube increases expression ISO Chsy3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Chsy3 Rat chlorpyrifos decreases expression ISO Chsy3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CHSY3 mRNA CTD PMID:37019170 Chsy3 Rat choline multiple interactions ISO Chsy3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CHSY3 gene CTD PMID:20938992 Chsy3 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of CHSY3 mRNA CTD PMID:22023808 Chsy3 Rat dioxygen multiple interactions ISO Chsy3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CHSY3 mRNA CTD PMID:30529165 Chsy3 Rat dorsomorphin multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHSY3 mRNA CTD PMID:27188386 Chsy3 Rat doxorubicin decreases expression ISO CHSY3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CHSY3 mRNA CTD PMID:29803840 Chsy3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CHSY3 mRNA CTD PMID:29391264 Chsy3 Rat folic acid multiple interactions ISO Chsy3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CHSY3 gene CTD PMID:20938992 Chsy3 Rat L-methionine multiple interactions ISO Chsy3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CHSY3 gene CTD PMID:20938992 Chsy3 Rat lipopolysaccharide multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of CHSY3 mRNA CTD PMID:35811015 Chsy3 Rat N-nitrosodiethylamine increases expression ISO Chsy3 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of CHSY3 mRNA CTD PMID:24535843 Chsy3 Rat paracetamol decreases expression ISO CHSY3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CHSY3 mRNA CTD PMID:26690555 Chsy3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CHSY3 mRNA CTD PMID:33387578 Chsy3 Rat paracetamol increases expression ISO CHSY3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CHSY3 mRNA CTD PMID:29067470 Chsy3 Rat paracetamol affects expression ISO Chsy3 (Mus musculus) 6480464 Acetaminophen affects the expression of CHSY3 mRNA CTD PMID:17562736 Chsy3 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of CHSY3 mRNA CTD PMID:32680482 Chsy3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Chsy3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CHSY3 mRNA CTD PMID:36331819 Chsy3 Rat progesterone increases expression ISO CHSY3 (Homo sapiens) 6480464 Progesterone results in increased expression of CHSY3 mRNA CTD PMID:20864642 Chsy3 Rat progesterone multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of CHSY3 mRNA CTD PMID:20660070 Chsy3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of CHSY3 mRNA CTD PMID:35811015 Chsy3 Rat SB 431542 multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHSY3 mRNA CTD PMID:27188386 Chsy3 Rat sodium arsenite decreases expression ISO CHSY3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CHSY3 mRNA CTD PMID:25879800 Chsy3 Rat sunitinib decreases expression ISO CHSY3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CHSY3 mRNA CTD PMID:31533062 Chsy3 Rat temozolomide increases expression ISO CHSY3 (Homo sapiens) 6480464 Temozolomide results in increased expression of CHSY3 mRNA CTD PMID:31758290 Chsy3 Rat tetrachloromethane increases expression ISO Chsy3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CHSY3 mRNA CTD PMID:31919559 Chsy3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CHSY3 mRNA CTD PMID:34492290 Chsy3 Rat titanium dioxide decreases methylation ISO Chsy3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CHSY3 gene and titanium dioxide results in decreased methylation of CHSY3 promoter CTD PMID:35295148 Chsy3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CHSY3 mRNA CTD PMID:33387578 Chsy3 Rat trichostatin A increases expression ISO CHSY3 (Homo sapiens) 6480464 trichostatin A results in increased expression of CHSY3 mRNA CTD PMID:24935251 Chsy3 Rat valproic acid affects expression ISO CHSY3 (Homo sapiens) 6480464 Valproic Acid affects the expression of CHSY3 mRNA CTD PMID:25979313 Chsy3 Rat valproic acid increases methylation ISO CHSY3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CHSY3 gene CTD PMID:29154799 Chsy3 Rat valproic acid increases expression ISO CHSY3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CHSY3 mRNA CTD PMID:23179753 more ... Chsy3 Rat valproic acid multiple interactions ISO CHSY3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CHSY3 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) folic acid (ISO) L-methionine (ISO) lipopolysaccharide (ISO) N-nitrosodiethylamine (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO)
Chsy3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 54,842,260 - 55,096,008 (+) NCBI GRCr8 mRatBN7.2 18 52,644,356 - 52,901,257 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 52,644,461 - 52,898,098 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 18 54,243,626 - 54,497,475 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 54,243,949 - 54,496,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 53,477,339 - 53,731,655 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 54,963,517 - 55,273,226 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 50,748,557 - 51,001,455 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
CHSY3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 129,903,979 - 130,186,634 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 129,904,465 - 130,186,634 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 129,240,158 - 129,522,327 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 129,268,422 - 129,550,226 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 125,370,892 - 125,652,732 (+) NCBI Celera Cytogenetic Map 5 q23.3 NCBI HuRef 5 124,432,045 - 124,713,660 (+) NCBI HuRef CHM1_1 5 128,673,143 - 128,955,624 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 130,422,787 - 130,705,475 (+) NCBI T2T-CHM13v2.0
Chsy3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 59,308,412 - 59,544,408 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 59,308,473 - 59,669,071 (+) Ensembl GRCm39 Ensembl GRCm38 18 59,175,340 - 59,411,336 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 59,175,401 - 59,535,999 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 59,334,994 - 59,570,990 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 59,300,709 - 59,536,705 (+) NCBI MGSCv36 mm8 Celera 18 60,481,285 - 60,714,414 (+) NCBI Celera Cytogenetic Map 18 D3 NCBI cM Map 18 33.93 NCBI
Chsy3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 2,748,777 - 2,991,782 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 2,748,776 - 2,994,041 (+) NCBI ChiLan1.0 ChiLan1.0
CHSY3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 125,214,859 - 125,496,222 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 123,354,421 - 123,641,132 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 125,319,738 - 125,601,102 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 131,491,059 - 131,772,060 (+) NCBI panpan1.1 PanPan1.1 panPan2
CHSY3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 18,621,196 - 18,855,018 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 18,620,781 - 18,854,177 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 17,420,827 - 17,654,322 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 19,375,694 - 19,642,226 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 19,375,694 - 19,641,379 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 18,100,068 - 18,370,955 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 17,935,119 - 18,202,405 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 18,549,166 - 18,816,845 (+) NCBI UU_Cfam_GSD_1.0
Chsy3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 141,374,905 - 141,626,875 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936504 2,949,014 - 3,200,006 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936504 2,948,878 - 2,952,518 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CHSY3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 132,535,984 - 132,802,188 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 132,536,085 - 132,803,476 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 137,866,436 - 138,011,589 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CHSY3
Chsy3
.
Assembly: RGSC_v3.4
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
18
55272619
55272620
A
T
snv
SHR/OlaIpcv (ICL) , SS/JrHsdMcwi (ICL), SS/JrHsdMcwi (MDC), SHR/OlaIpcv (KNAW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), COP/CrCrl (MCW & UW), GK/Ox (ICL), LH/MavRrrc (ICL), LN/MavRrrc (ICL), SHR/OlaIpcv (ICL), SHR/NHsd (ICL), SHRSP/Gcrc (ICL), SR/JrHsd (ICL), SS/Jr (ICL), SHRSP/Gcrc (MDC) View more Information
Assembly: Rnor_5.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
18
53730158
53730159
A
T
snv
COP/CrCrl (MCW & UW) , BDIX.Cg-Tal/NemOda (KyushuU), SS/JrHsdMcwi (MCW), LH/MavRrrc (KNAW), LN/MavRrrc (KNAW), SR/JrHsd (KNAW), SS/Jr (KNAW), SS/JrHsdMcwi (KNAW), SHR/NCrlPrin (KNAW), SHR/NHsd (KNAW), SHR/OlaIpcv (KNAW), SHR/OlaIpcvPrin (KNAW), SHRSP/Gcrc (KNAW), GK/Ox (KNAW), SDLEF7/Barth (UDEL), HTX/Kyo (KyushuU), HWY/Slc (KyushuU), BDIX/NemOda (KyushuU), DOB/Oda (KyushuU), SR/JrHsd (MCW) View more Information
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
18
54495978
54495979
A
T
snv
COP/CrCrl (MCW & UW) , European Variation Archive Release 6, SS/JrHsdMcwi (MCW), GK/Ox (RGD), LH/MavRrrc (RGD), LN/MavRrrc (RGD), SHR/NHsd (RGD), SHRSP/Gcrc (RGD), SR/JrHsd (RGD), SS/Jr (RGD), SS/JrHsdMcwi (RGD), BXH2/CubMcwi (2020), BXH3/CubMcwi (2020), GK/FarMcwi (2019), HXB10/IpcvMcwi (2019), HXB20/IpcvMcwi (2020), HXB4/IpcvMcwi (2020), LH/MavRrrcAek (2020), LN/MavRrrcAek (2020), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), SR/JrHsd (2020), SS/JrHsdMcwi (2019), European Variation Archive Release 3, European Variation Archive Release 4, SR/JrHsd (MCW) View more Information
Predicted Target Of
Count of predictions: 121 Count of miRNA genes: 97 Interacting mature miRNAs: 104 Transcripts: ENSRNOT00000073295, ENSRNOT00000075483 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331730 Scl27 Serum cholesterol level QTL 27 3.826 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 18 52292875 59796643 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 1331736 Bp227 Blood pressure QTL 227 2.791 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 46718763 59796643 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61360 Eaey Experimental allergic encephalomyelitis QTL y 3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 18 46988939 60377753 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 1331806 Bp229 Blood pressure QTL 229 4.36484 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 57867167 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 1331780 Bp238 Blood pressure QTL 238 3.269 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 59796643 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6903345 Bp349 Blood pressure QTL 349 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 6903349 Bp351 Blood pressure QTL 351 3.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 6903351 Bp352 Blood pressure QTL 352 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
AU048064
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 52,837,795 - 52,837,979 (+) MAPPER mRatBN7.2 Rnor_6.0 18 54,437,146 - 54,437,329 NCBI Rnor6.0 Rnor_5.0 18 53,672,262 - 53,672,445 UniSTS Rnor5.0 Celera 18 50,942,507 - 50,942,690 UniSTS Cytogenetic Map 18 q12.1 UniSTS
AI662215
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 52,897,851 - 52,897,943 (+) MAPPER mRatBN7.2 Rnor_6.0 18 54,497,202 - 54,497,293 NCBI Rnor6.0 Rnor_5.0 18 53,731,382 - 53,731,473 UniSTS Rnor5.0 RGSC_v3.4 18 55,273,843 - 55,273,934 UniSTS RGSC3.4 Celera 18 51,001,182 - 51,001,273 UniSTS Cytogenetic Map 18 q12.1 UniSTS
RH133228
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 52,897,849 - 52,898,029 (+) MAPPER mRatBN7.2 Rnor_6.0 18 54,497,200 - 54,497,379 NCBI Rnor6.0 Rnor_5.0 18 53,731,380 - 53,731,559 UniSTS Rnor5.0 RGSC_v3.4 18 55,273,841 - 55,274,020 UniSTS RGSC3.4 Celera 18 51,001,180 - 51,001,359 UniSTS RH 3.4 Map 18 510.4 UniSTS Cytogenetic Map 18 q12.1 UniSTS
BF390349
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 52,643,145 - 52,643,301 (+) MAPPER mRatBN7.2 Rnor_6.0 18 54,242,634 - 54,242,789 NCBI Rnor6.0 Rnor_6.0 18 54,205,336 - 54,205,491 NCBI Rnor6.0 Rnor_5.0 18 53,477,906 - 53,478,061 UniSTS Rnor5.0 Rnor_5.0 18 53,440,647 - 53,440,802 UniSTS Rnor5.0 RGSC_v3.4 18 54,962,202 - 54,962,357 UniSTS RGSC3.4 Celera 18 50,747,565 - 50,747,720 UniSTS RH 3.4 Map 18 503.9 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
217
97
93
44
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000075483 ⟹ ENSRNOP00000065131
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 52,644,461 - 52,898,098 (+) Ensembl Rnor_6.0 Ensembl 18 54,243,949 - 54,496,585 (+) Ensembl
RefSeq Acc Id:
XM_225912 ⟹ XP_225912
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 54,842,260 - 55,096,008 (+) NCBI mRatBN7.2 18 52,644,356 - 52,901,257 (+) NCBI Rnor_6.0 18 54,243,626 - 54,497,475 (+) NCBI Rnor_5.0 18 53,477,339 - 53,731,655 (+) NCBI RGSC_v3.4 18 54,963,517 - 55,273,226 (+) RGD
Sequence:
GTGGCAGCGGAGAAGCGGACGCGTTGCTGCCGCCGCTCCTCCTCCTGCAGCTCCTCTAGCGGCCGCCGCCGCCTCCGCCTCCGCCGCTGCCGAAGTTTCACTCCCGACCCTCGGCGGGAGCCCTAGCG
hide sequence
RefSeq Acc Id:
XP_225912 ⟸ XM_225912
- Sequence:
MAVRSRRPWVSVALGLVLGFTAASWLIAPRVAELSEKRRRGSSLCSYYGRSATGPRADAQQLLPQPQSQPRLQQSPPPASHQLPGPLRPEVAPGGPSLRSSPWQQPAPLPQRRRGHKPEGATALPGAP
hide sequence
Ensembl Acc Id:
ENSRNOP00000065131 ⟸ ENSRNOT00000075483
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-06-03
Chsy3
chondroitin sulfate synthase 3
Chsy3l
chondroitin sulfate synthase 3-like
Data merged from RGD:6496592
737654 PROVISIONAL
2015-06-12
Chsy3l
chondroitin sulfate synthase 3-like
LOC100910780
chondroitin sulfate synthase 3-like
Symbol changed
629549 APPROVED
2008-02-28
Chsy3
chondroitin sulfate synthase 3
RGD1560819_predicted
similar to chondroitin sulfate synthase 3 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1560819_predicted
similar to chondroitin sulfate synthase 3 (predicted)
LOC291577
similar to chondroitin sulfate synthase 3
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC291577
similar to chondroitin sulfate synthase 3
Symbol and Name status set to provisional
70820 PROVISIONAL
