Symbol:
Gnaq
Name:
guanine nucleotide binding protein, alpha q polypeptide
RGD ID:
1550022
MGI Page
MGI
Description:
Enables G protein activity and enzyme regulator activity. Involved in several processes, including G protein-coupled receptor signaling pathway; ligand-gated ion channel signaling pathway; and positive regulation of insulin secretion. Acts upstream of or within several processes, including G protein-coupled receptor signaling pathway; maternal behavior; and neuron development. Located in cell body; dendrite; and membrane. Is active in plasma membrane and postsynaptic cytosol. Is expressed in several structures, including central nervous system; gonad; heart; intestine smooth muscle circular layer; and retina. Used to study congestive heart failure and dilated cardiomyopathy. Human ortholog(s) of this gene implicated in Sturge-Weber syndrome; congestive heart failure; and familial multiple nevi flammei. Orthologous to human GNAQ (G protein subunit alpha q).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110005L02Rik; 6230401I02Rik; AA408290; AW060788; Dsk; Dsk1; Dsk10; G alpha q; Gal; Galphaq; Gq; GqI; guanine nucleotide-binding protein alpha-q; guanine nucleotide-binding protein G(q) subunit alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GNAQ (G protein subunit alpha q) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gnaq (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gnaq (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100986730 (guanine nucleotide-binding protein G(q) subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GNAQ (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101971998 (guanine nucleotide-binding protein G(q) subunit alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GNAQ (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GNAQ (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gnaq (G protein subunit alpha q) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GNA11 (G protein subunit alpha 11) HGNC
OrthoDB, OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Gnaq (G protein subunit alpha q)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GNAQ (G protein subunit alpha q)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gnaq (guanine nucleotide binding protein (G protein), q polypeptide)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GPA2
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
egl-30
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Galphaq
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gnaq
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 16,110,048 - 16,365,884 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 16,110,195 - 16,364,827 (+) Ensembl GRCm39 Ensembl GRCm38 19 16,132,684 - 16,388,520 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 16,132,831 - 16,387,463 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 16,207,321 - 16,461,943 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 16,199,850 - 16,454,472 (+) NCBI MGSCv36 mm8 MGSCv36 19 15,738,354 - 16,003,046 (+) NCBI MGSCv36 mm8 Celera 19 16,873,630 - 17,041,492 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 11.01 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gnaq Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO GNAQ (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GNAQ mRNA CTD PMID:22079256 Gnaq Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GNAQ mRNA CTD PMID:22206623 Gnaq Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GNAQ mRNA CTD PMID:22206623 Gnaq Mouse 17alpha-ethynylestradiol increases expression ISO Gnaq (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of GNAQ mRNA CTD PMID:29097150 Gnaq Mouse 17beta-estradiol multiple interactions ISO GNAQ (Homo sapiens) 6480464 Estradiol promotes the reaction [ESR1 protein binds to GNAQ protein] and Estradiol promotes the reaction [GNAQ protein binds to ESR1 protein] CTD PMID:23665804 more ... Gnaq Mouse 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO GNAQ (Homo sapiens) 6480464 [Metribolone binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to GNAQ protein modified form] CTD PMID:28751236 Gnaq Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO GNAQ (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of GNAQ mRNA CTD PMID:29581250 Gnaq Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GNAQ mRNA CTD PMID:21570461 Gnaq Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GNAQ mRNA CTD PMID:32109520 Gnaq Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Gnaq (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Gnaq Mouse 2,6-dimethoxyphenol multiple interactions ISO GNAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of GNAQ protein CTD PMID:38598786 Gnaq Mouse 2-bromohexadecanoic acid multiple interactions ISO GNAQ (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GNAQ protein] CTD PMID:38195004 Gnaq Mouse 2-methylcholine affects expression ISO GNAQ (Homo sapiens) 6480464 beta-methylcholine affects the expression of GNAQ mRNA CTD PMID:21179406 Gnaq Mouse 2-nitrotoluene decreases expression ISO Gnaq (Rattus norvegicus) 6480464 2-nitrotoluene results in decreased expression of GNAQ mRNA CTD PMID:16460773 Gnaq Mouse 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases response to substance EXP 6480464 GNAQ protein results in increased susceptibility to Puromycin Aminonucleoside CTD PMID:16267159 Gnaq Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GNAQ mRNA CTD PMID:20188158 Gnaq Mouse 4,4'-sulfonyldiphenol multiple interactions ISO GNAQ (Homo sapiens) 6480464 bisphenol S inhibits the reaction [ESR1 protein binds to GNAQ protein] CTD PMID:29389661 Gnaq Mouse 4,4'-sulfonyldiphenol affects expression ISO GNAQ (Homo sapiens) 6480464 bisphenol S affects the expression of GNAQ protein CTD PMID:31945527 Gnaq Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of GNAQ mRNA CTD PMID:39298647 Gnaq Mouse 4-hydroxynon-2-enal increases expression EXP 6480464 4-hydroxy-2-nonenal results in increased expression of GNAQ mRNA CTD PMID:19191707 Gnaq Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of GNAQ mRNA CTD PMID:28973697 Gnaq Mouse 4-vinylcyclohexene dioxide affects expression EXP 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of GNAQ mRNA CTD PMID:20829426 Gnaq Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GNAQ mRNA CTD PMID:19770486 Gnaq Mouse aldehydo-D-glucose multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of GNAQ protein] and CAT protein inhibits the reaction [Glucose results in increased expression of GNAQ protein] CTD PMID:20691780 Gnaq Mouse aldehydo-D-glucose multiple interactions EXP 6480464 GNAQ protein affects the reaction [Glucose results in increased secretion of INS1 protein] and GNAQ protein affects the reaction [Palmitic Acid promotes the reaction [Glucose results in increased secretion of INS1 protein]] CTD PMID:37217659 Gnaq Mouse aldehydo-D-glucose increases expression ISO Gnaq (Rattus norvegicus) 6480464 Glucose results in increased expression of GNAQ protein CTD PMID:20691780 Gnaq Mouse all-trans-retinoic acid decreases expression ISO GNAQ (Homo sapiens) 6480464 Tretinoin results in decreased expression of GNAQ mRNA CTD PMID:15498508 Gnaq Mouse aluminium atom increases response to substance EXP 6480464 GNAQ protein results in increased susceptibility to Aluminum CTD PMID:15068510 Gnaq Mouse aluminium(0) increases response to substance EXP 6480464 GNAQ protein results in increased susceptibility to Aluminum CTD PMID:15068510 Gnaq Mouse ammonium chloride affects expression ISO Gnaq (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of GNAQ mRNA CTD PMID:16483693 Gnaq Mouse apocynin multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of GNAQ protein] and acetovanillone inhibits the reaction [Streptozocin results in increased expression of GNAQ protein] CTD PMID:20691780 Gnaq Mouse aristolochic acid A decreases expression ISO GNAQ (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GNAQ mRNA CTD PMID:33212167 Gnaq Mouse arsenite(3-) decreases methylation ISO GNAQ (Homo sapiens) 6480464 arsenite results in decreased methylation of GNAQ promoter CTD PMID:23974009 Gnaq Mouse atrazine affects methylation ISO Gnaq (Rattus norvegicus) 6480464 Atrazine affects the methylation of GNAQ gene CTD PMID:35440735 Gnaq Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of GNAQ mRNA CTD PMID:19770486 and PMID:21715664 Gnaq Mouse benzo[a]pyrene increases methylation ISO GNAQ (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GNAQ promoter CTD PMID:27901495 Gnaq Mouse benzo[a]pyrene diol epoxide I decreases expression ISO GNAQ (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Gnaq Mouse bisphenol A decreases expression ISO Gnaq (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GNAQ mRNA CTD PMID:25181051 Gnaq Mouse bisphenol A multiple interactions ISO GNAQ (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to GNAQ protein modified form] and bisphenol A inhibits the reaction [ESR1 protein binds to GNAQ protein] CTD PMID:28751236 and PMID:29389661 Gnaq Mouse bisphenol A increases expression ISO Gnaq (Rattus norvegicus) 6480464 bisphenol A results in increased expression of GNAQ mRNA CTD PMID:29097150 and PMID:32145629 Gnaq Mouse bisphenol AF multiple interactions ISO GNAQ (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to GNAQ protein modified form] and bisphenol AF inhibits the reaction [ESR1 protein binds to GNAQ protein] CTD PMID:28751236 and PMID:29389661 Gnaq Mouse bromochloroacetic acid decreases expression ISO Gnaq (Rattus norvegicus) 6480464 bromochloroacetic acid results in decreased expression of GNAQ mRNA CTD PMID:16460773 Gnaq Mouse cadmium atom multiple interactions ISO GNAQ (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GNAQ protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GNAQ protein CTD PMID:38195004 Gnaq Mouse cadmium dichloride multiple interactions ISO GNAQ (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GNAQ protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GNAQ protein CTD PMID:38195004 Gnaq Mouse caffeine decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Caffeine results in decreased expression of GNAQ protein CTD PMID:15998294 Gnaq Mouse carbamazepine affects expression ISO GNAQ (Homo sapiens) 6480464 Carbamazepine affects the expression of GNAQ mRNA CTD PMID:24752500 Gnaq Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GNAQ mRNA CTD PMID:20350560 Gnaq Mouse cicaprost multiple interactions ISO GNAQ (Homo sapiens) 6480464 cicaprost promotes the reaction [PTGIR protein binds to GNAQ protein] CTD PMID:11895442 Gnaq Mouse cisplatin decreases expression ISO GNAQ (Homo sapiens) 6480464 Cisplatin results in decreased expression of GNAQ mRNA CTD PMID:27594783 Gnaq Mouse cobalt dichloride decreases expression ISO GNAQ (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GNAQ mRNA CTD PMID:19320972 Gnaq Mouse coumestrol decreases expression ISO GNAQ (Homo sapiens) 6480464 Coumestrol results in decreased expression of GNAQ mRNA CTD PMID:19167446 Gnaq Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of GNAQ mRNA CTD PMID:19770486 Gnaq Mouse cyproterone acetate multiple interactions ISO GNAQ (Homo sapiens) 6480464 [Cyproterone Acetate binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to GNAQ protein modified form] CTD PMID:28751236 Gnaq Mouse D-glucose multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of GNAQ protein] and CAT protein inhibits the reaction [Glucose results in increased expression of GNAQ protein] CTD PMID:20691780 Gnaq Mouse D-glucose multiple interactions EXP 6480464 GNAQ protein affects the reaction [Glucose results in increased secretion of INS1 protein] and GNAQ protein affects the reaction [Palmitic Acid promotes the reaction [Glucose results in increased secretion of INS1 protein]] CTD PMID:37217659 Gnaq Mouse D-glucose increases expression ISO Gnaq (Rattus norvegicus) 6480464 Glucose results in increased expression of GNAQ protein CTD PMID:20691780 Gnaq Mouse diazinon decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Diazinon results in decreased expression of GNAQ mRNA CTD PMID:17452286 Gnaq Mouse diazinon affects expression ISO Gnaq (Rattus norvegicus) 6480464 Diazinon affects the expression of GNAQ mRNA CTD PMID:22546817 Gnaq Mouse Dibutyl phosphate affects expression ISO GNAQ (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GNAQ mRNA CTD PMID:37042841 Gnaq Mouse diclofenac affects expression ISO GNAQ (Homo sapiens) 6480464 Diclofenac affects the expression of GNAQ mRNA CTD PMID:24752500 Gnaq Mouse endosulfan affects expression ISO Gnaq (Rattus norvegicus) 6480464 Endosulfan affects the expression of GNAQ mRNA CTD PMID:31464424 Gnaq Mouse endosulfan increases expression ISO Gnaq (Rattus norvegicus) 6480464 Endosulfan results in increased expression of GNAQ protein CTD PMID:31464424 Gnaq Mouse ethanol increases expression ISO Gnaq (Rattus norvegicus) 6480464 Ethanol results in increased expression of GNAQ mRNA CTD PMID:20655511 Gnaq Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of GNAQ mRNA CTD PMID:30319688 Gnaq Mouse ethyl methanesulfonate increases expression ISO GNAQ (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of GNAQ mRNA CTD PMID:23649840 Gnaq Mouse fingolimod hydrochloride multiple interactions ISO GNAQ (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of GNAQ protein] CTD PMID:25980589 Gnaq Mouse fluoxetine increases expression ISO Gnaq (Rattus norvegicus) 6480464 Fluoxetine results in increased expression of GNAQ mRNA CTD PMID:1426031 Gnaq Mouse fluoxetine decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Fluoxetine results in decreased expression of GNAQ protein CTD PMID:21712787 Gnaq Mouse fluoxetine multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 Adenosine-5'-(N-ethylcarboxamide) inhibits the reaction [Fluoxetine results in decreased expression of GNAQ protein] CTD PMID:21712787 Gnaq Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GNAQ mRNA CTD PMID:22206623 Gnaq Mouse FR900359 affects localization EXP 6480464 FR900359 affects the localization of GNAQ protein CTD PMID:37217659 Gnaq Mouse fulvestrant multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 [tanshinone co-treated with Fulvestrant] inhibits the reaction [IGF2 protein mutant form results in increased expression of GNAQ protein] and Fulvestrant inhibits the reaction [dan-shen root extract inhibits the reaction [IGF2 protein mutant form results in increased expression of GNAQ protein]] CTD PMID:23419388 and PMID:34655285 Gnaq Mouse furfural multiple interactions ISO GNAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of GNAQ protein CTD PMID:38598786 Gnaq Mouse gadolinium atom increases response to substance EXP 6480464 GNAQ protein results in increased susceptibility to Gadolinium CTD PMID:15068510 Gnaq Mouse glucose multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 acetovanillone inhibits the reaction [Glucose results in increased expression of GNAQ protein] and CAT protein inhibits the reaction [Glucose results in increased expression of GNAQ protein] CTD PMID:20691780 Gnaq Mouse glucose multiple interactions EXP 6480464 GNAQ protein affects the reaction [Glucose results in increased secretion of INS1 protein] and GNAQ protein affects the reaction [Palmitic Acid promotes the reaction [Glucose results in increased secretion of INS1 protein]] CTD PMID:37217659 Gnaq Mouse glucose increases expression ISO Gnaq (Rattus norvegicus) 6480464 Glucose results in increased expression of GNAQ protein CTD PMID:20691780 Gnaq Mouse hexadecanoic acid multiple interactions EXP 6480464 GNAQ protein affects the reaction [Palmitic Acid promotes the reaction [Glucose results in increased secretion of INS1 protein]] CTD PMID:37217659 Gnaq Mouse hexane decreases methylation ISO Gnaq (Rattus norvegicus) 6480464 n-hexane results in decreased methylation of GNAQ promoter CTD PMID:23740543 Gnaq Mouse hydrogen cyanide decreases expression EXP 6480464 Hydrogen Cyanide results in decreased expression of GNAQ mRNA CTD PMID:33914522 Gnaq Mouse hydrogen sulfide decreases expression EXP 6480464 Hydrogen Sulfide results in decreased expression of GNAQ protein CTD PMID:29932956 Gnaq Mouse ivermectin decreases expression ISO GNAQ (Homo sapiens) 6480464 Ivermectin results in decreased expression of GNAQ protein CTD PMID:32959892 Gnaq Mouse lead(0) affects expression ISO GNAQ (Homo sapiens) 6480464 Lead affects the expression of GNAQ mRNA CTD PMID:28903495 Gnaq Mouse leflunomide increases expression ISO GNAQ (Homo sapiens) 6480464 leflunomide results in increased expression of GNAQ mRNA CTD PMID:28988120 Gnaq Mouse methiothepin multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 Methiothepin inhibits the reaction [Serotonin results in increased palmitoylation of GNAQ protein] CTD PMID:9732414 Gnaq Mouse methyl methanesulfonate increases expression ISO GNAQ (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of GNAQ mRNA CTD PMID:23649840 Gnaq Mouse N-ethyl-5'-carboxamidoadenosine multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 Adenosine-5'-(N-ethylcarboxamide) inhibits the reaction [Fluoxetine results in decreased expression of GNAQ protein] CTD PMID:21712787 Gnaq Mouse N-ethyl-5'-carboxamidoadenosine decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Adenosine-5'-(N-ethylcarboxamide) results in decreased expression of GNAQ protein CTD PMID:21712787 Gnaq Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of GNAQ gene CTD PMID:16724327 Gnaq Mouse nickel dichloride affects expression ISO Gnaq (Rattus norvegicus) 6480464 nickel chloride affects the expression of GNAQ mRNA CTD PMID:22546817 Gnaq Mouse oleic acid increases expression ISO Gnaq (Rattus norvegicus) 6480464 Oleic Acid results in increased expression of GNAQ protein CTD PMID:20804650 Gnaq Mouse omipalisib multiple interactions ISO GNAQ (Homo sapiens) 6480464 [GNAQ gene mutant form results in increased susceptibility to [trametinib co-treated with omipalisib]] which results in increased cleavage of CASP3 protein more ... CTD PMID:22733540 Gnaq Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of GNAQ mRNA CTD PMID:23091169 Gnaq Mouse phenylephrine multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 RTKI cpd inhibits the reaction [GNAQ protein promotes the reaction [Phenylephrine results in increased expression of NPPA protein]] and Uridine Triphosphate inhibits the reaction [GNAQ protein promotes the reaction [Phenylephrine results in increased expression of NPPA protein]] CTD PMID:14676212 Gnaq Mouse potassium chromate decreases expression ISO GNAQ (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of GNAQ mRNA CTD PMID:22079256 Gnaq Mouse potassium chromate multiple interactions ISO GNAQ (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GNAQ mRNA CTD PMID:22079256 Gnaq Mouse serotonin increases palmitoylation ISO Gnaq (Rattus norvegicus) 6480464 Serotonin results in increased palmitoylation of GNAQ protein CTD PMID:9732414 Gnaq Mouse serotonin multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 Methiothepin inhibits the reaction [Serotonin results in increased palmitoylation of GNAQ protein] CTD PMID:9732414 Gnaq Mouse sodium arsenite increases expression ISO GNAQ (Homo sapiens) 6480464 sodium arsenite results in increased expression of GNAQ mRNA CTD PMID:38568856 Gnaq Mouse sodium chloride multiple interactions ISO GNAQ (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of GNAQ protein more ... CTD PMID:38598786 Gnaq Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of GNAQ protein CTD PMID:28918527 Gnaq Mouse sphingosine 1-phosphate multiple interactions ISO GNAQ (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of GNAQ protein] and Phytochemicals analog inhibits the reaction [sphingosine 1-phosphate results in increased expression of GNAQ protein] CTD PMID:25980589 Gnaq Mouse sphingosine 1-phosphate increases expression ISO GNAQ (Homo sapiens) 6480464 sphingosine 1-phosphate results in increased expression of GNAQ protein CTD PMID:25980589 Gnaq Mouse streptozocin increases expression ISO Gnaq (Rattus norvegicus) 6480464 Streptozocin results in increased expression of GNAQ protein CTD PMID:20691780 Gnaq Mouse streptozocin multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 acetovanillone inhibits the reaction [Streptozocin results in increased expression of GNAQ protein] and CAT protein inhibits the reaction [Streptozocin results in increased expression of GNAQ protein] CTD PMID:20691780 Gnaq Mouse strontium atom increases response to substance EXP 6480464 GNAQ protein results in increased susceptibility to Strontium CTD PMID:15068510 Gnaq Mouse succimer multiple interactions EXP 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of GNAQ mRNA CTD PMID:26378955 Gnaq Mouse tamibarotene affects expression ISO GNAQ (Homo sapiens) 6480464 tamibarotene affects the expression of GNAQ mRNA CTD PMID:15498508 Gnaq Mouse Tanshinone I multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 [tanshinone co-treated with Fulvestrant] inhibits the reaction [IGF2 protein mutant form results in increased expression of GNAQ protein] CTD PMID:34655285 Gnaq Mouse theophylline decreases expression ISO Gnaq (Rattus norvegicus) 6480464 Theophylline results in decreased expression of GNAQ protein CTD PMID:15998294 Gnaq Mouse Thrombin multiple interactions ISO GNAQ (Homo sapiens) 6480464 GNAQ protein affects the reaction [Thrombin results in increased expression of CHST11 mRNA] and GNAQ protein affects the reaction [Thrombin results in increased expression of CHSY1 mRNA] CTD PMID:36430902 Gnaq Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of GNAQ gene CTD PMID:35295148 Gnaq Mouse trametinib multiple interactions ISO GNAQ (Homo sapiens) 6480464 [GNAQ gene mutant form results in increased susceptibility to [trametinib co-treated with omipalisib]] which results in increased cleavage of CASP3 protein more ... CTD PMID:22733540 Gnaq Mouse trametinib increases response to substance ISO GNAQ (Homo sapiens) 6480464 GNAQ protein mutant form results in increased susceptibility to trametinib CTD PMID:22733540 Gnaq Mouse triphenyl phosphate affects expression ISO GNAQ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GNAQ mRNA CTD PMID:37042841 Gnaq Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of GNAQ mRNA CTD PMID:33045310 Gnaq Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of GNAQ mRNA CTD PMID:28973697 Gnaq Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of GNAQ mRNA CTD PMID:30912803 Gnaq Mouse tyrphostin AG 1478 multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 RTKI cpd inhibits the reaction [GNAQ protein promotes the reaction [Phenylephrine results in increased expression of NPPA protein]] CTD PMID:14676212 Gnaq Mouse urethane increases expression ISO GNAQ (Homo sapiens) 6480464 Urethane results in increased expression of GNAQ mRNA CTD PMID:28818685 Gnaq Mouse UTP multiple interactions ISO Gnaq (Rattus norvegicus) 6480464 Uridine Triphosphate inhibits the reaction [GNAQ protein promotes the reaction [Phenylephrine results in increased expression of NPPA protein]] CTD PMID:14676212 Gnaq Mouse valproic acid decreases expression ISO GNAQ (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GNAQ mRNA CTD PMID:23179753 more ... Gnaq Mouse venlafaxine hydrochloride affects expression ISO Gnaq (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride affects the expression of GNAQ mRNA CTD PMID:25423262 Gnaq Mouse vinclozolin increases methylation ISO Gnaq (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of GNAQ gene CTD PMID:31682807
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 2-methylcholine (ISO) 2-nitrotoluene (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (EXP) 4-vinylcyclohexene dioxide (EXP) aflatoxin B1 (EXP) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) aluminium atom (EXP) aluminium(0) (EXP) ammonium chloride (ISO) apocynin (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (ISO) bisphenol AF (ISO) bromochloroacetic acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbamazepine (ISO) chlorpyrifos (EXP) cicaprost (ISO) cisplatin (ISO) cobalt dichloride (ISO) coumestrol (ISO) cyclosporin A (EXP) cyproterone acetate (ISO) D-glucose (EXP,ISO) diazinon (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) endosulfan (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fingolimod hydrochloride (ISO) fluoxetine (ISO) folic acid (EXP) FR900359 (EXP) fulvestrant (ISO) furfural (ISO) gadolinium atom (EXP) glucose (EXP,ISO) hexadecanoic acid (EXP) hexane (ISO) hydrogen cyanide (EXP) hydrogen sulfide (EXP) ivermectin (ISO) lead(0) (ISO) leflunomide (ISO) methiothepin (ISO) methyl methanesulfonate (ISO) N-ethyl-5'-carboxamidoadenosine (ISO) N-ethyl-N-nitrosourea (EXP) nickel dichloride (ISO) oleic acid (ISO) omipalisib (ISO) phenobarbital (EXP) phenylephrine (ISO) potassium chromate (ISO) serotonin (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (EXP) sphingosine 1-phosphate (ISO) streptozocin (ISO) strontium atom (EXP) succimer (EXP) tamibarotene (ISO) Tanshinone I (ISO) theophylline (ISO) Thrombin (ISO) titanium dioxide (EXP) trametinib (ISO) triphenyl phosphate (ISO) triptonide (EXP) troglitazone (EXP) tungsten (EXP) tyrphostin AG 1478 (ISO) urethane (ISO) UTP (ISO) valproic acid (ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO)
1.
Molecular properties of muscarinic acetylcholine receptors.
Haga T Proc Jpn Acad Ser B Phys Biol Sci. 2013;89(6):226-56.
2.
Science review: Vasopressin and the cardiovascular system part 1--receptor physiology.
Holmes CL, etal., Crit Care. 2003 Dec;7(6):427-34. Epub 2003 Jun 26.
3.
Pleiotropic AT1 receptor signaling pathways mediating physiological and pathogenic actions of angiotensin II.
Hunyady L and Catt KJ, Mol Endocrinol. 2006 May;20(5):953-70. Epub 2005 Sep 1.
4.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
5.
A functional polymorphism of the Galphaq (GNAQ) gene is associated with accelerated mortality in African-American heart failure.
Liggett SB, etal., Hum Mol Genet. 2007 Nov 15;16(22):2740-50. doi: 10.1093/hmg/ddm229. Epub 2007 Aug 24.
6.
Transient cardiac expression of constitutively active Galphaq leads to hypertrophy and dilated cardiomyopathy by calcineurin-dependent and independent pathways.
Mende U, etal., Proc Natl Acad Sci U S A. 1998 Nov 10;95(23):13893-8.
7.
MGDs mouse GO annotations
MGD data from the GO Consortium
8.
MGD IEA
MGD IEA
9.
Discovery of new membrane-associated proteins overexpressed in small-cell lung cancer.
Ocak S, etal., J Thorac Oncol. 2014 Mar;9(3):324-36. doi: 10.1097/JTO.0000000000000090.
10.
Embryonic cardiomyocyte hypoplasia and craniofacial defects in G alpha q/G alpha 11-mutant mice.
Offermanns S, etal., EMBO J 1998 Aug 3;17(15):4304-12.
11.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
14.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
15.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Regulation of phosphoinositide-specific phospholipase C.
Rhee SG Annu Rev Biochem. 2001;70:281-312.
19.
Orexin receptor type-1 couples exclusively to pertussis toxin-insensitive G-proteins, while orexin receptor type-2 couples to both pertussis toxin-sensitive and -insensitive G-proteins.
Zhu Y, etal., J Pharmacol Sci. 2003 Jul;92(3):259-66.
Gnaq Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 16,110,048 - 16,365,884 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 16,110,195 - 16,364,827 (+) Ensembl GRCm39 Ensembl GRCm38 19 16,132,684 - 16,388,520 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 16,132,831 - 16,387,463 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 16,207,321 - 16,461,943 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 16,199,850 - 16,454,472 (+) NCBI MGSCv36 mm8 MGSCv36 19 15,738,354 - 16,003,046 (+) NCBI MGSCv36 mm8 Celera 19 16,873,630 - 17,041,492 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 11.01 NCBI
GNAQ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 77,716,097 - 78,031,811 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 77,716,097 - 78,031,811 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 80,331,013 - 80,646,727 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 79,525,009 - 79,836,012 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 77,564,746 - 77,875,746 NCBI Celera 9 50,912,294 - 51,223,287 (-) NCBI Celera Cytogenetic Map 9 q21.2 NCBI HuRef 9 50,167,421 - 50,477,535 (-) NCBI HuRef CHM1_1 9 80,482,435 - 80,793,672 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 89,873,050 - 90,188,930 (-) NCBI T2T-CHM13v2.0
Gnaq Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 222,852,453 - 223,098,754 (+) NCBI GRCr8 mRatBN7.2 1 213,425,631 - 213,671,947 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 213,424,465 - 213,667,672 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 221,757,414 - 222,003,643 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 228,689,512 - 228,935,809 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 221,511,974 - 221,758,205 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 233,382,778 - 233,622,584 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 233,382,708 - 233,622,786 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 240,497,178 - 240,736,860 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 219,520,998 - 219,764,401 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 219,685,020 - 219,928,420 (+) NCBI Celera 1 210,763,138 - 211,002,668 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
Gnaq Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955512 1,381,159 - 1,658,409 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100986730 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 76,877,498 - 77,190,897 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 76,883,323 - 77,196,700 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 46,816,409 - 47,129,116 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 76,570,773 - 76,773,847 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 76,575,815 - 76,773,849 (-) Ensembl panpan1.1 panPan2
GNAQ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 80,733,530 - 80,928,065 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 80,715,366 - 80,928,065 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 81,197,285 - 81,391,732 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 81,038,541 - 81,345,574 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 81,038,966 - 81,343,028 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 80,931,602 - 81,126,112 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 80,652,980 - 80,847,487 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 81,383,410 - 81,578,003 (+) NCBI UU_Cfam_GSD_1.0
LOC101971998 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 127,896,936 - 128,074,513 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936503 13,099,558 - 13,276,152 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936503 13,098,517 - 13,276,106 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GNAQ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 230,605,265 - 230,907,674 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 230,607,469 - 230,906,988 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 257,372,859 - 257,378,851 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GNAQ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 88,666,375 - 88,988,989 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 88,670,424 - 88,871,154 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 76,997,006 - 77,320,682 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gnaq
.
Predicted Target Of
Count of predictions: 1836 Count of miRNA genes: 770 Interacting mature miRNAs: 1048 Transcripts: ENSMUST00000025541, ENSMUST00000167656, ENSMUST00000170229 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142302 Nstr1_m nerve sheath tumor resistance QTL 1 (mouse) Not determined 19 1 22371338 Mouse 1301271 Datd_m dopamine transporter density (mouse) Not determined 19 1 32340234 Mouse 10413881 Moe2_m modifier of epilepsy 2 (mouse) 19 14923016 48923138 Mouse 1300923 Bits4_m bitterness sensitivity 4 (mouse) Not determined 19 3323216 37323348 Mouse 11039522 Tbbr4_m Trypanosoma brucei brucei response 4 (mouse) 19 5313326 39313470 Mouse 1301336 Alcp23_m alcohol preference locus 23 (mouse) Not determined 19 15912607 49912719 Mouse 4142161 Drinksac2_m drink saccharin 2 (mouse) Not determined 1 20695286 Mouse 1357819 Tgct2_m testicular germ cell tumor 2 (mouse) Not determined 19 3328551 20539663 Mouse 1302019 Pgia23_m proteoglycan induced arthritis 23 (mouse) Not determined 19 9787453 43787602 Mouse 1301633 Alcp24_m alcohol preference locus 24 (mouse) Not determined 19 15912607 49912719 Mouse 14928311 Manh85_m mandible shape 85 (mouse) 19 11914789 45914789 Mouse 38455997 Cdtm2_m CD62L+ CD8 TM cells 2 (mouse) 19 9977364 19977364 Mouse 4142406 Pbctlp1_m peripheral blood cytotoxic T lymphocyte percentage 1 (mouse) Not determined 1 32875174 Mouse 1300776 Lfp3_m long free running period 3 (mouse) Not determined 19 1 20328703 Mouse 1300904 Chab5_m cholesterol absorption 5 (mouse) Not determined 19 1653764 35653927 Mouse 26884385 Skwq14_m skull length QTL 14, 16 week (mouse) 19 3250000 35877400 Mouse 1301800 Faq10_m fluctuating asymmetry QTL 10 (mouse) Not determined 19 3323216 37323348 Mouse 12801464 Rta2_m retinal aging 2 (mouse) 14 12302874 25302874 Mouse 1300591 Pas3_m pulmonary adenoma susceptibility 3 (mouse) Not determined 19 3323216 37323348 Mouse 1302126 Skull26_m skull morphology 26 (mouse) Not determined 19 3323216 37323348 Mouse 1301228 Iba4_m induction of brown adipocytes 4 (mouse) Not determined 19 9305715 43305821 Mouse
RH127065
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,371,180 - 16,371,396 UniSTS GRCm38 MGSCv37 19 16,445,670 - 16,445,886 UniSTS GRCm37 Celera 19 17,025,229 - 17,025,445 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS Whitehead/MRC_RH 19 176.74 UniSTS
RH136177
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,314,711 - 16,314,910 UniSTS GRCm38 MGSCv37 19 16,389,201 - 16,389,400 UniSTS GRCm37 Celera 19 16,968,583 - 16,968,782 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS
AW060788
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,385,140 - 16,385,260 UniSTS GRCm38 MGSCv37 19 16,459,630 - 16,459,750 UniSTS GRCm37 Celera 19 17,039,179 - 17,039,299 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS Whitehead/MRC_RH 19 176.12 UniSTS
Gnaq
Mouse Assembly Chr Position (strand) Source JBrowse MGSCv37 19 16,457,861 - 16,458,183 UniSTS GRCm37 Celera 19 17,037,420 - 17,037,742 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS
02.MMHAP85FRA8.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,220,016 - 16,220,177 UniSTS GRCm38 MGSCv37 19 16,294,506 - 16,294,667 UniSTS GRCm37 Celera 19 16,874,090 - 16,874,251 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS Whitehead_YAC 19 UniSTS
D19Mit52
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,146,324 - 16,146,460 UniSTS GRCm38 MGSCv37 19 16,220,814 - 16,220,950 UniSTS GRCm37 Celera 19 16,798,688 - 16,798,824 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 8.0 UniSTS Whitehead Genetic 19 9.8 UniSTS Whitehead/MRC_RH 19 174.41 UniSTS Whitehead_YAC 19 UniSTS
RH124695
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,388,228 - 16,388,480 UniSTS GRCm38 MGSCv37 19 16,462,718 - 16,462,970 UniSTS GRCm37 Celera 19 17,042,267 - 17,042,519 UniSTS Cytogenetic Map 19 A UniSTS cM Map 19 9.0 UniSTS
Gnaq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 19 16,383,371 - 16,383,693 UniSTS GRCm38 MGSCv37 19 16,457,861 - 16,458,183 UniSTS GRCm37 Celera 19 17,037,420 - 17,037,742 UniSTS Cytogenetic Map 19 A UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000025541 ⟹ ENSMUSP00000025541
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 16,110,195 - 16,364,827 (+) Ensembl GRCm38.p6 Ensembl 19 16,132,831 - 16,387,463 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000167656
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 16,196,996 - 16,294,638 (+) Ensembl GRCm38.p6 Ensembl 19 16,219,632 - 16,317,274 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000170229
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 16,110,660 - 16,293,891 (+) Ensembl GRCm38.p6 Ensembl 19 16,133,296 - 16,316,527 (+) Ensembl
RefSeq Acc Id:
NM_008139 ⟹ NP_032165
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 16,110,048 - 16,365,884 (+) NCBI GRCm38 19 16,132,684 - 16,388,520 (+) NCBI MGSCv37 19 16,207,321 - 16,461,943 (+) RGD Celera 19 16,873,630 - 17,041,492 (+) RGD cM Map 19 ENTREZGENE
Sequence:
GCCCCCTCCCGGATCTGTGCTCCAGTTCAGAGAAAGGAGAAAATGTGTGTGTGTGGCGAGGGGGAGGGCGAGCACTGAGCAGCCGCGGCGCGCCTGGCAATCGGGCCGGGTGGGCGTCCGGCGGAGGC
hide sequence
RefSeq Acc Id:
NP_032165 ⟸ NM_008139
- UniProtKB:
Q6PFF5 (UniProtKB/Swiss-Prot), P21279 (UniProtKB/Swiss-Prot), Q3UHH5 (UniProtKB/TrEMBL)
- Sequence:
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPY
hide sequence
Ensembl Acc Id:
ENSMUSP00000025541 ⟸ ENSMUST00000025541
RGD ID: 13679048 Promoter ID: EPDNEW_M23673 Type: initiation region Name: Gnaq_1 Description: Mus musculus guanine nucleotide binding protein, alpha q polypeptide, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 19 16,132,880 - 16,132,940 EPDNEW
RGD ID: 6830098 Promoter ID: MM_KWN:26578 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: NM_008139 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 16,206,751 - 16,207,917 (+) MPROMDB
