Cnksr1 (connector enhancer of kinase suppressor of Ras 1) - Rat Genome Database

Cnksr1 (connector enhancer of kinase suppressor of Ras 1) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Cnksr1 (connector enhancer of kinase suppressor of Ras 1) Rattus norvegicus

Subscribe to Updates

Symbol:

Cnksr1

Name:

connector enhancer of kinase suppressor of Ras 1

RGD ID:

1311879

Description:

Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in synapse organization. Predicted to be located in cell cortex. Orthologous to human CNKSR1 (connector enhancer of kinase suppressor of Ras 1); PARTICIPATES IN angiotensin II signaling pathway via AT2 receptor; interleukin-3 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

Previously known as:

LOC298545; MGC124829

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,731,222 - 151,742,049 (-)	NCBI		GRCr8
mRatBN7.2	5	146,447,495 - 146,458,332 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,447,497 - 146,458,212 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	149,149,245 - 149,159,880 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,919,634 - 150,930,291 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,905,459 - 150,916,094 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,447,348 - 152,458,005 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,446,845 - 152,458,023 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	156,206,363 - 156,217,020 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,972,551 - 152,983,208 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,982,589 - 152,993,370 (-)	NCBI
Celera	5	144,865,185 - 144,875,842 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	autosomal recessive hypercholesterolemia		ISO	RGD:1323565	8554872	ClinVar Annotator: match by term: Hypercholesterolemia, familial, 4	ClinVar	PMID:11326085\|PMID:12464675\|PMID:28492532
Cnksr1	Rat	Neurodevelopmental Disorders		ISO	RGD:1323565	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Cnksr1	Rat	retinitis pigmentosa 59		ISO	RGD:1323565	8554872	ClinVar Annotator: match by term: Retinitis pigmentosa 59	ClinVar	PMID:28492532
Cnksr1	Rat	Usher syndrome type 2C		ISO	RGD:1323565	8554872	ClinVar Annotator: match by term: Usher syndrome type 2C	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	intellectual disability		ISO	RGD:1323565	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21937992

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1323565	6480464	Estradiol results in decreased expression of CNKSR1 mRNA	CTD	PMID:31614463
Cnksr1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1323566	6480464	Tetrachlorodibenzodioxin results in decreased expression of CNKSR1 mRNA	CTD	PMID:21354282
Cnksr1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1323566	6480464	Tetrachlorodibenzodioxin affects the expression of CNKSR1 mRNA	CTD	PMID:26377647
Cnksr1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CNKSR1 mRNA	CTD	PMID:22298810
Cnksr1	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of CNKSR1 mRNA	CTD	PMID:28522335
Cnksr1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1323566	6480464	bisphenol S results in increased expression of CNKSR1 mRNA	CTD	PMID:30951980
Cnksr1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CNKSR1 mRNA	CTD	PMID:24780913\|PMID:30047161
Cnksr1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of CNKSR1 mRNA	CTD	PMID:31881176
Cnksr1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of CNKSR1 mRNA	CTD	PMID:23630614
Cnksr1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:1323566	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNKSR1 mRNA	CTD	PMID:36189433
Cnksr1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of CNKSR1 mRNA	CTD	PMID:30047161
Cnksr1	Rat	aristolochic acid A	increases expression	ISO	RGD:1323565	6480464	aristolochic acid I results in increased expression of CNKSR1 mRNA	CTD	PMID:33212167
Cnksr1	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of CNKSR1 mRNA	CTD	PMID:21839799
Cnksr1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1323565	6480464	Benzo(a)pyrene results in decreased methylation of CNKSR1 promoter	CTD	PMID:27901495
Cnksr1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CNKSR1 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Cnksr1	Rat	bisphenol A	increases expression	ISO	RGD:1323566	6480464	bisphenol A results in increased expression of CNKSR1 mRNA	CTD	PMID:32156529
Cnksr1	Rat	bisphenol F	decreases expression	ISO	RGD:1323566	6480464	bisphenol F results in decreased expression of CNKSR1 mRNA	CTD	PMID:38685157
Cnksr1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1323565	6480464	Cadmium Chloride results in decreased expression of CNKSR1 mRNA	CTD	PMID:38568856
Cnksr1	Rat	caffeine	increases phosphorylation	ISO	RGD:1323565	6480464	Caffeine results in increased phosphorylation of CNKSR1 protein	CTD	PMID:35688186
Cnksr1	Rat	calcitriol	increases expression	ISO	RGD:1323565	6480464	Calcitriol results in increased expression of CNKSR1 mRNA	CTD	PMID:26485663
Cnksr1	Rat	cisplatin	decreases expression	ISO	RGD:1323565	6480464	Cisplatin results in decreased expression of CNKSR1 mRNA	CTD	PMID:27392435
Cnksr1	Rat	cisplatin	multiple interactions	ISO	RGD:1323565	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of CNKSR1 mRNA	CTD	PMID:27392435
Cnksr1	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of CNKSR1 mRNA	CTD	PMID:24386269
Cnksr1	Rat	crocidolite asbestos	affects expression	ISO	RGD:1323565	6480464	Asbestos, Crocidolite affects the expression of CNKSR1 mRNA	CTD	PMID:17331233
Cnksr1	Rat	cyclosporin A	increases expression	ISO	RGD:1323565	6480464	Cyclosporine results in increased expression of CNKSR1 mRNA	CTD	PMID:20106945
Cnksr1	Rat	dexamethasone	increases expression	EXP		6480464	Dexamethasone results in increased expression of CNKSR1 mRNA	CTD	PMID:20032058
Cnksr1	Rat	dexamethasone	multiple interactions	EXP		6480464	Testosterone inhibits the reaction [Dexamethasone results in increased expression of CNKSR1 mRNA]	CTD	PMID:20032058
Cnksr1	Rat	dicrotophos	increases expression	ISO	RGD:1323565	6480464	dicrotophos results in increased expression of CNKSR1 mRNA	CTD	PMID:28302478
Cnksr1	Rat	dioxygen	multiple interactions	ISO	RGD:1323566	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CNKSR1 mRNA	CTD	PMID:30529165
Cnksr1	Rat	doxorubicin	increases expression	ISO	RGD:1323566	6480464	Doxorubicin results in increased expression of CNKSR1 mRNA	CTD	PMID:36227756
Cnksr1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of CNKSR1 mRNA	CTD	PMID:29391264
Cnksr1	Rat	folic acid	increases expression	ISO	RGD:1323566	6480464	Folic Acid results in increased expression of CNKSR1 mRNA	CTD	PMID:25629700
Cnksr1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of CNKSR1 mRNA	CTD	PMID:25539665
Cnksr1	Rat	isoprenaline	increases expression	ISO	RGD:1323566	6480464	Isoproterenol results in increased expression of CNKSR1 mRNA	CTD	PMID:20003209
Cnksr1	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of CNKSR1 mRNA	CTD	PMID:28801915
Cnksr1	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of CNKSR1 mRNA	CTD	PMID:30047161
Cnksr1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1323566	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of CNKSR1 mRNA	CTD	PMID:36189433
Cnksr1	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of CNKSR1 mRNA	CTD	PMID:28801915
Cnksr1	Rat	pirinixic acid	multiple interactions	ISO	RGD:1323566	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Cnksr1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of CNKSR1 mRNA	CTD	PMID:28374803
Cnksr1	Rat	sodium arsenite	increases expression	ISO	RGD:1323565	6480464	sodium arsenite results in increased expression of CNKSR1 mRNA	CTD	PMID:38568856
Cnksr1	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of CNKSR1 mRNA	CTD	PMID:30047161
Cnksr1	Rat	testosterone	increases expression	ISO	RGD:1323566	6480464	Testosterone results in increased expression of CNKSR1 mRNA	CTD	PMID:20403060
Cnksr1	Rat	testosterone	decreases expression	ISO	RGD:1323565	6480464	Testosterone results in decreased expression of CNKSR1 mRNA	CTD	PMID:33359661
Cnksr1	Rat	testosterone	multiple interactions	EXP		6480464	Testosterone inhibits the reaction [Dexamethasone results in increased expression of CNKSR1 mRNA]	CTD	PMID:20032058
Cnksr1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of CNKSR1 mRNA	CTD	PMID:23411599\|PMID:34492290
Cnksr1	Rat	triptonide	increases expression	ISO	RGD:1323566	6480464	triptonide results in increased expression of CNKSR1 mRNA	CTD	PMID:33045310
Cnksr1	Rat	urethane	increases expression	ISO	RGD:1323565	6480464	Urethane results in increased expression of CNKSR1 mRNA	CTD	PMID:28818685
Cnksr1	Rat	valproic acid	affects expression	ISO	RGD:1323565	6480464	Valproic Acid affects the expression of CNKSR1 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	biological_process		ND		1598407	11/2013: no relevant rat data	RGD
Cnksr1	Rat	synapse organization	involved_in	IEA	ARBA:ARBA00029184	1600115	GO_REF:0000117	UniProt	GO_REF:0000117

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	cell cortex	located_in	ISO	RGD:1323565	1624291	PMID:15075335	RGD	PMID:15075335
Cnksr1	Rat	cell cortex	located_in	IEA	UniProtKB:Q969H4\|ensembl:ENSP00000354609	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	protein binding	enables	ISO	RGD:1323565	1624291	UniProtKB:O43739\|UniProtKB:O43739-2\|UniProtKB:Q13526\|UniProtKB:Q15438\|UniProtKB:Q8N5A5-2\|UniProtKB:Q8WWE8\|UniProtKB:Q99418\|UniProtKB:Q9UIA0\|UniProtKB:Q9Y4C2-2 PMID:16189514, PMID:25416956, PMID:28514442, PMID:31515488, PMID:32296183, PMID:33961781	RGD	PMID:16189514\|PMID:25416956\|PMID:28514442\|PMID:31515488\|PMID:32296183\|PMID:33961781
Cnksr1	Rat	protein-macromolecule adaptor activity	enables	ISO	RGD:1323565	1624291	PMID:14749388	RGD	PMID:14749388
Cnksr1	Rat	protein-macromolecule adaptor activity	enables	IEA	UniProtKB:Q969H4\|ensembl:ENSP00000354609	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	angiotensin II signaling pathway via AT2 receptor		ISO	RGD:1323565	5133679		RGD

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cnksr1	Rat	interleukin-3 signaling pathway		ISO	RGD:1323565	6484113		PID	PID:200145

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
2.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	An ATIPical family of angiotensin II AT2 receptor-interacting proteins.	Rodrigues-Ferreira S and Nahmias C, Trends Endocrinol Metab. 2010 Nov;21(11):684-90.

PMID:12477932	PMID:14749388	PMID:15075335

Cnksr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,731,222 - 151,742,049 (-)	NCBI		GRCr8
mRatBN7.2	5	146,447,495 - 146,458,332 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	146,447,497 - 146,458,212 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	149,149,245 - 149,159,880 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,919,634 - 150,930,291 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,905,459 - 150,916,094 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	152,447,348 - 152,458,005 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	152,446,845 - 152,458,023 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	156,206,363 - 156,217,020 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,972,551 - 152,983,208 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,982,589 - 152,993,370 (-)	NCBI
Celera	5	144,865,185 - 144,875,842 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

CNKSR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	26,177,491 - 26,189,884 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	26,177,484 - 26,189,884 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	26,503,982 - 26,516,375 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	26,376,590 - 26,388,962 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	26,188,144 - 26,200,515	NCBI
Celera	1	24,900,351 - 24,912,738 (+)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	24,758,021 - 24,770,408 (+)	NCBI		HuRef
CHM1_1	1	26,617,199 - 26,629,585 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	26,014,921 - 26,027,308 (+)	NCBI		T2T-CHM13v2.0

Cnksr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	133,955,352 - 133,965,737 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	133,955,352 - 133,965,710 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	134,228,041 - 134,238,416 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	134,228,041 - 134,238,399 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	133,783,957 - 133,794,314 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	133,500,118 - 133,510,475 (-)	NCBI		MGSCv36	mm8
MGSCv36	4	131,800,745 - 131,810,306 (-)	NCBI		MGSCv36	mm8
Celera	4	132,407,888 - 132,418,211 (-)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	66.5	NCBI

Cnksr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	5,624,306 - 5,634,923 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	5,624,334 - 5,634,861 (+)	NCBI	ChiLan1.0	ChiLan1.0

CNKSR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	200,681,749 - 200,700,402 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	199,779,866 - 199,798,352 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	25,438,092 - 25,450,953 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	26,505,376 - 26,517,561 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	26,505,513 - 26,517,225 (+)	Ensembl	panpan1.1		panPan2

CNKSR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	73,805,333 - 73,814,711 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	73,805,710 - 73,814,725 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	70,381,662 - 70,391,005 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	74,368,429 - 74,377,772 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	74,368,438 - 74,389,997 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	71,192,826 - 71,202,168 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	72,198,576 - 72,207,918 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	73,202,496 - 73,211,838 (-)	NCBI		UU_Cfam_GSD_1.0

Cnksr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	44,872,995 - 44,882,216 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	10,699,819 - 10,706,591 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	10,697,777 - 10,706,988 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CNKSR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	83,598,372 - 83,608,607 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	83,598,363 - 83,608,617 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	77,200,943 - 77,208,114 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CNKSR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	106,577,470 - 106,596,544 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	106,577,809 - 106,589,788 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	9,828,678 - 9,841,637 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cnksr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	10,234,670 - 10,253,631 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	10,223,039 - 10,253,937 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Cnksr1
61 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	285
Count of miRNA genes:	174
Interacting mature miRNAs:	192
Transcripts:	ENSRNOT00000031225
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

BI294230

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	146,447,674 - 146,447,832 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	152,447,528 - 152,447,685	NCBI	Rnor6.0
Rnor_5.0	5	156,206,543 - 156,206,700	UniSTS	Rnor5.0
RGSC_v3.4	5	152,972,731 - 152,972,888	UniSTS	RGSC3.4
Celera	5	144,865,365 - 144,865,522	UniSTS
RH 3.4 Map	5	986.1	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	107	90	89	58	25	58	6	217	97	87	45	60	31


RefSeq Transcripts	NM_001039011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031225 ⟹ ENSRNOP00000029346

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,447,497 - 146,458,153 (-)	Ensembl
Rnor_6.0 Ensembl	5	152,446,845 - 152,458,023 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097555 ⟹ ENSRNOP00000095433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,447,497 - 146,458,212 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105866 ⟹ ENSRNOP00000088159

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	146,447,497 - 146,458,153 (-)	Ensembl

RefSeq Acc Id:

NM_001039011 ⟹ NP_001034100

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,741,879 (-)	NCBI
mRatBN7.2	5	146,447,495 - 146,458,153 (-)	NCBI
Rnor_6.0	5	152,447,348 - 152,458,005 (-)	NCBI
Rnor_5.0	5	156,206,363 - 156,217,020 (-)	NCBI
RGSC_v3.4	5	152,972,551 - 152,983,208 (-)	RGD
Celera	5	144,865,185 - 144,875,842 (-)	RGD

Sequence:

show sequence

GTCTGGACGCTGCGGGCGGAGCTCAGTATGGAGCCCGTGGAGACCTGGACCCCCGGGAAGGTGGCAGCTTGGCTGAGAGGCCTTGATGACGTCCTACAGGACTATCCCTTCGAGGACTGGGAGCTGCC
TGGAAAGTACCTGCTGCAGCTCTGTCCCCAAAACCTCGAGGCTCTGACCGTGTGGCCTCTGGGCCACCAGGAGCTCATTCTACATGGAGTGGAACAGCTCCGGGCCCTGGGCTCTAAGTTACAGACCG
AGAACCTCAAGAGCCTAGCCCAGGGGCTGCTGGACAGGACCCAGGCCTTCCAAAGCTTGGTCCAAGGCCGTCTGAGAGACTGTGCTGAGACACCCGCCGATGTCCTCAATGCTGCTGTAGAGCTGGTA
CGGGAGGCTCATGCCCTGCTCTCTTGGCTCAACAGGTACCTCTTCACTCACTTAAATGACTTCTCCGCCTGCCAAGAGATTGGTGTGCTGTGCGGAGAGCTGGGCCAAGTCTTGCAGGAGGATTGCCT
AGAGGCTGAGAAAGAAAGCAACACCCTGAGGATTTGCGGCCGTGTGGCTGGGATCTGTCACAACATCCTGGGCTGCAGCCCGGAGGAGCTGCTGGAACAGAGGGCCGTGTTGGAGCTGGTGCAGCTGG
ACGACCCTTCCGGCCTAGAAATTCACACCACCAGCAACTGCCTACACTTTGTGTCTCGAGTAGGCGTCCAGGCTGCCACCGGCTCCCAGATCCTGCCCGGAGATGAGATCATCCAAATCAATGAGCAG
GTGGTGGTCGGCTGGCCCCATAAAAACATGCTGAGGGAGCTGCTGAGGGAGCCAGCAAGGGTCAGCCTTGTACTAAAGAAGATTCCCGTGCCAGAGACCCCCTCAAAGACGCCCCCGGACTCCCCTCA
GCGGCTAAGCCAATCGCTGCCCCTGAACCCACCGTCTCCCAGGGTTCCACGCGAAGGTCTTTTTGACTTCAAGCTGTTTACAGATGGAAACCCCAGCCCCAGCCCTGCGTGGACAGACTCTACCTCCC
TTGACGCTCAGCCCACGCCCACTCCCCCTGGGCCACCAGGCACTCTTCCAGAAGAAACAGCAGAACCTCTGGAGGCTTCGGGACACCTTGACAAGAGTCCCACCGTTGGTCGGAAGAATTCAAAAGGT
ATAGCTACAAGGCTGAGCCGCCGGCGGGTGTCCTGCCGAGAGCTGGGTCTGCCGGACTGTGATGGATGGCTTCTACTGCGGAAGGTACCCGGTGGTTTTATGGGCGCTCGCTGGCGTCGCTGCTGGTT
CGTGCTCAAGGGACACACCCTATACTGGTACCGCCAACCGCAGGATGAAAAGGCGGAAGGACTTATCAACATCTCCAATTACAGCCTGGAGTGCGGGCATGACCAGAAGAAAAAATATGTGTTCCAGC
TGACCCACGATGTGTACAAGCCCTTCATCTTTGCCTCGGAGACCCTGTCTGATCTGAGCATGTGGGTGCGGCATCTTGTCACCTGCATTTCCAAGTATCAGACTCTAGGTCGGGCCCCCTCCGCCAGA
GAGGAAGACTGCTACAGTGAGACCGAAGCAGAAGACCCTGATGAAGAGGCAGGGTCCCGCTCAGCTTCTCCTGGTCCAGCTCAAGCTTGGAATGACACATCGCCCTCGGCTTCACCCCTGCAGAGTCC
TAGGACCTCCTTTGGCTCTTCATTAGATAGCAGTGACAGAGCCCTGGAAGGAATGGTACAGGGGCTGAGGCAGGGAGGCGTGTCCCTCCTGGGCCAGCCACAGCCCTTGACCCATGAACAGTGGCGGA
GTTCTTTCATGCGGCGAAACCGTGACCCTCATCTCAATGAGCATGTGCACCGTGTCCGGGCACTACAGAGCACACTCAAGGCAAAGCTACAGGAACTGCAGGTCCTGGAGGAAGTCCTGGGTGATCCT
GAACTCACAGGAGCAAAATTTCGCCAGTGGAAGGAACAGAACCACGAGCTGTACTCAGAAGGCCTGAGGACCTGGGGAGGGATGTGGGCCCAGACCAGCTCCCCAGACCCAAACACTGACTCCAGGGG
TCAATCCCCACAGCCTCTACCCTCTGACCCTGAAGAGCCCTCCCAGCTTTTTCCCTCGACCCCAGAGAACAGCCTCCAACCTCCTGACCTCTGACCCTGGCTGAGGACTACTTCATCCCCAGTCTCTG
ATGTGCTTAAAACATGTCCAAGGGGTCTGTGAGAGACCGGAAGGAGCATTAGCCCTCAGCTTACCTCCAAACCGGTCCCTCTATGCTGGGCTTCCACACTTTCTGCTCACAAGTCCCTCATAGTGGAA
GGAAAGTTCCTCTCTTCTCTGTGAGGTAGAAATCCCTCAACCCATCCTCAGATTTGGGATGTACCTGCCTCCCTGGGTCATTCAAAAAGGTTTCCCAGACCTTCCTAGGTAGGTGTTTATTTTACATG
AGAGATAGTTTTCCACCAAATAAAGTTGATTTTTCTGAAGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039109635 ⟹ XP_038965563

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,742,049 (-)	NCBI
mRatBN7.2	5	146,447,495 - 146,458,323 (-)	NCBI

RefSeq Acc Id:

XM_063287450 ⟹ XP_063143520

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,742,049 (-)	NCBI

RefSeq Acc Id:

XM_063287451 ⟹ XP_063143521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,742,049 (-)	NCBI

RefSeq Acc Id:

XM_063287452 ⟹ XP_063143522

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,741,555 (-)	NCBI

RefSeq Acc Id:

XM_063287453 ⟹ XP_063143523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,731,222 - 151,741,226 (-)	NCBI


Protein RefSeqs	NP_001034100	(Get FASTA)	NCBI Sequence Viewer
	XP_038965563	(Get FASTA)	NCBI Sequence Viewer
	XP_063143520	(Get FASTA)	NCBI Sequence Viewer
	XP_063143521	(Get FASTA)	NCBI Sequence Viewer
	XP_063143522	(Get FASTA)	NCBI Sequence Viewer
	XP_063143523	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99788	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029346
	ENSRNOP00000029346.4
	ENSRNOP00000088159.1
	ENSRNOP00000095433
	ENSRNOP00000095433.1

RefSeq Acc Id:

NP_001034100 ⟸ NM_001039011

- UniProtKB:

Q499S0 (UniProtKB/TrEMBL), A6IT10 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPVETWTPGKVAAWLRGLDDVLQDYPFEDWELPGKYLLQLCPQNLEALTVWPLGHQELILHGVEQLRALGSKLQTENLKSLAQGLLDRTQAFQSLVQGRLRDCAETPADVLNAAVELVREAHALLSW
LNRYLFTHLNDFSACQEIGVLCGELGQVLQEDCLEAEKESNTLRICGRVAGICHNILGCSPEELLEQRAVLELVQLDDPSGLEIHTTSNCLHFVSRVGVQAATGSQILPGDEIIQINEQVVVGWPHKN
MLRELLREPARVSLVLKKIPVPETPSKTPPDSPQRLSQSLPLNPPSPRVPREGLFDFKLFTDGNPSPSPAWTDSTSLDAQPTPTPPGPPGTLPEETAEPLEASGHLDKSPTVGRKNSKGIATRLSRRR
VSCRELGLPDCDGWLLLRKVPGGFMGARWRRCWFVLKGHTLYWYRQPQDEKAEGLINISNYSLECGHDQKKKYVFQLTHDVYKPFIFASETLSDLSMWVRHLVTCISKYQTLGRAPSAREEDCYSETE
AEDPDEEAGSRSASPGPAQAWNDTSPSASPLQSPRTSFGSSLDSSDRALEGMVQGLRQGGVSLLGQPQPLTHEQWRSSFMRRNRDPHLNEHVHRVRALQSTLKAKLQELQVLEEVLGDPELTGAKFRQ
WKEQNHELYSEGLRTWGGMWAQTSSPDPNTDSRGQSPQPLPSDPEEPSQLFPSTPENSLQPPDL

hide sequence

Ensembl Acc Id:

ENSRNOP00000029346 ⟸ ENSRNOT00000031225

RefSeq Acc Id:	XP_038965563 ⟸ XM_039109635
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AI85 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088159 ⟸ ENSRNOT00000105866

Ensembl Acc Id:

ENSRNOP00000095433 ⟸ ENSRNOT00000097555

Protein Domains

CRIC PH SAM

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8W8-F1-model_v2	AlphaFold	G3V8W8	1-704	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Cnksr1_1

Description:

connector enhancer of kinase suppressor of Ras 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	152,458,026 - 152,458,086	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39591	BioCyc
Ensembl Genes	ENSRNOG00000022838	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000031225	ENTREZGENE
	ENSRNOT00000031225.5	UniProtKB/TrEMBL
	ENSRNOT00000097555	ENTREZGENE
	ENSRNOT00000097555.1	UniProtKB/TrEMBL
	ENSRNOT00000105866.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.150.50	UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/TrEMBL
	2.30.42.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7934518	IMAGE-MGC_LOAD
InterPro	CNKSR	UniProtKB/TrEMBL
	CRIC_domain	UniProtKB/TrEMBL
	PDZ	UniProtKB/TrEMBL
	PDZ_sf	UniProtKB/TrEMBL
	PH_type	UniProtKB/TrEMBL
	Pleckstrin_homology	UniProtKB/TrEMBL
	SAM	UniProtKB/TrEMBL
	SAM/pointed	UniProtKB/TrEMBL
KEGG Report	rno:298545	UniProtKB/TrEMBL
MGC_CLONE	MGC:124829	IMAGE-MGC_LOAD
NCBI Gene	298545	ENTREZGENE
PANTHER	CONNECTOR ENCHANCER OF KINASE SUPPRESSOR OF RAS	UniProtKB/TrEMBL
	CONNECTOR ENHANCER OF KINASE SUPPRESSOR OF RAS 1	UniProtKB/TrEMBL
Pfam	CRIC_ras_sig	UniProtKB/TrEMBL
	PF00169	UniProtKB/TrEMBL
PhenoGen	Cnksr1	PhenoGen
PROSITE	CRIC	UniProtKB/TrEMBL
	PH_DOMAIN	UniProtKB/TrEMBL
	SAM_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022838	RatGTEx
SMART	SAM	UniProtKB/TrEMBL
	SM00233	UniProtKB/TrEMBL
Superfamily-SCOP	PDZ	UniProtKB/TrEMBL
	PH domain-like	UniProtKB/TrEMBL
	SAM_homology	UniProtKB/TrEMBL
UniProt	A0A8I6AI85	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AN25	ENTREZGENE, UniProtKB/TrEMBL
	A6IT10	ENTREZGENE, UniProtKB/TrEMBL
	G3V8W8	ENTREZGENE, UniProtKB/TrEMBL
	Q499S0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Cnksr1	connector enhancer of kinase suppressor of Ras 1	Cnksr1_predicted	connector enhancer of kinase suppressor of Ras 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cnksr1_predicted	connector enhancer of kinase suppressor of Ras 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED