Advanced Search (OLGA)

Gene: IFNA21 (interferon alpha 21) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

IFNA21

Name:

interferon alpha 21

RGD ID:

1344688

HGNC Page

HGNC:5424

Description:

Predicted to enable cytokine activity and type I interferon receptor binding activity. Predicted to be involved in several processes, including lymphocyte activation involved in immune response; response to exogenous dsRNA; and type I interferon-mediated signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

IFN-alpha-21; IFN-alphaI; interferon alpha-21; interferon alpha-F; interferon, alpha 21; LeIF F; leIF-F; leukocyte interferon protein; MGC126687; MGC126689

RGD Orthologs

Bonobo

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

IFNA20P

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,165,637 - 21,166,660 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	21,165,637 - 21,166,660 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,165,636 - 21,166,659 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,155,636 - 21,156,619 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	21,155,635 - 21,156,619	NCBI
Celera	9	21,103,926 - 21,104,949 (-)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,128,787 - 21,129,810 (-)	NCBI		HuRef
CHM1_1	9	21,165,431 - 21,166,454 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,179,487 - 21,180,510 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	multisystem inflammatory syndrome in children		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Multisystem inflammatory syndrome in children	ClinVar
IFNA21	Human	schizophrenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of IFNA21 gene	CTD	PMID:27153756
IFNA21	Human	amphotericin B	increases expression	EXP		6480464	Amphotericin B analog results in increased expression of IFNA21 mRNA	CTD	PMID:28534445
IFNA21	Human	benzene-1,2,4-triol	increases expression	EXP		6480464	hydroxyhydroquinone results in increased expression of IFNA21 mRNA	CTD	PMID:39245080
IFNA21	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of IFNA21 mRNA	CTD	PMID:35301059
IFNA21	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of IFNA21 mRNA	CTD	PMID:35301059
IFNA21	Human	glyphosate	increases expression	EXP		6480464	Glyphosate results in increased expression of IFNA21 mRNA	CTD	PMID:31295307
IFNA21	Human	lead(0)	increases expression	EXP		6480464	Lead results in increased expression of IFNA21 mRNA	CTD	PMID:19921347
IFNA21	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of IFNA21 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	adaptive immune response	involved_in	IBA	MGI:107657 and PANTHER:PTN002618644	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	B cell activation involved in immune response	involved_in	IBA	PANTHER:PTN002618644 and UniProtKB:P01574	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	cellular response to virus	involved_in	NAS		150520179	PMID:30936491	ComplexPortal	PMID:30936491
IFNA21	Human	defense response	involved_in	IEA	InterPro:IPR000471	150520179		InterPro	GO_REF:0000002
IFNA21	Human	defense response to virus	involved_in	IEA	UniProtKB-KW:KW-0051	150520179		UniProt	GO_REF:0000043
IFNA21	Human	humoral immune response	involved_in	IBA	MGI:107657 and PANTHER:PTN002618644	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	natural killer cell activation involved in immune response	involved_in	IBA	MGI:107659 more ...	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	response to exogenous dsRNA	involved_in	IBA	PANTHER:PTN002618644 more ...	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	signal transduction	involved_in	IEA	GO:0005125	150520179		GOC	GO_REF:0000108
IFNA21	Human	T cell activation involved in immune response	involved_in	IBA	MGI:107668 and PANTHER:PTN002618644	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	type I interferon-mediated signaling pathway	involved_in	IBA	MGI:107657 more ...	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	type I interferon-mediated signaling pathway	involved_in	NAS		150520179	PMID:30936491	ComplexPortal	PMID:30936491

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	extracellular region	located_in	IEA	InterPro:IPR000471	150520179		InterPro	GO_REF:0000002
IFNA21	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
IFNA21	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-909718 more ...
IFNA21	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
IFNA21	Human	extracellular space	located_in	IEA	UniProtKB-KW:KW-0202	150520179		UniProt	GO_REF:0000043
IFNA21	Human	extracellular space	is_active_in	IBA	MGI:107657 more ...	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	cytokine activity	enables	IEA	UniProtKB-KW:KW-0202	150520179		UniProt	GO_REF:0000043
IFNA21	Human	cytokine activity	enables	IBA	MGI:107657 more ...	150520179		GO_Central	GO_REF:0000033
IFNA21	Human	cytokine receptor binding	enables	IEA	InterPro:IPR000471	150520179		InterPro	GO_REF:0000002
IFNA21	Human	cytokine receptor binding	enables	TAS		150520179	PMID:6163083	PINC	PMID:6163083
IFNA21	Human	protein binding	enables	IPI	UniProtKB:Q86W67 and UniProtKB:Q9Y2G3	150520179	PMID:28514442 and PMID:33961781	IntAct	PMID:28514442 and PMID:33961781
IFNA21	Human	type I interferon receptor binding	enables	IBA	MGI:107657 more ...	150520179		GO_Central	GO_REF:0000033

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	autoimmune thyroiditis pathway		IEA		6907045		KEGG	hsa:05320
IFNA21	Human	autophagy pathway		IEA		6907045		KEGG	hsa:04140
IFNA21	Human	hepatitis C pathway		IEA		6907045		KEGG	hsa:05160
IFNA21	Human	Jak-Stat signaling pathway		IEA		6907045		KEGG	hsa:04630
IFNA21	Human	measles pathway		IEA		6907045		KEGG	hsa:05162
IFNA21	Human	Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway		IEA		6907045		KEGG	hsa:04622
IFNA21	Human	Toll-like receptor signaling pathway		IEA		6907045		KEGG	hsa:04620
IFNA21	Human	tuberculosis pathway		IEA		6907045		KEGG	hsa:05152

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
IFNA21	Human	Schizophrenia		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1381203	PMID:1385305	PMID:1708818	PMID:1905933	PMID:2014240	PMID:2552026	PMID:6163083	PMID:6548765	PMID:7510216	PMID:7511078	PMID:7526537	PMID:7532202
PMID:7583919	PMID:7815507	PMID:7904170	PMID:7913356	PMID:8345204	PMID:8438572	PMID:8661419	PMID:8668211	PMID:8764000	PMID:8910771	PMID:9027905	PMID:9108403
PMID:9181467	PMID:9225992	PMID:9343822	PMID:9425112	PMID:9520456	PMID:9658081	PMID:9865497	PMID:11694501	PMID:12089333	PMID:12477932	PMID:15481145	PMID:15489334
PMID:15953390	PMID:16160188	PMID:16278001	PMID:16375755	PMID:16418394	PMID:17180012	PMID:17360657	PMID:17854033	PMID:18005734	PMID:18200009	PMID:18200012	PMID:18272764
PMID:18414664	PMID:18672082	PMID:19004943	PMID:19559726	PMID:19706714	PMID:20096141	PMID:20237496	PMID:20331378	PMID:20574843	PMID:20588308	PMID:20677014	PMID:21757613
PMID:21873635	PMID:22315404	PMID:22739040	PMID:22814248	PMID:23100517	PMID:23255800	PMID:25972534	PMID:28514442	PMID:30936491	PMID:32248921	PMID:33961781

IFNA21
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,165,637 - 21,166,660 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	21,165,637 - 21,166,660 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,165,636 - 21,166,659 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,155,636 - 21,156,619 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	21,155,635 - 21,156,619	NCBI
Celera	9	21,103,926 - 21,104,949 (-)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,128,787 - 21,129,810 (-)	NCBI		HuRef
CHM1_1	9	21,165,431 - 21,166,454 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,179,487 - 21,180,510 (-)	NCBI		T2T-CHM13v2.0

LOC100967539
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	103,380,842 - 103,403,248 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	103,386,789 - 103,408,825 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	20,971,515 - 20,975,339 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	21,629,421 - 21,630,428 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	21,629,817 - 21,630,386 (-)	Ensembl	panpan1.1		panPan2

Variants in IFNA21
22 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 9p24.3-13.1(chr9:204193-38815478)x3	copy number gain	See cases [RCV000050357]	Chr9:204193..38815478 [GRCh38] Chr9:204193..38815475 [GRCh37] Chr9:194193..38805475 [NCBI36] Chr9:9p24.3-13.1	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000050348]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:204193-38741440)x3	copy number gain	See cases [RCV000051106]	Chr9:204193..38741440 [GRCh38] Chr9:204193..38741437 [GRCh37] Chr9:194193..38731437 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p21.3(chr9:21082471-23839529)x1	copy number loss	See cases [RCV000052902]	Chr9:21082471..23839529 [GRCh38] Chr9:21082470..23839527 [GRCh37] Chr9:21072470..23829527 [NCBI36] Chr9:9p21.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:203993-38815619)x3	copy number gain	See cases [RCV000053703]	Chr9:203993..38815619 [GRCh38] Chr9:203993..38815616 [GRCh37] Chr9:193993..38805616 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-21.3(chr9:204193-22086858)x3	copy number gain	See cases [RCV000053704]	Chr9:204193..22086858 [GRCh38] Chr9:204193..22086857 [GRCh37] Chr9:194193..22076857 [NCBI36] Chr9:9p24.3-21.3	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204193-34599437)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053706]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053706]\|See cases [RCV000053706]	Chr9:204193..34599437 [GRCh38] Chr9:204193..34599435 [GRCh37] Chr9:194193..34589435 [NCBI36] Chr9:9p24.3-13.3	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204193-33284638)x3	copy number gain	See cases [RCV000053707]	Chr9:204193..33284638 [GRCh38] Chr9:204193..33284636 [GRCh37] Chr9:194193..33274636 [NCBI36] Chr9:9p24.3-13.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124532)x3	copy number gain	See cases [RCV000053745]	Chr9:193412..138124532 [GRCh38] Chr9:204193..141018984 [GRCh37] Chr9:194193..140138805 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:220253-38815419)x3	copy number gain	See cases [RCV000053747]	Chr9:220253..38815419 [GRCh38] Chr9:220253..38815416 [GRCh37] Chr9:210253..38805416 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|See cases [RCV000053748]	Chr9:193412..138179445 [GRCh38] Chr9:266045..141073897 [GRCh37] Chr9:256045..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p23-21.1(chr9:9543538-30266463)x3	copy number gain	See cases [RCV000053749]	Chr9:9543538..30266463 [GRCh38] Chr9:9543538..30266461 [GRCh37] Chr9:9533538..30256461 [NCBI36] Chr9:9p23-21.1	pathogenic
GRCh38/hg38 9p23-13.3(chr9:13526091-34261642)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053750]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053750]\|See cases [RCV000053750]	Chr9:13526091..34261642 [GRCh38] Chr9:13526090..34261640 [GRCh37] Chr9:13516090..34251640 [NCBI36] Chr9:9p23-13.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138114463)x3	copy number gain	See cases [RCV000053746]	Chr9:193412..138114463 [GRCh38] Chr9:214367..141008915 [GRCh37] Chr9:204367..140128736 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
NM_002175.2(IFNA21):c.454C>T (p.Leu152Phe)	single nucleotide variant	Malignant melanoma [RCV000061919]	Chr9:21166159 [GRCh38] Chr9:21166158 [GRCh37] Chr9:21156158 [NCBI36] Chr9:9p21.3	not provided
GRCh38/hg38 9p24.3-q34.3(chr9:204193-138179445)	copy number gain	See cases [RCV000133791]	Chr9:204193..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-21.1(chr9:220257-29424848)x3	copy number gain	See cases [RCV000134037]	Chr9:220257..29424848 [GRCh38] Chr9:220257..29424846 [GRCh37] Chr9:210257..29414846 [NCBI36] Chr9:9p24.3-21.1	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:13997-68401065)x3	copy number gain	See cases [RCV000135344]	Chr9:13997..68401065 [GRCh38] Chr9:13997..71015981 [GRCh37] Chr9:3997..70205801 [NCBI36] Chr9:9p24.3-q21.11	pathogenic
GRCh38/hg38 9p24.3-q21.12(chr9:193412-70630731)x3	copy number gain	See cases [RCV000136152]	Chr9:193412..70630731 [GRCh38] Chr9:220253..73245647 [GRCh37] Chr9:210253..72435467 [NCBI36] Chr9:9p24.3-q21.12	pathogenic
GRCh38/hg38 9p24.3-q21.13(chr9:193412-74615913)x3	copy number gain	See cases [RCV000135954]	Chr9:193412..74615913 [GRCh38] Chr9:204193..77230829 [GRCh37] Chr9:194193..76420649 [NCBI36] Chr9:9p24.3-q21.13	pathogenic
GRCh38/hg38 9p24.1-21.2(chr9:4661872-27661572)x3	copy number gain	See cases [RCV000136680]	Chr9:4661872..27661572 [GRCh38] Chr9:4661872..27661570 [GRCh37] Chr9:4651872..27651570 [NCBI36] Chr9:9p24.1-21.2	pathogenic
GRCh38/hg38 9p21.3(chr9:20687770-21309178)x1	copy number loss	See cases [RCV000137295]	Chr9:20687770..21309178 [GRCh38] Chr9:20687769..21309177 [GRCh37] Chr9:20677769..21299177 [NCBI36] Chr9:9p21.3	uncertain significance
GRCh38/hg38 9p24.1-13.2(chr9:7162304-37038771)x3	copy number gain	See cases [RCV000137741]	Chr9:7162304..37038771 [GRCh38] Chr9:7162304..37038768 [GRCh37] Chr9:7152304..37028768 [NCBI36] Chr9:9p24.1-13.2	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:204104-66233120)x4	copy number gain	See cases [RCV000137888]	Chr9:204104..66233120 [GRCh38] Chr9:204104..47212321 [GRCh37] Chr9:194104..47002141 [NCBI36] Chr9:9p24.3-q21.11	pathogenic\|conflicting data from submitters
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124524)x3	copy number gain	See cases [RCV000138783]	Chr9:193412..138124524 [GRCh38] Chr9:204090..141018976 [GRCh37] Chr9:194090..140138797 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-21.3(chr9:459131-24207894)x3	copy number gain	See cases [RCV000138499]	Chr9:459131..24207894 [GRCh38] Chr9:459131..24207892 [GRCh37] Chr9:449131..24197892 [NCBI36] Chr9:9p24.3-21.3	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:204104-67549861)x3	copy number gain	See cases [RCV000139208]	Chr9:204104..67549861 [GRCh38] Chr9:204104..66516698 [GRCh37] Chr9:194104..66256518 [NCBI36] Chr9:9p24.3-q21.11	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204104-34151476)x3	copy number gain	See cases [RCV000139015]	Chr9:204104..34151476 [GRCh38] Chr9:204104..34151474 [GRCh37] Chr9:194104..34141474 [NCBI36] Chr9:9p24.3-13.3	pathogenic\|likely benign
GRCh38/hg38 9p24.3-13.1(chr9:204104-38768294)x3	copy number gain	See cases [RCV000139126]	Chr9:204104..38768294 [GRCh38] Chr9:204104..38768291 [GRCh37] Chr9:194104..38758291 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000138962]	Chr9:193412..138159073 [GRCh38] Chr9:204104..141053525 [GRCh37] Chr9:194104..140173346 [NCBI36] Chr9:9p24.3-q34.3	pathogenic\|conflicting data from submitters
GRCh38/hg38 9p22.2-q21.11(chr9:18344605-68257015)	copy number gain	See cases [RCV000140448]	Chr9:18344605..68257015 [GRCh38] Chr9:18344603..68995221 [GRCh37] Chr9:18334603..68285041 [NCBI36] Chr9:9p22.2-q21.11	pathogenic
GRCh38/hg38 9p22.1-21.1(chr9:19564275-28106622)x1	copy number loss	See cases [RCV000139905]	Chr9:19564275..28106622 [GRCh38] Chr9:19564273..28106620 [GRCh37] Chr9:19554273..28096620 [NCBI36] Chr9:9p22.1-21.1	pathogenic
GRCh38/hg38 9p24.3-21.2(chr9:204104-27963369)x3	copy number gain	See cases [RCV000139621]	Chr9:204104..27963369 [GRCh38] Chr9:204104..27963367 [GRCh37] Chr9:194104..27953367 [NCBI36] Chr9:9p24.3-21.2	pathogenic
GRCh38/hg38 9p21.3(chr9:21150820-21517343)x3	copy number gain	See cases [RCV000140758]	Chr9:21150820..21517343 [GRCh38] Chr9:21150819..21517342 [GRCh37] Chr9:21140819..21507342 [NCBI36] Chr9:9p21.3	likely benign
GRCh38/hg38 9p24.3-q22.1(chr9:203861-88130444)x4	copy number gain	See cases [RCV000141904]	Chr9:203861..88130444 [GRCh38] Chr9:203861..90745359 [GRCh37] Chr9:193861..89935179 [NCBI36] Chr9:9p24.3-q22.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:203861-138125937)x3	copy number gain	See cases [RCV000141876]	Chr9:203861..138125937 [GRCh38] Chr9:203861..141020389 [GRCh37] Chr9:193861..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-21.1(chr9:203861-31423873)x4	copy number gain	See cases [RCV000141662]	Chr9:203861..31423873 [GRCh38] Chr9:203861..31423871 [GRCh37] Chr9:193861..31413871 [NCBI36] Chr9:9p24.3-21.1	pathogenic
GRCh38/hg38 9p24.3-q21.31(chr9:193412-79877816)x3	copy number gain	See cases [RCV000143012]	Chr9:193412..79877816 [GRCh38] Chr9:204104..82492731 [GRCh37] Chr9:194104..81682551 [NCBI36] Chr9:9p24.3-q21.31	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:203861-38381642)	copy number gain	See cases [RCV000143411]	Chr9:203861..38381642 [GRCh38] Chr9:203861..38381639 [GRCh37] Chr9:193861..38371639 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:203862-138125937)x3	copy number gain	See cases [RCV000143476]	Chr9:203862..138125937 [GRCh38] Chr9:203862..141020389 [GRCh37] Chr9:193862..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:204193-38815478)x3	copy number gain	See cases [RCV000148159]	Chr9:204193..38815478 [GRCh38] Chr9:204193..38815475 [GRCh37] Chr9:194193..38805475 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000148113]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p11.2-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000139207]	Chr9:193412..138159073 [GRCh38] Chr9:68420641..141053525 [GRCh37] Chr9:67910461..140173346 [NCBI36] Chr9:9p11.2-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:163131-38763958)x3	copy number gain	See cases [RCV000240201]	Chr9:163131..38763958 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-11.2(chr9:213161-47212321)x4	copy number gain	See cases [RCV000240048]	Chr9:213161..47212321 [GRCh37] Chr9:9p24.3-11.2	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:163131-141122114)x3	copy number gain	See cases [RCV000240081]	Chr9:163131..141122114 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:213161-39092820)x3	copy number gain	See cases [RCV000239869]	Chr9:213161..39092820 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-68188391)x4	copy number gain	See cases [RCV000449165]	Chr9:203861..68188391 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:62525-141006407)	copy number gain	See cases [RCV000449375]	Chr9:62525..141006407 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020389)x3	copy number gain	not specified [RCV003986800]	Chr9:203861..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:32396-39140211)	copy number gain	See cases [RCV000447246]	Chr9:32396..39140211 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67983174)x4	copy number gain	See cases [RCV000446521]	Chr9:203861..67983174 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:13997-70919878)x4	copy number gain	See cases [RCV000448242]	Chr9:13997..70919878 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p21.3(chr9:20951885-22447709)x1	copy number loss	See cases [RCV000448195]	Chr9:20951885..22447709 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-69002883)x3	copy number gain	See cases [RCV000448569]	Chr9:203861..69002883 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203864-141020389)x3	copy number gain	See cases [RCV000448978]	Chr9:203864..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p22.2-21.1(chr9:17684434-30889762)x3	copy number gain	See cases [RCV000510665]	Chr9:17684434..30889762 [GRCh37] Chr9:9p22.2-21.1	pathogenic
GRCh37/hg19 9p24.1-21.1(chr9:5900425-30008330)x3	copy number gain	See cases [RCV000510425]	Chr9:5900425..30008330 [GRCh37] Chr9:9p24.1-21.1	pathogenic
GRCh37/hg19 9p21.3(chr9:20684175-21312153)x1	copy number loss	See cases [RCV000511958]	Chr9:20684175..21312153 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)x3	copy number gain	See cases [RCV000510864]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p22.2-13.3(chr9:17132123-35567051)x3	copy number gain	See cases [RCV000510986]	Chr9:17132123..35567051 [GRCh37] Chr9:9p22.2-13.3	pathogenic
GRCh37/hg19 9p24.3-11.2(chr9:204193-44259464)x4	copy number gain	Syndromic hydrocephalus due to diffuse villous hyperplasia of choroid plexus [RCV000677299]	Chr9:204193..44259464 [GRCh37] Chr9:9p24.3-11.2	likely pathogenic
GRCh37/hg19 9p23-21.2(chr9:10320113-26205565)x1	copy number loss	Poly (ADP-Ribose) polymerase inhibitor response [RCV000626433]	Chr9:10320113..26205565 [GRCh37] Chr9:9p23-21.2	drug response
GRCh37/hg19 9p24.3-q21.33(chr9:203861-88189913)x3	copy number gain	See cases [RCV000512431]	Chr9:203861..88189913 [GRCh37] Chr9:9p24.3-q21.33	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203862-141020389)	copy number gain	See cases [RCV000512392]	Chr9:203862..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-21.2(chr9:203861-26397133)x3	copy number gain	not provided [RCV000683171]	Chr9:203861..26397133 [GRCh37] Chr9:9p24.3-21.2	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67983174)x4	copy number gain	not provided [RCV000683173]	Chr9:203861..67983174 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-68262804)x3,4	copy number gain	not provided [RCV000683174]	Chr9:203861..68262804 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q21.12(chr9:203861-72717793)x3	copy number gain	not provided [RCV000683176]	Chr9:203861..72717793 [GRCh37] Chr9:9p24.3-q21.12	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)x3	copy number gain	not provided [RCV000683172]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-70985795)x4	copy number gain	not provided [RCV000683175]	Chr9:203861..70985795 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
Single allele	duplication	Schizophrenia [RCV000754362]	Chr9:20655425..24580688 [GRCh38] Chr9:9p21.3	likely pathogenic
GRCh37/hg19 9p21.3(chr9:20834837-22101120)x1	copy number loss	not provided [RCV000748288]	Chr9:20834837..22101120 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141122247)x3	copy number gain	not provided [RCV000748055]	Chr9:10590..141122247 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141107672)x3	copy number gain	not provided [RCV000748053]	Chr9:10590..141107672 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-21.3(chr9:46587-22012051)x3	copy number gain	not provided [RCV000748062]	Chr9:46587..22012051 [GRCh37] Chr9:9p24.3-21.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:46587-141066491)x3	copy number gain	not provided [RCV000748063]	Chr9:46587..141066491 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141114095)x2	copy number gain	not provided [RCV000748054]	Chr9:10590..141114095 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.2-21.3(chr9:4420767-22195820)x3	copy number gain	not provided [RCV000748122]	Chr9:4420767..22195820 [GRCh37] Chr9:9p24.2-21.3	pathogenic
GRCh37/hg19 9p21.3(chr9:20715401-22136489)	copy number loss	not provided [RCV000767562]	Chr9:20715401..22136489 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:214309-39156958)	copy number gain	not provided [RCV000767644]	Chr9:214309..39156958 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020388)x3	copy number gain	not provided [RCV000845900]	Chr9:203861..141020388 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67986965)x3	copy number gain	not provided [RCV000845815]	Chr9:203861..67986965 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p21.3(chr9:20684175-21308693)x1	copy number loss	not provided [RCV000847176]	Chr9:20684175..21308693 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-13.1(chr9:203861-38472979)x3	copy number gain	not provided [RCV000848175]	Chr9:203861..38472979 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p21.3(chr9:20659492-22347440)x3	copy number gain	not provided [RCV002473498]	Chr9:20659492..22347440 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p21.3(chr9:20829681-22069144)x3	copy number gain	not provided [RCV001006222]	Chr9:20829681..22069144 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-q21.11(chr9:203861-70984588)x3	copy number gain	not provided [RCV001006167]	Chr9:203861..70984588 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
NM_002175.2(IFNA21):c.376G>T (p.Glu126Ter)	single nucleotide variant	Multisystem inflammatory syndrome in children [RCV001779420]	Chr9:21166237 [GRCh38] Chr9:21166236 [GRCh37] Chr9:9p21.3	risk factor
GRCh37/hg19 9p24.3-q21.32(chr9:203861-84155399)	copy number gain	not specified [RCV002053820]	Chr9:203861..84155399 [GRCh37] Chr9:9p24.3-q21.32	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-69002883)	copy number gain	not specified [RCV002053819]	Chr9:203861..69002883 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p24.3-13.3(chr9:676264-33743670)	copy number gain	not specified [RCV002053827]	Chr9:676264..33743670 [GRCh37] Chr9:9p24.3-13.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:353349-141020389)	copy number gain	not specified [RCV002053823]	Chr9:353349..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p22.1-q33.1(chr9:19356861-119513311)	copy number loss	Distal tetrasomy 15q [RCV002280776]	Chr9:19356861..119513311 [GRCh37] Chr9:9p22.1-q33.1	uncertain significance
GRCh37/hg19 9p24.3-q34.11(chr9:203861-131603223)x3	copy number gain	See cases [RCV002292402]	Chr9:203861..131603223 [GRCh37] Chr9:9p24.3-q34.11	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67986965)	copy number gain	Tetrasomy 9p [RCV002280656]	Chr9:203861..67986965 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-13.3(chr9:203861-35903398)x3	copy number gain	MISSED ABORTION [RCV002282974]	Chr9:203861..35903398 [GRCh37] Chr9:9p24.3-13.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:48827-39154913)x3	copy number gain	Syndromic anorectal malformation [RCV002286608]	Chr9:48827..39154913 [GRCh37] Chr9:9p24.3-13.1	likely pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-68342786)	copy number gain	Bradycardia [RCV002280662]	Chr9:203861..68342786 [GRCh37] Chr9:9p24.3-q13	pathogenic
NM_002175.2(IFNA21):c.493G>A (p.Glu165Lys)	single nucleotide variant	not specified [RCV004213118]	Chr9:21166120 [GRCh38] Chr9:21166119 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.394A>T (p.Thr132Ser)	single nucleotide variant	not specified [RCV004164338]	Chr9:21166219 [GRCh38] Chr9:21166218 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.470A>C (p.Lys157Thr)	single nucleotide variant	not specified [RCV004191796]	Chr9:21166143 [GRCh38] Chr9:21166142 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.397C>T (p.Pro133Ser)	single nucleotide variant	not specified [RCV004153915]	Chr9:21166216 [GRCh38] Chr9:21166215 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.497T>C (p.Val166Ala)	single nucleotide variant	not specified [RCV004184121]	Chr9:21166116 [GRCh38] Chr9:21166115 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.323T>C (p.Phe108Ser)	single nucleotide variant	not specified [RCV004101477]	Chr9:21166290 [GRCh38] Chr9:21166289 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.169C>G (p.His57Asp)	single nucleotide variant	not specified [RCV004071194]	Chr9:21166444 [GRCh38] Chr9:21166443 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.410T>A (p.Val137Glu)	single nucleotide variant	not specified [RCV004127665]	Chr9:21166203 [GRCh38] Chr9:21166202 [GRCh37] Chr9:9p21.3	likely benign
NM_002175.2(IFNA21):c.444A>C (p.Gln148His)	single nucleotide variant	not specified [RCV004158282]	Chr9:21166169 [GRCh38] Chr9:21166168 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.560G>T (p.Arg187Met)	single nucleotide variant	not specified [RCV004287363]	Chr9:21166053 [GRCh38] Chr9:21166052 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.197T>C (p.Phe66Ser)	single nucleotide variant	not specified [RCV004284680]	Chr9:21166416 [GRCh38] Chr9:21166415 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.64C>A (p.Leu22Met)	single nucleotide variant	not specified [RCV004265865]	Chr9:21166549 [GRCh38] Chr9:21166548 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.168A>T (p.Arg56Ser)	single nucleotide variant	not specified [RCV004280073]	Chr9:21166445 [GRCh38] Chr9:21166444 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p21.3(chr9:20663642-21312153)x4	copy number gain	not provided [RCV003485354]	Chr9:20663642..21312153 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-13.1(chr9:1475882-38771831)x3	copy number gain	not provided [RCV003484765]	Chr9:1475882..38771831 [GRCh37] Chr9:9p24.3-13.1	pathogenic
NM_002175.2(IFNA21):c.146C>A (p.Pro49His)	single nucleotide variant	not specified [RCV004400151]	Chr9:21166467 [GRCh38] Chr9:21166466 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.464C>A (p.Thr155Lys)	single nucleotide variant	not specified [RCV004400154]	Chr9:21166149 [GRCh38] Chr9:21166148 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.521C>A (p.Ser174Tyr)	single nucleotide variant	not specified [RCV004400155]	Chr9:21166092 [GRCh38] Chr9:21166091 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.545A>C (p.Gln182Pro)	single nucleotide variant	not specified [RCV004400156]	Chr9:21166068 [GRCh38] Chr9:21166067 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.220G>A (p.Ala74Thr)	single nucleotide variant	not specified [RCV004400152]	Chr9:21166393 [GRCh38] Chr9:21166392 [GRCh37] Chr9:9p21.3	uncertain significance
NM_002175.2(IFNA21):c.62C>A (p.Ser21Tyr)	single nucleotide variant	not specified [RCV004926347]	Chr9:21166551 [GRCh38] Chr9:21166550 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p21.3(chr9:21041507-21285666)x1	copy number loss	not provided [RCV001006224]	Chr9:21041507..21285666 [GRCh37] Chr9:9p21.3	uncertain significance
NC_000009.11:g.12246100_101559378inv	inversion	Recurrent spontaneous abortion [RCV000999471]	Chr9:12246100..101559378 [GRCh37] Chr9:9p23-q22.33	likely pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)	copy number gain	not specified [RCV002053818]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
NM_002175.2(IFNA21):c.110C>T (p.Ala37Val)	single nucleotide variant	not specified [RCV004926346]	Chr9:21166503 [GRCh38] Chr9:21166502 [GRCh37] Chr9:9p21.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	144
Count of miRNA genes:	129
Interacting mature miRNAs:	130
Transcripts:	ENST00000380225
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1643245	BW137_H	Body weight QTL 137 (human)	2.28		Body weight		9	5289149	31289149	Human
2302773	MAMTS18_H	Mammary tumor susceptibility QTL 18 (human)		0.039	Mammary tumor susceptibility		9	5289149	31289149	Human
1357299	AASTH47_H	Allergic/atopic asthma related QTL 47 (human)		0.00028	Reversible airflow obstruction		9	5289149	31289149	Human
2315898	GLUCO191_H	Glucose level QTL 191 (human)	1.83		Glucose level		9	5289149	31289149	Human
2293400	PRSTS224_H	Prostate tumor susceptibility QTL 224 (human)	1.62		Prostate tumor susceptibility		9	5289149	31289149	Human
2293433	PRSTS223_H	Prostate tumor susceptibility QTL 223 (human)	1.6		Prostate tumor susceptibility		9	5289149	31289149	Human

IFNA21_1257

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	21,165,835 - 21,166,567	UniSTS	GRCh37
Build 36	9	21,155,835 - 21,156,567	RGD	NCBI36
Celera	9	21,104,125 - 21,104,857	RGD
HuRef	9	21,128,986 - 21,129,718	UniSTS

SHGC-35276

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	9	p22	UniSTS
GeneMap99-GB4 RH Map	9	62.78	UniSTS
Whitehead-RH Map	9	62.0	UniSTS
NCBI RH Map	9	225.3	UniSTS
GeneMap99-G3 RH Map	9	733.0	UniSTS

UniSTS:481597

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	21,165,929 - 21,166,619	UniSTS	GRCh37
Celera	9	21,104,219 - 21,104,909	UniSTS
HuRef	9	21,129,080 - 21,129,770	UniSTS

UniSTS:485812

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	21,165,974 - 21,166,618	UniSTS	GRCh37
Celera	9	21,104,264 - 21,104,908	UniSTS
HuRef	9	21,129,125 - 21,129,769	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system
255	975	643	628	2689	593	675	79	456	32	360	1777	1721	2554	205	645	575	49


RefSeq Transcripts	NG_030029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_002175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL390882	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC096699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M12350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M28586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V00540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X00145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000380225 ⟹ ENSP00000369574

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	9	21,165,637 - 21,166,660 (-)	Ensembl

RefSeq Acc Id:

NM_002175 ⟹ NP_002166

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	9	21,165,637 - 21,166,660 (-)	NCBI
GRCh37	9	21,165,636 - 21,166,659 (-)	RGD
Build 36	9	21,155,636 - 21,156,619 (-)	NCBI Archive
Celera	9	21,103,926 - 21,104,949 (-)	RGD
HuRef	9	21,128,787 - 21,129,810 (-)	ENTREZGENE
CHM1_1	9	21,165,431 - 21,166,454 (-)	NCBI
T2T-CHM13v2.0	9	21,179,487 - 21,180,510 (-)	NCBI

Sequence:

show sequence

TTCAAGGTTACCCATCTCAAGTAGCCTAGCAATATTGGCAACATCCCAATGGCCCTGTCCTTTTCTTTACTGATGGCCGTGCTGGTGCTCAGCTACAAATCCATCTGTTCTCTGGGCTGTGATCTGCC
TCAGACCCACAGCCTGGGTAATAGGAGGGCCTTGATACTCCTGGCACAAATGGGAAGAATCTCTCCTTTCTCCTGCCTGAAGGACAGACATGACTTTGGATTCCCCCAGGAGGAGTTTGATGGCAACC
AGTTCCAGAAGGCTCAAGCCATCTCTGTCCTCCATGAGATGATCCAGCAGACCTTCAATCTCTTCAGCACAAAGGACTCATCTGCTACTTGGGAACAGAGCCTCCTAGAAAAATTTTCCACTGAACTT
AACCAGCAGCTGAATGACCTGGAAGCCTGCGTGATACAGGAGGTTGGGGTGGAAGAGACTCCCCTGATGAATGTGGACTCCATCCTGGCTGTGAAGAAATACTTCCAAAGAATCACTCTTTATCTGAC
AGAGAAGAAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATCCTTCTCTTTATCAAAAATTTTTCAAGAAAGATTAAGGAGGAAGGAATGAAACCTGTTTCAACATGGAAATG
ATCTGTATTGACTAATACACCAGTCCACACTTCTATGACTTCTGCCATTTCAAAGACTCATTTCTCCTATAACCACCGCATGAGTTGAATCAAAATTTTCAGATCTTTTCAGGAGTGTAAGGAAACAT
CATGTTTACCTGTGCAGGCACTAGTCCTTTACAGATGACCATGCTGATAGATCTAATTATCTATCTATTGAAATATTTATTTATTTATTAGATTTAAATTATTTTTGTCCATGTAATATTATGTGTAC
TTTTACATTGTGTTATATCAAAATATGTTATTTATATTTAGTCAATATATTATTTTCTTTTTATTAATTTTTACTATTAAAACTTCTTATATTATTTGTTTATTCTTTAATAAAGAAATACCAAGCCC

hide sequence


Protein RefSeqs	NP_002166	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA36041	(Get FASTA)	NCBI Sequence Viewer
	AAA52718	(Get FASTA)	NCBI Sequence Viewer
	AAH69329	(Get FASTA)	NCBI Sequence Viewer
	AAH69372	(Get FASTA)	NCBI Sequence Viewer
	AAH69408	(Get FASTA)	NCBI Sequence Viewer
	AAH96699	(Get FASTA)	NCBI Sequence Viewer
	AAI01639	(Get FASTA)	NCBI Sequence Viewer
	AAI01641	(Get FASTA)	NCBI Sequence Viewer
	CAA23801	(Get FASTA)	NCBI Sequence Viewer
	CAA24980	(Get FASTA)	NCBI Sequence Viewer
	EAW58623	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000369574
	ENSP00000369574.1
GenBank Protein	P01568	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_002166 ⟸ NM_002175
- Peptide Label:	precursor
- UniProtKB:	Q5VWD1 (UniProtKB/Swiss-Prot), Q14608 (UniProtKB/Swiss-Prot), P01568 (UniProtKB/Swiss-Prot), A0A7R8GUQ6 (UniProtKB/TrEMBL), A0A7R8GUS8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVG VEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE hide sequence

Ensembl Acc Id:

ENSP00000369574 ⟸ ENST00000380225

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P01568-F1-model_v2	AlphaFold	P01568	1-189	view protein structure

Database	Acc Id	Source(s)
COSMIC	IFNA21	COSMIC
Ensembl Genes	ENSG00000137080	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000380225	ENTREZGENE
	ENST00000380225.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000137080	GTEx
HGNC ID	HGNC:5424	ENTREZGENE
Human Proteome Map	IFNA21	Human Proteome Map
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot
	Interferon_alpha/beta/delta	UniProtKB/Swiss-Prot
KEGG Report	hsa:3452	UniProtKB/Swiss-Prot
NCBI Gene	3452	ENTREZGENE
OMIM	147584	OMIM
PANTHER	INTERFERON ALPHA-21	UniProtKB/Swiss-Prot
	PTHR11691	UniProtKB/Swiss-Prot
Pfam	Interferon	UniProtKB/Swiss-Prot
PharmGKB	PA29663	PharmGKB
PRINTS	INTERFERONAB	UniProtKB/Swiss-Prot
PROSITE	INTERFERON_A_B_D	UniProtKB/Swiss-Prot
SMART	IFabd	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot
UniProt	A0A7R8GUQ6	ENTREZGENE, UniProtKB/TrEMBL
	A0A7R8GUS8	ENTREZGENE, UniProtKB/TrEMBL
	IFN21_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q14608	ENTREZGENE
	Q5VWD1	ENTREZGENE
UniProt Secondary	Q14608	UniProtKB/Swiss-Prot
	Q5VWD1	UniProtKB/Swiss-Prot
	Q7M4Q4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-21	IFNA21	interferon alpha 21	IFNA21	interferon, alpha 21	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar