Symbol:
Gnao1
Name:
guanine nucleotide binding protein, alpha O
RGD ID:
1550478
MGI Page
MGI
Description:
Enables G protein activity and GTP binding activity. Involved in negative regulation of insulin secretion and postsynaptic modulation of chemical synaptic transmission. Acts upstream of with a negative effect on vesicle docking involved in exocytosis. Acts upstream of or within G protein-coupled dopamine receptor signaling pathway; locomotory behavior; and regulation of heart contraction. Located in cell body and dendrite. Is active in several cellular components, including GABA-ergic synapse; parallel fiber to Purkinje cell synapse; and synaptic membrane. Is expressed in several structures, including alimentary system; brain; ganglia; genitourinary system; and sensory organ. Used to study developmental and epileptic encephalopathy 17 and neurodevelopmental disorder with involuntary movements. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 17 and neurodevelopmental disorder with involuntary movements. Orthologous to human GNAO1 (G protein subunit alpha o1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
a; alphaO; AW050213; expressed sequence AW050213; Ga; Galphao; Gnao; Go alpha; GTP-binding protein alpha-o subunit; guanine nucleotide-binding protein G(o) subunit alpha; heterotrimeric guanine nucleotide-binding protein 1g; Hg1g
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GNAO1 (G protein subunit alpha o1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gnao1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gnao1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GNAO1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GNAO1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gnao1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GNAO1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GNAO1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gnao1 (G protein subunit alpha o1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Gnao1 (G protein subunit alpha o1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GNAO1 (G protein subunit alpha o1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gnao1b (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, b)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
gnao1a (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
GPA1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Galphao
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
goa-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gnao1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 94,537,213 - 94,696,016 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 94,536,594 - 94,696,016 (+) Ensembl GRCm39 Ensembl GRCm38 8 93,810,153 - 93,969,388 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 93,809,966 - 93,969,388 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 96,334,738 - 96,493,288 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 96,700,050 - 96,858,087 (+) NCBI MGSCv36 mm8 Celera 8 98,140,645 - 98,299,435 (+) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 45.94 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gnao1 Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of GNAO1 mRNA CTD PMID:28960355 Gnao1 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of GNAO1 mRNA CTD PMID:22206623 Gnao1 Mouse 17alpha-ethynylestradiol increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of GNAO1 mRNA CTD PMID:15212814 Gnao1 Mouse 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of GNAO1 mRNA CTD PMID:17555576 Gnao1 Mouse 17beta-estradiol multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of GNAO1 mRNA CTD PMID:30165855 Gnao1 Mouse 17beta-estradiol increases expression ISO GNAO1 (Homo sapiens) 6480464 Estradiol results in increased expression of GNAO1 mRNA CTD PMID:31614463 Gnao1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GNAO1 mRNA CTD PMID:33387578 Gnao1 Mouse 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine multiple interactions EXP 6480464 [Dronabinol results in increased susceptibility to 4-iodo-2 and 5-dimethoxyphenylisopropylamine] which results in increased activity of GNAO1 protein CTD PMID:29748632 Gnao1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GNAO1 mRNA CTD PMID:20188158 Gnao1 Mouse 3,4-methylenedioxymethamphetamine decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of GNAO1 mRNA CTD PMID:30071829 Gnao1 Mouse 3-chloropropane-1,2-diol increases expression ISO Gnao1 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of GNAO1 mRNA CTD PMID:28522335 Gnao1 Mouse 3H-1,2-dithiole-3-thione increases expression ISO Gnao1 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in increased expression of GNAO1 mRNA CTD PMID:19162173 Gnao1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of GNAO1 mRNA CTD PMID:33297965 Gnao1 Mouse 6-propyl-2-thiouracil decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of GNAO1 mRNA CTD PMID:30047161 Gnao1 Mouse acrylamide decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of GNAO1 mRNA CTD PMID:28959563 Gnao1 Mouse aflatoxin B1 decreases methylation ISO GNAO1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GNAO1 gene CTD PMID:27153756 Gnao1 Mouse Aflatoxin B2 alpha decreases methylation ISO GNAO1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of GNAO1 3' UTR CTD PMID:30157460 Gnao1 Mouse all-trans-retinoic acid increases expression ISO GNAO1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GNAO1 mRNA CTD PMID:33167477 Gnao1 Mouse ammonium chloride affects expression ISO Gnao1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of GNAO1 mRNA CTD PMID:16483693 Gnao1 Mouse arsane affects methylation ISO GNAO1 (Homo sapiens) 6480464 Arsenic affects the methylation of GNAO1 gene CTD PMID:25304211 Gnao1 Mouse arsenic atom affects methylation ISO GNAO1 (Homo sapiens) 6480464 Arsenic affects the methylation of GNAO1 gene CTD PMID:25304211 Gnao1 Mouse arsenite(3-) increases methylation ISO GNAO1 (Homo sapiens) 6480464 arsenite results in increased methylation of GNAO1 promoter CTD PMID:23974009 Gnao1 Mouse atrazine increases expression ISO GNAO1 (Homo sapiens) 6480464 Atrazine results in increased expression of GNAO1 mRNA CTD PMID:22378314 Gnao1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of GNAO1 mRNA] CTD PMID:22228805 Gnao1 Mouse benzo[a]pyrene affects methylation ISO GNAO1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GNAO1 3' UTR CTD PMID:30157460 Gnao1 Mouse benzo[a]pyrene increases methylation ISO GNAO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GNAO1 promoter CTD PMID:27901495 Gnao1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of GNAO1 mRNA CTD PMID:22228805 Gnao1 Mouse benzo[e]pyrene decreases methylation ISO GNAO1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of GNAO1 3' UTR and benzo(e)pyrene results in decreased methylation of GNAO1 intron CTD PMID:30157460 Gnao1 Mouse bisphenol A multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of GNAO1 mRNA CTD PMID:26496021 Gnao1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GNAO1 mRNA CTD PMID:32156529 Gnao1 Mouse bisphenol A decreases expression ISO GNAO1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GNAO1 protein CTD PMID:33376534 Gnao1 Mouse bisphenol A increases methylation ISO Gnao1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of GNAO1 gene CTD PMID:28505145 Gnao1 Mouse bisphenol A decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GNAO1 mRNA CTD PMID:25181051 and PMID:30816183 Gnao1 Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of GNAO1 mRNA CTD PMID:38685157 Gnao1 Mouse butanal increases expression ISO GNAO1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of GNAO1 mRNA CTD PMID:26079696 Gnao1 Mouse cadmium atom decreases expression ISO GNAO1 (Homo sapiens) 6480464 Cadmium results in decreased expression of GNAO1 mRNA CTD PMID:24376830 Gnao1 Mouse cannabidiol multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of GNAO1 protein CTD PMID:34122009 Gnao1 Mouse cantharidin decreases expression EXP 6480464 Cantharidin results in decreased expression of GNAO1 mRNA CTD PMID:36907384 Gnao1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Gnao1 Mouse carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon affects the expression of GNAO1 protein CTD PMID:21135415 Gnao1 Mouse CGP 52608 multiple interactions ISO GNAO1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GNAO1 gene] CTD PMID:28238834 Gnao1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of GNAO1 mRNA CTD PMID:27905518 Gnao1 Mouse chlorpyrifos multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of GNAO1 mRNA CTD PMID:27905518 Gnao1 Mouse chlorpyrifos decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of GNAO1 mRNA CTD PMID:27905518 Gnao1 Mouse chromium(6+) multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of GNAO1 mRNA CTD PMID:38479592 Gnao1 Mouse cocaine decreases expression ISO GNAO1 (Homo sapiens) 6480464 Cocaine results in decreased expression of GNAO1 mRNA CTD PMID:12629581 Gnao1 Mouse cocaine multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Cocaine affects the activity of PRKACA protein] which affects the phosphorylation of GNAO1 protein alternative form CTD PMID:19457111 Gnao1 Mouse copper atom increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of GNAO1 mRNA CTD PMID:26033743 Gnao1 Mouse copper atom multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of GNAO1 mRNA CTD PMID:26033743 Gnao1 Mouse copper(0) increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of GNAO1 mRNA CTD PMID:26033743 Gnao1 Mouse copper(0) multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of GNAO1 mRNA CTD PMID:26033743 Gnao1 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of GNAO1 mRNA CTD PMID:29279043 Gnao1 Mouse Cuprizon multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of GNAO1 protein and [Cuprizone co-treated with Haloperidol] results in increased expression of GNAO1 protein CTD PMID:34122009 Gnao1 Mouse dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of GNAO1 mRNA CTD PMID:22733784 Gnao1 Mouse dextran sulfate multiple interactions EXP 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of GNAO1 protein] CTD PMID:35362542 Gnao1 Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of GNAO1 protein CTD PMID:35362542 Gnao1 Mouse diazinon increases methylation ISO GNAO1 (Homo sapiens) 6480464 Diazinon results in increased methylation of GNAO1 gene CTD PMID:22964155 Gnao1 Mouse dichlorine decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Chlorine results in decreased expression of GNAO1 mRNA CTD PMID:18636392 Gnao1 Mouse dichlorine multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of GNAO1 mRNA CTD PMID:18636392 Gnao1 Mouse diethyl malate affects expression EXP 6480464 diethyl malate affects the expression of GNAO1 mRNA CTD PMID:24814887 Gnao1 Mouse dorsomorphin multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GNAO1 mRNA CTD PMID:27188386 Gnao1 Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of GNAO1 mRNA CTD PMID:35436446 Gnao1 Mouse ethanol decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Ethanol results in decreased expression of GNAO1 mRNA and Ethanol results in decreased expression of GNAO1 protein CTD PMID:20655511 and PMID:23702218 Gnao1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of GNAO1 mRNA CTD PMID:30319688 Gnao1 Mouse ethanol multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 N-methyl-N-(6-methoxy-1-phenyl-1 more ... CTD PMID:20655511 Gnao1 Mouse Ethylenethiourea multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of GNAO1 mRNA CTD PMID:27905518 Gnao1 Mouse Evodiamine multiple interactions EXP 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of GNAO1 protein] CTD PMID:35362542 Gnao1 Mouse fenvalerate increases expression ISO Gnao1 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of GNAO1 mRNA CTD PMID:30307764 Gnao1 Mouse flavonoids increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Flavonoids results in increased expression of GNAO1 mRNA CTD PMID:18035473 Gnao1 Mouse genistein decreases expression EXP 6480464 Genistein results in decreased expression of GNAO1 mRNA CTD PMID:16169203 Gnao1 Mouse genistein multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of GNAO1 mRNA CTD PMID:21782745 Gnao1 Mouse glyphosate increases methylation ISO Gnao1 (Rattus norvegicus) 6480464 Glyphosate results in increased methylation of GNAO1 gene CTD PMID:31011160 Gnao1 Mouse Guanabenz affects response to substance EXP 6480464 GNAO1 affects the susceptibility to Guanabenz CTD PMID:15207363 Gnao1 Mouse guanosine 5'-[gamma-thio]triphosphate affects binding EXP 6480464 GNAO1 protein binds to Guanosine 5'-O-(3-Thiotriphosphate) CTD PMID:29748632 Gnao1 Mouse haloperidol multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of GNAO1 protein CTD PMID:34122009 Gnao1 Mouse ivermectin decreases expression ISO GNAO1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GNAO1 protein CTD PMID:32959892 Gnao1 Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of GNAO1 protein CTD PMID:20797405 Gnao1 Mouse lead(0) affects expression ISO GNAO1 (Homo sapiens) 6480464 Lead affects the expression of GNAO1 mRNA CTD PMID:28903495 Gnao1 Mouse lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of GNAO1 mRNA CTD PMID:12057914 Gnao1 Mouse methapyrilene decreases methylation ISO GNAO1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of GNAO1 3' UTR and Methapyrilene results in decreased methylation of GNAO1 intron CTD PMID:30157460 Gnao1 Mouse methiothepin multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 Methiothepin inhibits the reaction [Serotonin results in increased palmitoylation of GNAO1 protein] CTD PMID:9732414 Gnao1 Mouse methoxychlor multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of GNAO1 mRNA CTD PMID:21782745 Gnao1 Mouse methoxychlor affects methylation ISO Gnao1 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of GNAO1 gene CTD PMID:35440735 Gnao1 Mouse nickel atom increases expression ISO GNAO1 (Homo sapiens) 6480464 Nickel results in increased expression of GNAO1 mRNA CTD PMID:23195993 Gnao1 Mouse ozone multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of GNAO1 mRNA CTD PMID:18636392 Gnao1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GNAO1 mRNA CTD PMID:34911549 Gnao1 Mouse paraquat affects expression ISO Gnao1 (Rattus norvegicus) 6480464 Paraquat affects the expression of GNAO1 mRNA CTD PMID:15206577 Gnao1 Mouse paraquat decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Paraquat results in decreased expression of GNAO1 mRNA CTD PMID:32680482 Gnao1 Mouse pentanal increases expression ISO GNAO1 (Homo sapiens) 6480464 pentanal results in increased expression of GNAO1 mRNA CTD PMID:26079696 Gnao1 Mouse pentobarbital affects expression ISO Gnao1 (Rattus norvegicus) 6480464 Pentobarbital affects the expression of GNAO1 mRNA CTD PMID:12199159 Gnao1 Mouse phenylmercury acetate decreases expression ISO GNAO1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of GNAO1 mRNA CTD PMID:26272509 Gnao1 Mouse phenylmercury acetate multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of GNAO1 mRNA CTD PMID:27188386 Gnao1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of GNAO1 mRNA CTD PMID:20813756 Gnao1 Mouse pregnenolone 16alpha-carbonitrile increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of GNAO1 mRNA CTD PMID:19162173 Gnao1 Mouse progesterone increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Progesterone results in increased expression of GNAO1 mRNA CTD PMID:20726854 Gnao1 Mouse propanal increases expression ISO GNAO1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of GNAO1 mRNA CTD PMID:26079696 Gnao1 Mouse quercetin affects expression ISO Gnao1 (Rattus norvegicus) 6480464 Quercetin affects the expression of GNAO1 mRNA CTD PMID:18178720 Gnao1 Mouse reserpine increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Reserpine results in increased expression of GNAO1 mRNA and Reserpine results in increased expression of GNAO1 protein CTD PMID:11264240 and PMID:8419537 Gnao1 Mouse rotenone decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of GNAO1 mRNA CTD PMID:28374803 Gnao1 Mouse SB 431542 multiple interactions ISO GNAO1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Gnao1 Mouse serotonin increases palmitoylation ISO Gnao1 (Rattus norvegicus) 6480464 Serotonin results in increased palmitoylation of GNAO1 protein CTD PMID:9732414 Gnao1 Mouse serotonin multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 Methiothepin inhibits the reaction [Serotonin results in increased palmitoylation of GNAO1 protein] CTD PMID:9732414 Gnao1 Mouse sodium arsenite decreases expression ISO GNAO1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GNAO1 mRNA CTD PMID:34032870 Gnao1 Mouse sulfadimethoxine decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of GNAO1 mRNA CTD PMID:30047161 Gnao1 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of GNAO1 mRNA CTD PMID:17555576 Gnao1 Mouse testosterone multiple interactions ISO Gnao1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of GNAO1 mRNA CTD PMID:26496021 Gnao1 Mouse testosterone increases expression ISO GNAO1 (Homo sapiens) 6480464 Testosterone results in increased expression of GNAO1 mRNA CTD PMID:33359661 Gnao1 Mouse thapsigargin decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of GNAO1 protein CTD PMID:35544339 Gnao1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of GNAO1 gene CTD PMID:35295148 Gnao1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of GNAO1 gene CTD PMID:35295148 Gnao1 Mouse trichloroethene decreases expression ISO Gnao1 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of GNAO1 mRNA CTD PMID:33387578 Gnao1 Mouse trichostatin A increases expression ISO GNAO1 (Homo sapiens) 6480464 trichostatin A results in increased expression of GNAO1 mRNA CTD PMID:28542535 Gnao1 Mouse triclosan decreases expression ISO GNAO1 (Homo sapiens) 6480464 Triclosan results in decreased expression of GNAO1 mRNA CTD PMID:30510588 Gnao1 Mouse triphenyl phosphate affects expression ISO GNAO1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GNAO1 mRNA CTD PMID:37042841 Gnao1 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of GNAO1 mRNA CTD PMID:33045310 Gnao1 Mouse valproic acid increases expression ISO GNAO1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GNAO1 mRNA CTD PMID:23179753 Gnao1 Mouse valproic acid affects expression ISO GNAO1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GNAO1 mRNA CTD PMID:25979313 Gnao1 Mouse venlafaxine hydrochloride increases expression ISO Gnao1 (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride results in increased expression of GNAO1 mRNA CTD PMID:25423262 Gnao1 Mouse vinclozolin affects expression ISO Gnao1 (Rattus norvegicus) 6480464 vinclozolin affects the expression of GNAO1 mRNA CTD PMID:19015723 Gnao1 Mouse vinclozolin decreases methylation ISO Gnao1 (Rattus norvegicus) 6480464 vinclozolin results in decreased methylation of GNAO1 gene CTD PMID:31682807
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine (EXP) 3,4-methylenedioxymethamphetamine (EXP,ISO) 3-chloropropane-1,2-diol (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) cadmium atom (ISO) cannabidiol (ISO) cantharidin (EXP) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) chromium(6+) (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (EXP) Cuprizon (ISO) dexamethasone (EXP) dextran sulfate (EXP) diazinon (ISO) dichlorine (ISO) diethyl malate (EXP) dorsomorphin (ISO) epoxiconazole (EXP) ethanol (EXP,ISO) Ethylenethiourea (ISO) Evodiamine (EXP) fenvalerate (ISO) flavonoids (ISO) genistein (EXP,ISO) glyphosate (ISO) Guanabenz (EXP) guanosine 5'-[gamma-thio]triphosphate (EXP) haloperidol (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (ISO) lipopolysaccharide (EXP) methapyrilene (ISO) methiothepin (ISO) methoxychlor (ISO) nickel atom (ISO) ozone (EXP,ISO) paraquat (ISO) pentanal (ISO) pentobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propanal (ISO) quercetin (ISO) reserpine (ISO) rotenone (ISO) SB 431542 (ISO) serotonin (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) tamoxifen (EXP) testosterone (ISO) thapsigargin (ISO) titanium dioxide (EXP) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (EXP) valproic acid (ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO)
1.
Neuropilin-2 mediates axonal fasciculation, zonal segregation, but not axonal convergence, of primary accessory olfactory neurons.
Cloutier JF, etal., Neuron 2002 Mar 14;33(6):877-92.
2.
Molecular cloning and sequence determination of cDNAs for alpha subunits of the guanine nucleotide-binding proteins Gs, Gi, and Go from rat brain.
Itoh H, etal., Proc Natl Acad Sci U S A 1986 Jun;83(11):3776-80.
3.
Multiple neurological abnormalities in mice deficient in the G protein Go.
Jiang M, etal., Proc Natl Acad Sci U S A 1998 Mar 17;95(6):3269-74.
4.
GPR56, a novel secretin-like human G-protein-coupled receptor gene.
Liu M, etal., Genomics 1999 Feb 1;55(3):296-305.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
MGD IEA
MGD IEA
7.
Functionally selective dopamine D(2), D(3) receptor partial agonists.
Moller D, etal., J Med Chem. 2014 Jun 12;57(11):4861-75. doi: 10.1021/jm5004039. Epub 2014 May 23.
8.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Gnao1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 94,537,213 - 94,696,016 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 94,536,594 - 94,696,016 (+) Ensembl GRCm39 Ensembl GRCm38 8 93,810,153 - 93,969,388 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 93,809,966 - 93,969,388 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 96,334,738 - 96,493,288 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 96,700,050 - 96,858,087 (+) NCBI MGSCv36 mm8 Celera 8 98,140,645 - 98,299,435 (+) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 45.94 NCBI
GNAO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 56,191,489 - 56,357,444 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 56,189,660 - 56,357,444 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 56,225,401 - 56,391,356 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 54,783,649 - 54,948,651 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 54,783,648 - 54,935,363 NCBI Celera 16 40,722,067 - 40,888,176 (+) NCBI Celera Cytogenetic Map 16 q13 NCBI HuRef 16 42,096,140 - 42,261,995 (+) NCBI HuRef CHM1_1 16 57,632,612 - 57,798,711 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 61,986,534 - 62,152,480 (+) NCBI T2T-CHM13v2.0
Gnao1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 11,040,788 - 11,198,437 (-) NCBI GRCr8 mRatBN7.2 19 11,034,874 - 11,192,531 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 11,035,956 - 11,192,493 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 11,003,977 - 11,161,720 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 11,769,148 - 11,926,880 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 11,056,156 - 11,213,897 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 11,513,201 - 11,669,578 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 11,513,201 - 11,669,578 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 11,487,578 - 11,643,367 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 11,472,083 - 11,623,600 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 11,476,908 - 11,628,426 (-) NCBI Celera 19 10,919,521 - 11,074,052 (-) NCBI Celera Cytogenetic Map 19 p12 NCBI
Gnao1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 14,004,813 - 14,172,707 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 14,004,813 - 14,170,631 (+) NCBI ChiLan1.0 ChiLan1.0
GNAO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 65,669,503 - 65,839,209 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 71,588,239 - 71,758,365 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 36,473,852 - 36,643,789 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 55,606,920 - 55,776,619 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 55,606,920 - 55,776,619 (+) Ensembl panpan1.1 panPan2
GNAO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 59,805,675 - 59,980,782 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 59,806,689 - 59,980,398 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 56,439,284 - 56,614,525 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 60,350,680 - 60,525,810 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 60,350,811 - 60,526,437 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 57,180,704 - 57,353,192 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 58,189,791 - 58,364,758 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 59,082,779 - 59,255,395 (-) NCBI UU_Cfam_GSD_1.0
Gnao1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 50,907,469 - 50,975,262 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 8,565,889 - 8,690,673 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 8,610,123 - 8,681,606 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GNAO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 29,417,603 - 29,592,706 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 29,416,574 - 29,592,874 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 26,756,513 - 26,788,415 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GNAO1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 42,105,295 - 42,272,573 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 42,105,334 - 42,273,059 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 34,092,746 - 34,260,108 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gnao1
.
Predicted Target Of
Count of predictions: 2655 Count of miRNA genes: 771 Interacting mature miRNAs: 990 Transcripts: ENSMUST00000034198, ENSMUST00000125695, ENSMUST00000125716, ENSMUST00000127900, ENSMUST00000130974, ENSMUST00000137202, ENSMUST00000138659, ENSMUST00000142466, ENSMUST00000144451, ENSMUST00000149530, ENSMUST00000155245 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1301872 Cd4ts3_m CD4 T cell subset 3 (mouse) Not determined 8 72122809 106123021 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
AW050213
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,960,369 - 93,960,470 UniSTS GRCm38 MGSCv37 8 96,484,269 - 96,484,370 UniSTS GRCm37 Celera 8 98,290,417 - 98,290,518 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS Whitehead/MRC_RH 8 1159.72 UniSTS
Gnao1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS cM Map 8 45.0 UniSTS
RH143789
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,967,995 - 93,968,134 UniSTS GRCm38 MGSCv37 8 96,491,895 - 96,492,034 UniSTS GRCm37 Celera 8 98,298,043 - 98,298,182 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
UniSTS:235968
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,968,523 - 93,968,757 UniSTS GRCm38 MGSCv37 8 96,492,423 - 96,492,657 UniSTS GRCm37 Celera 8 98,298,571 - 98,298,805 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
RH139637
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,960,411 - 93,960,599 UniSTS GRCm38 MGSCv37 8 96,484,311 - 96,484,499 UniSTS GRCm37 Celera 8 98,290,459 - 98,290,647 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
PMC19731P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,949,410 - 93,950,409 UniSTS GRCm38 MGSCv37 8 96,473,310 - 96,474,309 UniSTS GRCm37 Celera 8 98,279,458 - 98,280,457 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
RH68394
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 93,969,148 - 93,969,309 UniSTS GRCm38 MGSCv37 8 96,493,048 - 96,493,209 UniSTS GRCm37 Celera 8 98,299,196 - 98,299,356 UniSTS Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
Gnao1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C5 UniSTS cM Map 8 45.0 UniSTS
Gnao1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 C5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034198 ⟹ ENSMUSP00000034198
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,537,466 - 94,696,016 (+) Ensembl GRCm38.p6 Ensembl 8 93,810,838 - 93,969,388 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125695
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,537,264 - 94,538,398 (+) Ensembl GRCm38.p6 Ensembl 8 93,810,636 - 93,811,770 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125716 ⟹ ENSMUSP00000114144
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,537,468 - 94,695,584 (+) Ensembl GRCm38.p6 Ensembl 8 93,810,840 - 93,968,956 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000127900 ⟹ ENSMUSP00000116826
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,622,859 - 94,694,791 (+) Ensembl GRCm38.p6 Ensembl 8 93,896,231 - 93,968,163 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000130974
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,676,133 - 94,677,303 (+) Ensembl GRCm38.p6 Ensembl 8 93,949,505 - 93,950,675 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137202 ⟹ ENSMUSP00000119220
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,536,594 - 94,677,031 (+) Ensembl GRCm38.p6 Ensembl 8 93,809,966 - 93,950,403 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138659 ⟹ ENSMUSP00000148550
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,537,941 - 94,687,318 (+) Ensembl GRCm38.p6 Ensembl 8 93,811,313 - 93,960,690 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142466 ⟹ ENSMUSP00000118463
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,677,033 - 94,694,688 (+) Ensembl GRCm38.p6 Ensembl 8 93,950,405 - 93,968,060 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144451
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,679,575 - 94,683,208 (+) Ensembl GRCm38.p6 Ensembl 8 93,952,947 - 93,956,580 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000149530 ⟹ ENSMUSP00000115007
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,677,033 - 94,694,709 (+) Ensembl GRCm38.p6 Ensembl 8 93,950,405 - 93,968,081 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155245
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,689,472 - 94,693,649 (+) Ensembl GRCm38.p6 Ensembl 8 93,962,844 - 93,967,021 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212008
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 94,692,424 - 94,695,838 (+) Ensembl GRCm38.p6 Ensembl 8 93,965,796 - 93,969,210 (+) Ensembl
RefSeq Acc Id:
NM_001113384 ⟹ NP_001106855
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 94,537,213 - 94,687,319 (+) NCBI GRCm38 8 93,810,838 - 93,960,694 (+) NCBI MGSCv37 8 96,334,738 - 96,493,288 (+) RGD Celera 8 98,140,645 - 98,299,435 (+) RGD cM Map 8 ENTREZGENE
Sequence:
ACTCCCTCCACACCCCGCGCCACCGCCGCCTCCACCTTCTCCGCCTCCGCCTCCTCCTCCTCCGCCTCCGGCAGCCGCGGCAGAAGGACCCACCCTGCCCCCCACCCCACCCTCCGCCGGCTCCGGCT
hide sequence
RefSeq Acc Id:
NM_001414907 ⟹ NP_001401836
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 94,537,213 - 94,696,016 (+) NCBI
RefSeq Acc Id:
NM_001414908 ⟹ NP_001401837
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 94,537,213 - 94,696,016 (+) NCBI
RefSeq Acc Id:
NM_010308 ⟹ NP_034438
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 94,537,213 - 94,696,016 (+) NCBI GRCm38 8 93,810,838 - 93,969,388 (+) NCBI MGSCv37 8 96,334,738 - 96,493,288 (+) RGD Celera 8 98,140,645 - 98,299,435 (+) RGD cM Map 8 ENTREZGENE
Sequence:
ACTCCCTCCACACCCCGCGCCACCGCCGCCTCCACCTTCTCCGCCTCCGCCTCCTCCTCCTCCG
hide sequence
RefSeq Acc Id:
NR_188943
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 94,537,213 - 94,687,319 (+) NCBI
RefSeq Acc Id:
NP_034438 ⟸ NM_010308
- Peptide Label:
isoform A
- UniProtKB:
P18873 (UniProtKB/Swiss-Prot), P18872 (UniProtKB/Swiss-Prot), Q543S2 (UniProtKB/TrEMBL)
- Sequence:
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAM
hide sequence
RefSeq Acc Id:
NP_001106855 ⟸ NM_001113384
- Peptide Label:
isoform B
- UniProtKB:
P18872 (UniProtKB/Swiss-Prot)
- Sequence:
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAM
hide sequence
Ensembl Acc Id:
ENSMUSP00000114144 ⟸ ENSMUST00000125716
Ensembl Acc Id:
ENSMUSP00000148550 ⟸ ENSMUST00000138659
Ensembl Acc Id:
ENSMUSP00000116826 ⟸ ENSMUST00000127900
Ensembl Acc Id:
ENSMUSP00000034198 ⟸ ENSMUST00000034198
Ensembl Acc Id:
ENSMUSP00000115007 ⟸ ENSMUST00000149530
Ensembl Acc Id:
ENSMUSP00000119220 ⟸ ENSMUST00000137202
Ensembl Acc Id:
ENSMUSP00000118463 ⟸ ENSMUST00000142466
RefSeq Acc Id:
NP_001401837 ⟸ NM_001414908
- Peptide Label:
isoform C
RefSeq Acc Id:
NP_001401836 ⟸ NM_001414907
- Peptide Label:
isoform A
- UniProtKB:
P18872 (UniProtKB/Swiss-Prot), P18873 (UniProtKB/Swiss-Prot), Q543S2 (UniProtKB/TrEMBL)
RGD ID: 8667877 Promoter ID: EPDNEW_M11969 Type: initiation region Name: Gnao1_1 Description: Mus musculus guanine nucleotide binding protein, alpha O , transcriptvariant A, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 93,810,838 - 93,810,898 EPDNEW
RGD ID: 6843251 Promoter ID: MM_KWN:55303 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000085920 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,333,726 - 96,334,226 (+) MPROMDB
RGD ID: 6843252 Promoter ID: MM_KWN:55306 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000085921 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,419,776 - 96,420,276 (+) MPROMDB
RGD ID: 6843258 Promoter ID: MM_KWN:55308 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000085919, OTTMUST00000085925 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,473,876 - 96,474,376 (+) MPROMDB
RGD ID: 6843253 Promoter ID: MM_KWN:55309 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: OTTMUST00000085923 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,476,036 - 96,476,627 (+) MPROMDB
RGD ID: 6843254 Promoter ID: MM_KWN:55310 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000085924 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,486,676 - 96,487,176 (+) MPROMDB
RGD ID: 6848291 Promoter ID: MM_ACW:48465 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, Brain, MEF_B6 Transcripts: GNAO1.GSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 96,492,366 - 96,492,866 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-05
Gnao1
guanine nucleotide binding protein, alpha O
AW050213
expressed sequence AW050213
Data merged from RGD:1609550
737654 PROVISIONAL
