Symbol:
Map3k11
Name:
mitogen-activated protein kinase kinase kinase 11
RGD ID:
1359261
Description:
Enables ATP binding activity; JUN kinase kinase kinase activity; and enzyme binding activity. Involved in several processes, including JNK cascade; positive regulation of JNK cascade; and protein autophosphorylation. Predicted to be located in microtubule. Predicted to be active in centrosome and cytoplasm. Orthologous to human MAP3K11 (mitogen-activated protein kinase kinase kinase 11); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; p38 MAPK signaling pathway; Reelin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
mixed lineage kinase 3; Mlk-3; Mlk3; RHOE
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Map3k11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Map3k11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Map3k11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Map3k11 (mitogen-activated protein kinase kinase kinase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NCOR1 (nuclear receptor corepressor 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MAP3K11 (mitogen-activated protein kinase kinase kinase 11)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Map3k11 (mitogen-activated protein kinase kinase kinase 11)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mlk-1
Alliance
DIOPT (OrthoFinder|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
slpr
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 212,404,685 - 212,417,986 (+) NCBI GRCr8 mRatBN7.2 1 202,975,353 - 202,988,655 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 202,975,353 - 202,988,652 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 211,327,935 - 211,341,229 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 218,420,755 - 218,434,054 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 211,111,801 - 211,125,100 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 221,043,119 - 221,056,420 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 221,043,119 - 221,056,417 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,978,441 - 227,991,742 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 208,312,955 - 208,326,289 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 208,466,407 - 208,479,739 (+) NCBI Celera 1 200,511,102 - 200,524,400 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map3k11 Rat 1,2-dimethylhydrazine multiple interactions ISO Map3k11 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP3K11 mRNA CTD PMID:22206623 Map3k11 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Map3k11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of MAP3K11 gene and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MAP3K11 promoter] CTD PMID:19654925 and PMID:21212295 Map3k11 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP3K11 mRNA CTD PMID:34747641 Map3k11 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map3k11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP3K11 mRNA CTD PMID:21570461 Map3k11 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Map3k11 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP3K11 mRNA CTD PMID:15652763 Map3k11 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MAP3K11 mRNA CTD PMID:21346803 Map3k11 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MAP3K11 mRNA CTD PMID:21346803 Map3k11 Rat 4,4'-sulfonyldiphenol affects methylation ISO Map3k11 (Mus musculus) 6480464 bisphenol S affects the methylation of MAP3K11 gene CTD PMID:31683443 Map3k11 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MAP3K11 mRNA CTD PMID:24780913 Map3k11 Rat acrolein multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of MAP3K11 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of MAP3K11 mRNA CTD PMID:32699268 Map3k11 Rat aflatoxin B1 decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MAP3K11 mRNA CTD PMID:27153756 Map3k11 Rat all-trans-retinoic acid increases expression ISO MAP3K11 (Homo sapiens) 6480464 Tretinoin results in increased expression of MAP3K11 mRNA CTD PMID:33167477 Map3k11 Rat alpha-pinene multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of MAP3K11 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of MAP3K11 mRNA CTD PMID:32699268 Map3k11 Rat antirheumatic drug decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MAP3K11 mRNA CTD PMID:24449571 Map3k11 Rat aristolochic acid A increases expression ISO MAP3K11 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAP3K11 mRNA CTD PMID:33212167 Map3k11 Rat benzo[a]pyrene multiple interactions ISO Map3k11 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to MAP3K11 promoter] CTD PMID:19654925 Map3k11 Rat benzo[a]pyrene increases expression ISO Map3k11 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAP3K11 mRNA CTD PMID:22228805 Map3k11 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of MAP3K11 mRNA CTD PMID:21839799 Map3k11 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAP3K11 mRNA CTD PMID:25181051 Map3k11 Rat bisphenol A increases expression ISO Map3k11 (Mus musculus) 6480464 bisphenol A results in increased expression of MAP3K11 mRNA CTD PMID:32156529 Map3k11 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAP3K11 mRNA CTD PMID:34947998 Map3k11 Rat caffeine decreases phosphorylation ISO MAP3K11 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of MAP3K11 protein CTD PMID:35688186 Map3k11 Rat copper atom multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP3K11 mRNA CTD PMID:30911355 Map3k11 Rat copper(0) multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP3K11 mRNA CTD PMID:30911355 Map3k11 Rat copper(II) chloride increases expression ISO MAP3K11 (Homo sapiens) 6480464 cupric chloride results in increased expression of MAP3K11 mRNA CTD PMID:38568856 Map3k11 Rat copper(II) sulfate decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MAP3K11 mRNA CTD PMID:19549813 Map3k11 Rat crocidolite asbestos affects expression ISO MAP3K11 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of MAP3K11 mRNA CTD PMID:17331233 Map3k11 Rat crocidolite asbestos increases expression ISO Map3k11 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of MAP3K11 mRNA CTD PMID:29279043 Map3k11 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MAP3K11 mRNA CTD PMID:26577399 Map3k11 Rat cyclosporin A decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MAP3K11 mRNA CTD PMID:20106945 and PMID:25562108 Map3k11 Rat diazinon increases methylation ISO MAP3K11 (Homo sapiens) 6480464 Diazinon results in increased methylation of MAP3K11 gene CTD PMID:22964155 Map3k11 Rat dibutyl phthalate increases expression ISO Map3k11 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAP3K11 mRNA CTD PMID:21266533 Map3k11 Rat doxorubicin decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAP3K11 mRNA CTD PMID:29803840 Map3k11 Rat ethanol affects expression ISO Map3k11 (Mus musculus) 6480464 Ethanol affects the expression of MAP3K11 mRNA CTD PMID:30319688 Map3k11 Rat folic acid multiple interactions ISO Map3k11 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAP3K11 mRNA CTD PMID:22206623 Map3k11 Rat FR900359 increases phosphorylation ISO MAP3K11 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MAP3K11 protein CTD PMID:37730182 Map3k11 Rat fulvestrant increases expression ISO MAP3K11 (Homo sapiens) 6480464 fulvestrant results in increased expression of MAP3K11 mRNA CTD PMID:12154049 Map3k11 Rat furan increases methylation EXP 6480464 furan results in increased methylation of MAP3K11 gene CTD PMID:22079235 Map3k11 Rat lipopolysaccharide increases phosphorylation ISO MAP3K11 (Homo sapiens) 6480464 Lipopolysaccharides results in increased phosphorylation of MAP3K11 protein CTD PMID:17698565 Map3k11 Rat lipopolysaccharide multiple interactions ISO Map3k11 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of MAP3K11 gene CTD PMID:21212295 Map3k11 Rat manganese(II) chloride increases phosphorylation EXP 6480464 manganese chloride results in increased phosphorylation of MAP3K11 protein CTD PMID:15342272 Map3k11 Rat nitrates multiple interactions ISO Map3k11 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MAP3K11 mRNA CTD PMID:35964746 Map3k11 Rat NSC 23766 multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 NSC 23766 inhibits the reaction [Zinc Oxide results in increased expression of MAP3K11 protein] CTD PMID:22166487 Map3k11 Rat ozone multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of MAP3K11 mRNA more ... CTD PMID:32699268 and PMID:35430440 Map3k11 Rat ozone multiple interactions ISO Map3k11 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAP3K11 mRNA CTD PMID:34911549 Map3k11 Rat perfluorohexanesulfonic acid decreases expression ISO Map3k11 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of MAP3K11 mRNA CTD PMID:37995155 Map3k11 Rat perfluorononanoic acid decreases expression ISO MAP3K11 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of MAP3K11 mRNA CTD PMID:38568856 Map3k11 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Map3k11 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MAP3K11 mRNA CTD PMID:36331819 Map3k11 Rat poly(I:C) increases phosphorylation ISO MAP3K11 (Homo sapiens) 6480464 Poly I-C results in increased phosphorylation of MAP3K11 protein CTD PMID:17698565 Map3k11 Rat raloxifene increases expression ISO MAP3K11 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of MAP3K11 mRNA CTD PMID:12154049 Map3k11 Rat selenomethionine affects expression ISO MAP3K11 (Homo sapiens) 6480464 Selenomethionine affects the expression of MAP3K11 mRNA CTD PMID:17222674 Map3k11 Rat sodium arsenite increases expression ISO MAP3K11 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP3K11 mRNA CTD PMID:38568856 Map3k11 Rat sodium arsenite increases expression ISO Map3k11 (Mus musculus) 6480464 sodium arsenite results in increased expression of MAP3K11 mRNA CTD PMID:36209798 Map3k11 Rat sulfates affects methylation ISO MAP3K11 (Homo sapiens) 6480464 Sulfates affects the methylation of MAP3K11 promoter CTD PMID:25395096 Map3k11 Rat thimerosal decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Thimerosal results in decreased expression of MAP3K11 mRNA CTD PMID:27188386 Map3k11 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAP3K11 mRNA CTD PMID:34492290 Map3k11 Rat titanium dioxide decreases methylation ISO Map3k11 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP3K11 gene CTD PMID:35295148 Map3k11 Rat triphenyl phosphate affects expression ISO MAP3K11 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAP3K11 mRNA CTD PMID:37042841 Map3k11 Rat tungsten decreases expression ISO Map3k11 (Mus musculus) 6480464 Tungsten results in decreased expression of MAP3K11 mRNA CTD PMID:30912803 Map3k11 Rat urethane increases expression ISO MAP3K11 (Homo sapiens) 6480464 Urethane results in increased expression of MAP3K11 mRNA CTD PMID:28818685 Map3k11 Rat valproic acid affects expression ISO Map3k11 (Mus musculus) 6480464 Valproic Acid affects the expression of MAP3K11 mRNA CTD PMID:17963808 Map3k11 Rat valproic acid decreases expression ISO MAP3K11 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAP3K11 mRNA CTD PMID:28001369 Map3k11 Rat valproic acid increases methylation ISO MAP3K11 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAP3K11 gene CTD PMID:29154799 Map3k11 Rat valproic acid affects expression ISO MAP3K11 (Homo sapiens) 6480464 Valproic Acid affects the expression of MAP3K11 mRNA CTD PMID:25979313 Map3k11 Rat valproic acid decreases expression ISO Map3k11 (Mus musculus) 6480464 Valproic Acid results in decreased expression of MAP3K11 mRNA CTD PMID:21427059 Map3k11 Rat valproic acid increases expression ISO Map3k11 (Mus musculus) 6480464 Valproic Acid results in increased expression of MAP3K11 mRNA CTD PMID:21427059 Map3k11 Rat zinc oxide multiple interactions ISO MAP3K11 (Homo sapiens) 6480464 NSC 23766 inhibits the reaction [Zinc Oxide results in increased expression of MAP3K11 protein] CTD PMID:22166487 Map3k11 Rat zinc oxide increases expression ISO MAP3K11 (Homo sapiens) 6480464 Zinc Oxide results in increased expression of MAP3K11 protein CTD PMID:22166487
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) caffeine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) diazinon (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) lipopolysaccharide (ISO) manganese(II) chloride (EXP) nitrates (ISO) NSC 23766 (ISO) ozone (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) poly(I:C) (ISO) raloxifene (ISO) selenomethionine (ISO) sodium arsenite (ISO) sulfates (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) zinc oxide (ISO)
Biological Process
cell cycle G1/S phase transition (IEA,ISO) JNK cascade (IBA,IDA,IEA,ISO) MAPK cascade (IEA,ISO) microtubule-based process (IBA,IEA,ISO) positive regulation of apoptotic process (IBA,IMP) positive regulation of JNK cascade (IDA,IEA,ISO) positive regulation of JUN kinase activity (ISO) positive regulation of neuron apoptotic process (IMP) protein autophosphorylation (IDA,ISO) protein phosphorylation (IDA,ISO)
Molecular Function
ATP binding (IDA,IEA) identical protein binding (IEA,ISO) JUN kinase kinase kinase activity (IBA,IDA,IEA,ISO) kinase activity (IEA) MAP kinase kinase kinase activity (IDA,IEA,ISO) mitogen-activated protein kinase kinase binding (IPI) mitogen-activated protein kinase kinase kinase binding (IEA,ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein homodimerization activity (IEA,ISO) protein kinase activity (IEA) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IDA,IEA,ISO) small GTPase binding (IPI) transferase activity (IEA)
1.
Mechanisms and functions of p38 MAPK signalling.
Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
4.
Mixed lineage kinase 3 (MLK3)-activated p38 MAP kinase mediates transforming growth factor-beta-induced apoptosis in hepatoma cells.
Kim KY, etal., J Biol Chem 2004 Jul 9;279(28):29478-84. Epub 2004 Apr 6.
5.
Evidence for a role of mixed lineage kinases in neuronal apoptosis.
Mota M, etal., J Neurosci. 2001 Jul 15;21(14):4949-57.
6.
The neuroprotective effects of K252a through inhibiting MLK3/MKK7/JNK3 signaling pathway on ischemic brain injury in rat hippocampal CA1 region.
Pan J, etal., Neuroscience. 2005;131(1):147-59.
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Signaling from the small GTP-binding proteins Rac1 and Cdc42 to the c-Jun N-terminal kinase/stress-activated protein kinase pathway. A role for mixed lineage kinase 3/protein-tyrosine kinase 1, a novel member of the mixed lineage kinase family.
Teramoto H, etal., J Biol Chem. 1996 Nov 1;271(44):27225-8.
14.
Inhibition of MLK3-MKK4/7-JNK1/2 pathway by Akt1 in exogenous estrogen-induced neuroprotection against transient global cerebral ischemia by a non-genomic mechanism in male rats.
Wang R, etal., J Neurochem. 2006 Dec;99(6):1543-54. Epub 2006 Oct 25.
15.
The MLK family mediates c-Jun N-terminal kinase activation in neuronal apoptosis.
Xu Z, etal., Mol Cell Biol. 2001 Jul;21(14):4713-24.
16.
Delayed activation and regulation of MKK7 in hippocampal CA1 region following global cerebral ischemia in rats.
Zhang Q, etal., Life Sci. 2003 Nov 21;74(1):37-45.
17.
Crosstalk between PSD-95 and JIP1-mediated signaling modules: the mechanism of MLK3 activation in cerebral ischemia.
Zhang QX, etal., Biochemistry. 2007 Apr 3;46(13):4006-16. Epub 2007 Mar 10.
18.
Down-regulation Cdc42 attenuates neuronal apoptosis through inhibiting MLK3/JNK3 cascade during ischemic reperfusion in rat hippocampus.
Zhao J, etal., Cell Signal. 2007 Apr;19(4):831-43. Epub 2006 Dec 8.
19.
SUMOylation of the kainate receptor subunit GluK2 contributes to the activation of the MLK3-JNK3 pathway following kainate stimulation.
Zhu QJ, etal., FEBS Lett. 2012 May 7;586(9):1259-64. doi: 10.1016/j.febslet.2012.03.048. Epub 2012 Mar 31.
Map3k11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 212,404,685 - 212,417,986 (+) NCBI GRCr8 mRatBN7.2 1 202,975,353 - 202,988,655 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 202,975,353 - 202,988,652 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 211,327,935 - 211,341,229 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 218,420,755 - 218,434,054 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 211,111,801 - 211,125,100 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 221,043,119 - 221,056,420 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 221,043,119 - 221,056,417 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 227,978,441 - 227,991,742 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 208,312,955 - 208,326,289 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 208,466,407 - 208,479,739 (+) NCBI Celera 1 200,511,102 - 200,524,400 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
MAP3K11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 65,597,757 - 65,614,221 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 65,597,756 - 65,615,382 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 65,365,228 - 65,381,692 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 65,121,802 - 65,138,296 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 65,121,801 - 65,138,296 NCBI Celera 11 62,691,942 - 62,708,437 (-) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 61,692,198 - 61,708,691 (-) NCBI HuRef CHM1_1 11 65,249,129 - 65,265,648 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 65,591,917 - 65,608,380 (-) NCBI T2T-CHM13v2.0
Map3k11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 5,738,764 - 5,752,893 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 5,738,770 - 5,752,893 (+) Ensembl GRCm39 Ensembl GRCm38 19 5,688,411 - 5,702,865 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 5,688,742 - 5,702,865 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 5,689,131 - 5,702,865 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 5,689,131 - 5,702,865 (+) NCBI MGSCv36 mm8 Celera 19 5,559,170 - 5,572,916 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 4.34 NCBI
Map3k11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 19,651,372 - 19,667,924 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 19,651,371 - 19,666,468 (+) NCBI ChiLan1.0 ChiLan1.0
MAP3K11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 66,827,487 - 66,844,363 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 67,870,243 - 67,888,664 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 60,956,880 - 60,973,972 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 64,291,099 - 64,308,711 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 64,291,635 - 64,307,737 (-) Ensembl panpan1.1 panPan2
MAP3K11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 51,593,641 - 51,609,245 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 51,594,274 - 51,608,696 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 50,201,432 - 50,217,631 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 52,630,200 - 52,646,397 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 52,631,100 - 52,646,392 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 51,730,092 - 51,746,289 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 51,304,151 - 51,320,331 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 52,094,525 - 52,110,726 (+) NCBI UU_Cfam_GSD_1.0
Map3k11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 7,405,272 - 7,420,546 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 3,848,334 - 3,863,005 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 3,847,637 - 3,862,895 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP3K11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 6,640,056 - 6,657,713 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 6,640,061 - 6,657,717 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 5,910,163 - 5,914,495 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP3K11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 8,625,431 - 8,639,049 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 8,625,961 - 8,638,924 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 105,919,807 - 105,938,227 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map3k11
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 81 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000028185 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
AI502630
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 202,988,457 - 202,988,638 (+) MAPPER mRatBN7.2 mRatBN7.2 4 132,277,197 - 132,277,459 (+) MAPPER mRatBN7.2 Rnor_6.0 4 132,086,377 - 132,086,638 NCBI Rnor6.0 Rnor_6.0 1 221,056,223 - 221,056,403 NCBI Rnor6.0 Rnor_5.0 4 196,577,927 - 196,578,188 UniSTS Rnor5.0 Rnor_5.0 1 227,991,545 - 227,991,725 UniSTS Rnor5.0 RGSC_v3.4 1 208,326,092 - 208,326,272 UniSTS RGSC3.4 RGSC_v3.4 4 134,489,579 - 134,489,840 UniSTS RGSC3.4 Celera 4 121,136,822 - 121,137,083 UniSTS Celera 1 200,524,203 - 200,524,383 UniSTS RH 3.4 Map 4 808.61 UniSTS Cytogenetic Map 4 q34 UniSTS Cytogenetic Map 1 q43 UniSTS
PMC87148P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 202,975,828 - 202,975,992 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,043,595 - 221,043,758 NCBI Rnor6.0 Rnor_5.0 1 227,978,917 - 227,979,080 UniSTS Rnor5.0 RGSC_v3.4 1 208,313,431 - 208,313,594 UniSTS RGSC3.4 Celera 1 200,511,578 - 200,511,741 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028185 ⟹ ENSRNOP00000028185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 202,975,353 - 202,988,652 (+) Ensembl Rnor_6.0 Ensembl 1 221,043,119 - 221,056,417 (+) Ensembl
RefSeq Acc Id:
NM_001013150 ⟹ NP_001013168
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 212,404,685 - 212,417,986 (+) NCBI mRatBN7.2 1 202,975,353 - 202,988,655 (+) NCBI Rnor_6.0 1 221,043,119 - 221,056,420 (+) NCBI Rnor_5.0 1 227,978,441 - 227,991,742 (+) NCBI RGSC_v3.4 1 208,312,955 - 208,326,289 (+) RGD Celera 1 200,511,102 - 200,524,400 (+) RGD
Sequence:
CCCGAGAAGAGGTAGCTTCGGCTCTATTGGAGACTTTCTCTTACCTCTTGTATCTCAAGACAACAACCAGAGTCCAGGCGCCGACCCTGGCAGGCCCCACCTTACAGTAGGCGGGCGCTGGAGCCAGG
hide sequence
RefSeq Acc Id:
NP_001013168 ⟸ NM_001013150
- UniProtKB:
Q80YF1 (UniProtKB/Swiss-Prot), Q66HA1 (UniProtKB/Swiss-Prot), A6HZ88 (UniProtKB/TrEMBL)
- Sequence:
MEPLKNLFLKSPLGSWNGSGSGGGGGSGGVRPEGSPKATAAYANPVWTALFDYEPNGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLEEVIGIGG
hide sequence
Ensembl Acc Id:
ENSRNOP00000028185 ⟸ ENSRNOT00000028185
RGD ID: 13690667 Promoter ID: EPDNEW_R1192 Type: multiple initiation site Name: Map3k11_1 Description: mitogen-activated protein kinase kinase kinase 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 221,043,093 - 221,043,153 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-29
Map3k11
mitogen-activated protein kinase kinase kinase 11
Symbol and Name status set to provisional
70820 PROVISIONAL
