Symbol:
Me3
Name:
malic enzyme 3
RGD ID:
1311070
Description:
Predicted to enable NADP+ binding activity and malate dehydrogenase (decarboxylating) (NADP+) activity. Predicted to be involved in malate metabolic process. Predicted to be active in mitochondrial matrix. Orthologous to human ME3 (malic enzyme 3); PARTICIPATES IN pyruvate metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC361602; malic enzyme 3, NADP(+)-dependent, mitochondrial; mitochondrial malic enzyme 3; NADP-dependent malic enzyme, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ME3 (malic enzyme 3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Me3 (malic enzyme 3, NADP(+)-dependent, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Me3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ME3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ME3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Me3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ME3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ME3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Me3 (malic enzyme 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ME1 (malic enzyme 1) HGNC
OrthoDB
Homo sapiens (human):
LOC122455342 (testis-specific serine/proline-rich protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ME3 (malic enzyme 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Me3 (malic enzyme 3, NADP(+)-dependent, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
me3 (malic enzyme 3, NADP(+)-dependent, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MAE1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7848
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Men
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Men-b
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Menl-1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Menl-2
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
men-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
me3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 152,946,595 - 153,148,026 (+) NCBI GRCr8 mRatBN7.2 1 143,534,024 - 143,735,551 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 143,534,139 - 143,733,132 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 151,479,136 - 151,672,663 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 158,655,512 - 158,849,041 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 151,529,440 - 151,722,961 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 153,861,535 - 154,058,608 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 153,861,569 - 154,056,654 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 160,166,289 - 160,361,740 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 146,220,504 - 146,422,659 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 146,297,071 - 146,500,992 (+) NCBI Celera 1 141,786,200 - 141,975,029 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Me3 Rat (+)-catechin multiple interactions ISO RGD:1322332 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of ME3 mRNA CTD PMID:24763279 Me3 Rat 1,1-dichloroethene decreases expression ISO RGD:1553653 6480464 vinylidene chloride results in decreased expression of ME3 mRNA CTD PMID:26682919 Me3 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1553653 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Me3 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1553653 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ME3 mRNA CTD PMID:17942748 Me3 Rat 17beta-estradiol multiple interactions ISO RGD:1322332 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ME3 mRNA CTD PMID:19619570 Me3 Rat 17beta-estradiol increases expression ISO RGD:1322332 6480464 Estradiol results in increased expression of ME3 mRNA CTD PMID:19619570 Me3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1553653 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Me3 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1553653 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Me3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1322332 6480464 Tetrachlorodibenzodioxin results in increased expression of ME3 mRNA CTD PMID:19619570 Me3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ME3 mRNA CTD PMID:21215274 Me3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ME3 mRNA CTD PMID:22298810 Me3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1553653 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ME3 mRNA CTD PMID:17942748 Me3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1322332 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of ME3 mRNA CTD PMID:19619570 Me3 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1553653 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Me3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of ME3 mRNA CTD PMID:21346803 Me3 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1322332 6480464 Lactic Acid results in decreased expression of ME3 mRNA CTD PMID:30851411 Me3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:1322332 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of ME3 mRNA CTD PMID:23146750 Me3 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ME3 mRNA CTD PMID:31881176 Me3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ME3 mRNA CTD PMID:28959563 Me3 Rat acrylamide decreases expression ISO RGD:1322332 6480464 Acrylamide results in decreased expression of ME3 mRNA CTD PMID:32763439 Me3 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of ME3 mRNA CTD PMID:23630614|PMID:25378103 Me3 Rat aflatoxin B1 increases methylation ISO RGD:1322332 6480464 Aflatoxin B1 results in increased methylation of ME3 intron CTD PMID:30157460 Me3 Rat aflatoxin B1 multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of ME3 mRNA CTD PMID:25450479 Me3 Rat all-trans-retinoic acid decreases expression ISO RGD:1322332 6480464 Tretinoin results in decreased expression of ME3 mRNA CTD PMID:23724009 Me3 Rat all-trans-retinoic acid multiple interactions ISO RGD:1553653 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of ME3 mRNA CTD PMID:36189433 Me3 Rat antirheumatic drug increases expression ISO RGD:1322332 6480464 Antirheumatic Agents results in increased expression of ME3 mRNA CTD PMID:24449571 Me3 Rat arsane affects methylation ISO RGD:1322332 6480464 Arsenic affects the methylation of ME3 gene CTD PMID:25304211 Me3 Rat arsenic atom affects methylation ISO RGD:1322332 6480464 Arsenic affects the methylation of ME3 gene CTD PMID:25304211 Me3 Rat benzo[a]pyrene decreases expression ISO RGD:1322332 6480464 Benzo(a)pyrene results in decreased expression of ME3 mRNA CTD PMID:20064835 Me3 Rat benzo[a]pyrene increases methylation ISO RGD:1322332 6480464 Benzo(a)pyrene results in increased methylation of ME3 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Me3 Rat benzo[e]pyrene increases methylation ISO RGD:1322332 6480464 benzo(e)pyrene results in increased methylation of ME3 intron CTD PMID:30157460 Me3 Rat Benzo[ghi]perylene increases expression ISO RGD:1553653 6480464 1,12-benzoperylene results in increased expression of ME3 mRNA CTD PMID:26377693 Me3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ME3 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Me3 Rat bisphenol A decreases methylation ISO RGD:1322332 6480464 bisphenol A results in decreased methylation of ME3 gene CTD PMID:31601247 Me3 Rat bisphenol A multiple interactions ISO RGD:1322332 6480464 [[ginger extract results in increased abundance of Oils, Volatile] which co-treated with bisphenol A] affects more ... CTD PMID:33376534 Me3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ME3 mRNA CTD PMID:32145629 Me3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of ME3 mRNA CTD PMID:31129395 Me3 Rat bisphenol AF increases expression ISO RGD:1322332 6480464 bisphenol AF results in increased expression of ME3 protein CTD PMID:34186270 Me3 Rat Bisphenol B increases expression ISO RGD:1322332 6480464 bisphenol B results in increased expression of ME3 protein CTD PMID:34186270 Me3 Rat Butylbenzyl phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat carbon nanotube decreases expression ISO RGD:1553653 6480464 Nanotubes, Carbon results in decreased expression of ME3 mRNA CTD PMID:25554681 Me3 Rat CGP 52608 multiple interactions ISO RGD:1322332 6480464 CGP 52608 promotes the reaction [RORA protein binds to ME3 gene] CTD PMID:28238834 Me3 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ME3 mRNA CTD PMID:22023808 Me3 Rat cisplatin multiple interactions ISO RGD:1322332 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ME3 mRNA CTD PMID:27392435 Me3 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ME3 mRNA CTD PMID:17602206 Me3 Rat cobalt dichloride decreases expression ISO RGD:1322332 6480464 cobaltous chloride results in decreased expression of ME3 mRNA CTD PMID:19320972|PMID:19376846 Me3 Rat dexamethasone increases expression ISO RGD:1322332 6480464 Dexamethasone results in increased expression of ME3 mRNA CTD PMID:25047013 Me3 Rat dibenz[a,h]anthracene increases expression ISO RGD:1553653 6480464 1,2,5,6-dibenzanthracene results in increased expression of ME3 mRNA CTD PMID:26377693 Me3 Rat dibutyl phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat dichloroacetic acid decreases expression ISO RGD:1553653 6480464 Dichloroacetic Acid results in decreased expression of ME3 mRNA CTD PMID:28962523 Me3 Rat diethyl phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat diisobutyl phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat diisononyl phthalate multiple interactions ISO RGD:1553653 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Me3 Rat dorsomorphin multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Me3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ME3 mRNA CTD PMID:29391264 Me3 Rat entinostat decreases expression ISO RGD:1322332 6480464 entinostat results in decreased expression of ME3 mRNA CTD PMID:26272509 Me3 Rat entinostat multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Me3 Rat ethanol affects splicing ISO RGD:1553653 6480464 Ethanol affects the splicing of ME3 mRNA CTD PMID:30319688 Me3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ME3 mRNA CTD PMID:21525395 Me3 Rat fonofos increases methylation ISO RGD:1322332 6480464 Fonofos results in increased methylation of ME3 promoter CTD PMID:22847954 Me3 Rat furan decreases expression EXP 6480464 furan results in decreased expression of ME3 mRNA CTD PMID:25539665 Me3 Rat genistein decreases expression ISO RGD:1553653 6480464 Genistein results in decreased expression of ME3 mRNA CTD PMID:32186404 Me3 Rat GW 4064 decreases expression ISO RGD:1553653 6480464 GW 4064 results in decreased expression of ME3 mRNA CTD PMID:26655953 Me3 Rat iron dichloride increases expression ISO RGD:1322332 6480464 ferrous chloride results in increased expression of ME3 mRNA CTD PMID:35984750 Me3 Rat kojic acid decreases expression ISO RGD:1322332 6480464 kojic acid results in decreased expression of ME3 mRNA CTD PMID:16595896 Me3 Rat maneb multiple interactions ISO RGD:1553653 6480464 [Maneb co-treated with Paraquat] results in increased expression of ME3 mRNA CTD PMID:36117858 Me3 Rat manganese atom increases expression ISO RGD:1322332 6480464 Manganese results in increased expression of ME3 mRNA CTD PMID:17175027 Me3 Rat manganese(0) increases expression ISO RGD:1322332 6480464 Manganese results in increased expression of ME3 mRNA CTD PMID:17175027 Me3 Rat manganese(II) chloride increases expression ISO RGD:1322332 6480464 manganese chloride results in increased expression of ME3 mRNA CTD PMID:17175027 Me3 Rat methapyrilene increases methylation ISO RGD:1322332 6480464 Methapyrilene results in increased methylation of ME3 intron CTD PMID:30157460 Me3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ME3 gene CTD PMID:35440735 Me3 Rat methylmercury chloride decreases expression ISO RGD:1322332 6480464 methylmercuric chloride results in decreased expression of ME3 mRNA CTD PMID:28001369 Me3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1553653 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of ME3 mRNA CTD PMID:36189433 Me3 Rat morphine increases expression ISO RGD:1553653 6480464 Morphine results in increased expression of ME3 mRNA CTD PMID:21178816 Me3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of ME3 mRNA CTD PMID:17602206 Me3 Rat niclosamide decreases expression ISO RGD:1322332 6480464 Niclosamide results in decreased expression of ME3 mRNA CTD PMID:36318118 Me3 Rat okadaic acid decreases expression ISO RGD:1322332 6480464 Okadaic Acid results in decreased expression of ME3 mRNA CTD PMID:38832940 Me3 Rat p-chloromercuribenzoic acid decreases expression ISO RGD:1322332 6480464 p-Chloromercuribenzoic Acid results in decreased expression of ME3 mRNA CTD PMID:26272509 Me3 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Me3 Rat panobinostat multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Me3 Rat panobinostat decreases expression ISO RGD:1322332 6480464 panobinostat results in decreased expression of ME3 mRNA CTD PMID:26272509 Me3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ME3 mRNA CTD PMID:17202762|PMID:33387578 Me3 Rat paracetamol affects expression ISO RGD:1553653 6480464 Acetaminophen affects the expression of ME3 mRNA CTD PMID:17562736 Me3 Rat paraquat multiple interactions ISO RGD:1553653 6480464 [Maneb co-treated with Paraquat] results in increased expression of ME3 mRNA CTD PMID:36117858 Me3 Rat parathion increases methylation ISO RGD:1322332 6480464 Parathion results in increased methylation of ME3 promoter CTD PMID:22847954 Me3 Rat PCB138 multiple interactions ISO RGD:1553653 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Me3 Rat phenobarbital affects expression ISO RGD:1322332 6480464 Phenobarbital affects the expression of ME3 mRNA CTD PMID:19159669 Me3 Rat phenylmercury acetate decreases expression ISO RGD:1322332 6480464 Phenylmercuric Acetate results in decreased expression of ME3 mRNA CTD PMID:26272509 Me3 Rat phenylmercury acetate multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Me3 Rat rac-lactic acid decreases expression ISO RGD:1322332 6480464 Lactic Acid results in decreased expression of ME3 mRNA CTD PMID:30851411 Me3 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ME3 mRNA CTD PMID:28374803 Me3 Rat SB 431542 multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Me3 Rat sodium arsenite decreases expression ISO RGD:1553653 6480464 sodium arsenite results in decreased expression of ME3 mRNA CTD PMID:37682722 Me3 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of ME3 mRNA CTD PMID:19281266 Me3 Rat sulforaphane multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of ME3 mRNA CTD PMID:25450479 Me3 Rat sulforaphane multiple interactions ISO RGD:1553653 6480464 [NFE2L2 protein affects the susceptibility to sulforaphane] which affects the expression of ME3 mRNA CTD PMID:30529165 Me3 Rat sunitinib decreases expression ISO RGD:1322332 6480464 Sunitinib results in decreased expression of ME3 mRNA CTD PMID:31533062 Me3 Rat tamoxifen increases expression ISO RGD:1553653 6480464 Tamoxifen results in increased expression of ME3 mRNA CTD PMID:25123088 Me3 Rat terbufos increases methylation ISO RGD:1322332 6480464 terbufos results in increased methylation of ME3 promoter CTD PMID:22847954 Me3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ME3 mRNA CTD PMID:31150632 Me3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ME3 mRNA CTD PMID:23411599|PMID:34492290 Me3 Rat titanium dioxide decreases methylation ISO RGD:1553653 6480464 titanium dioxide results in decreased methylation of ME3 promoter CTD PMID:35295148 Me3 Rat titanium dioxide decreases expression ISO RGD:1553653 6480464 titanium dioxide results in decreased expression of ME3 mRNA CTD PMID:35295148 Me3 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of ME3 mRNA CTD PMID:31129395 Me3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ME3 mRNA CTD PMID:33387578 Me3 Rat trichostatin A decreases expression ISO RGD:1322332 6480464 trichostatin A results in decreased expression of ME3 mRNA CTD PMID:24935251|PMID:26272509 Me3 Rat trichostatin A multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Me3 Rat triclosan decreases expression ISO RGD:1322332 6480464 Triclosan results in decreased expression of ME3 mRNA CTD PMID:30510588 Me3 Rat triptonide increases expression ISO RGD:1553653 6480464 triptonide results in increased expression of ME3 mRNA CTD PMID:33045310 Me3 Rat valproic acid affects expression ISO RGD:1322332 6480464 Valproic Acid affects the expression of ME3 mRNA CTD PMID:25979313 Me3 Rat valproic acid decreases expression ISO RGD:1322332 6480464 Valproic Acid results in decreased expression of ME3 mRNA CTD PMID:23179753|PMID:23527032|PMID:24383497|PMID:24935251|PMID:26272509|PMID:29154799 Me3 Rat valproic acid multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Me3 Rat vinclozolin affects methylation EXP 6480464 vinclozolin affects the methylation of ME3 gene CTD PMID:31682807 Me3 Rat vorinostat decreases expression ISO RGD:1322332 6480464 vorinostat results in decreased expression of ME3 mRNA CTD PMID:26272509 Me3 Rat vorinostat multiple interactions ISO RGD:1322332 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,1-dichloroethene (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) Butylbenzyl phthalate (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (EXP,ISO) clofibric acid (EXP) cobalt dichloride (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) flutamide (EXP) fonofos (ISO) furan (EXP) genistein (ISO) GW 4064 (ISO) iron dichloride (ISO) kojic acid (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) morphine (ISO) N-nitrosodiethylamine (EXP) niclosamide (ISO) okadaic acid (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) PCB138 (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) rac-lactic acid (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) sulforaphane (EXP,ISO) sunitinib (ISO) tamoxifen (ISO) terbufos (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (EXP) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Me3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 152,946,595 - 153,148,026 (+) NCBI GRCr8 mRatBN7.2 1 143,534,024 - 143,735,551 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 143,534,139 - 143,733,132 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 151,479,136 - 151,672,663 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 158,655,512 - 158,849,041 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 151,529,440 - 151,722,961 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 153,861,535 - 154,058,608 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 153,861,569 - 154,056,654 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 160,166,289 - 160,361,740 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 146,220,504 - 146,422,659 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 146,297,071 - 146,500,992 (+) NCBI Celera 1 141,786,200 - 141,975,029 (+) NCBI Celera Cytogenetic Map 1 q32 NCBI
ME3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 86,434,930 - 86,672,616 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 86,441,108 - 86,672,636 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 86,145,972 - 86,383,658 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 85,829,798 - 86,061,075 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 85,829,885 - 86,061,004 NCBI Celera 11 83,462,760 - 83,694,235 (-) NCBI Celera Cytogenetic Map 11 q14.2 NCBI HuRef 11 82,440,697 - 82,672,413 (-) NCBI HuRef CHM1_1 11 86,037,902 - 86,269,349 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 86,377,442 - 86,612,763 (-) NCBI T2T-CHM13v2.0
Me3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 89,281,492 - 89,503,423 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 89,281,600 - 89,503,567 (+) Ensembl GRCm39 Ensembl GRCm38 7 89,632,284 - 89,854,359 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 89,632,392 - 89,854,359 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 96,781,328 - 97,002,869 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 89,508,010 - 89,729,551 (+) NCBI MGSCv36 mm8 Celera 7 86,981,993 - 87,178,718 (+) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 50.27 NCBI
Me3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 6,343,476 - 6,557,058 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 6,335,411 - 6,555,494 (+) NCBI ChiLan1.0 ChiLan1.0
ME3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 87,349,049 - 87,595,198 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 88,407,386 - 88,646,956 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 81,490,947 - 81,728,589 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 85,104,477 - 85,336,683 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 85,104,477 - 85,222,822 (-) Ensembl panpan1.1 panPan2
ME3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 12,813,052 - 13,105,805 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 12,813,047 - 13,105,804 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 12,678,922 - 12,971,512 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 12,995,770 - 13,288,435 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 13,101,638 - 13,288,430 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 12,781,982 - 13,074,486 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 12,853,629 - 13,146,550 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 12,909,897 - 13,203,162 (+) NCBI UU_Cfam_GSD_1.0
Me3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 72,614,105 - 72,823,300 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936498 14,216,513 - 14,423,031 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936498 14,216,510 - 14,422,936 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ME3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 20,294,908 - 20,583,584 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 20,294,871 - 20,613,225 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 22,589,632 - 22,780,615 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ME3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 77,712,748 - 77,934,263 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 77,712,838 - 77,933,727 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 47,792,396 - 48,016,415 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Me3
.
Predicted Target Of
Count of predictions: 51 Count of miRNA genes: 48 Interacting mature miRNAs: 50 Transcripts: ENSRNOT00000023329 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
BI301980
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 143,568,830 - 143,569,020 (+) MAPPER mRatBN7.2 Rnor_6.0 1 153,895,885 - 153,896,074 NCBI Rnor6.0 Rnor_5.0 1 160,200,232 - 160,200,421 UniSTS Rnor5.0 RGSC_v3.4 1 146,255,789 - 146,255,978 UniSTS RGSC3.4 Celera 1 141,820,906 - 141,821,095 UniSTS RH 3.4 Map 1 1116.4 UniSTS Cytogenetic Map 1 q32 UniSTS
RH129606
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 152,946,456 - 152,946,755 (+) Marker Load Pipeline mRatBN7.2 1 143,533,885 - 143,534,184 (+) MAPPER mRatBN7.2 Rnor_6.0 1 153,861,316 - 153,861,614 NCBI Rnor6.0 Rnor_5.0 1 160,166,036 - 160,166,334 UniSTS Rnor5.0 RGSC_v3.4 1 146,220,251 - 146,220,549 UniSTS RGSC3.4 Celera 1 141,785,947 - 141,786,245 UniSTS RH 3.4 Map 1 1115.9 UniSTS Cytogenetic Map 1 q32 UniSTS
RH133219
Rat Assembly Chr Position (strand) Source JBrowse Celera 1 141,973,432 - 141,974,926 UniSTS RH 3.4 Map 1 1121.0 UniSTS Cytogenetic Map 1 q32 UniSTS
BF405328
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 143,535,926 - 143,536,019 (+) MAPPER mRatBN7.2 Rnor_6.0 1 153,863,357 - 153,863,449 NCBI Rnor6.0 Rnor_5.0 1 160,168,077 - 160,168,169 UniSTS Rnor5.0 RGSC_v3.4 1 146,222,292 - 146,222,384 UniSTS RGSC3.4 Celera 1 141,787,988 - 141,788,080 UniSTS RH 3.4 Map 1 1116.4 UniSTS Cytogenetic Map 1 q32 UniSTS
BE118196
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 143,532,538 - 143,532,716 (+) MAPPER mRatBN7.2 Rnor_6.0 1 153,859,969 - 153,860,146 NCBI Rnor6.0 Rnor_5.0 1 160,164,689 - 160,164,866 UniSTS Rnor5.0 RGSC_v3.4 1 146,218,904 - 146,219,081 UniSTS RGSC3.4 Celera 1 141,784,600 - 141,784,777 UniSTS RH 3.4 Map 1 1114.6 UniSTS Cytogenetic Map 1 q32 UniSTS
MARC_13809-13810:1046871162:1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 153,140,608 - 153,141,337 (+) Marker Load Pipeline mRatBN7.2 1 143,728,048 - 143,728,777 (+) MAPPER mRatBN7.2 Rnor_6.0 1 154,052,701 - 154,053,429 NCBI Rnor6.0 Rnor_5.0 1 160,357,081 - 160,357,809 UniSTS Rnor5.0 RGSC_v3.4 1 146,418,037 - 146,418,543 UniSTS RGSC3.4 Celera 1 141,971,160 - 141,971,889 UniSTS Cytogenetic Map 1 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023329 ⟹ ENSRNOP00000023329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 143,534,139 - 143,731,927 (+) Ensembl Rnor_6.0 Ensembl 1 153,861,569 - 154,056,587 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087067 ⟹ ENSRNOP00000072989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 143,534,139 - 143,733,132 (+) Ensembl Rnor_6.0 Ensembl 1 153,861,948 - 154,056,654 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095307 ⟹ ENSRNOP00000089037
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 143,534,139 - 143,733,132 (+) Ensembl
RefSeq Acc Id:
NM_001415972 ⟹ NP_001402901
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 152,946,628 - 153,148,026 (+) NCBI mRatBN7.2 1 143,534,057 - 143,735,466 (+) NCBI
RefSeq Acc Id:
XM_006229666 ⟹ XP_006229728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 152,946,595 - 153,144,494 (+) NCBI mRatBN7.2 1 143,534,024 - 143,735,551 (+) NCBI Rnor_6.0 1 153,861,535 - 154,058,608 (+) NCBI Rnor_5.0 1 160,166,289 - 160,361,740 (+) NCBI
Sequence:
TGACAGGGGACAGTAGCGTCTTTCCCTACCTGCCTGCAGTGGGGCTGCACAGACTTGAGCTTCTCACAGACTTGAGCTTCTCCAGTTAGGCAGGTCTGTGCCAGGACCATGGGCGCCGCGCTGGGCAC
hide sequence
RefSeq Acc Id:
XM_063266979 ⟹ XP_063123049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 152,946,595 - 153,142,135 (+) NCBI
RefSeq Acc Id:
XP_006229728 ⟸ XM_006229666
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K4C6 (UniProtKB/TrEMBL), F1M5N4 (UniProtKB/TrEMBL)
- Sequence:
MGAALGTGARLTSLPRLACGSLRRQALSAPAQGCHSKSGPPRPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYENQQSDLDKYIILMTLQDRNEKLFYRVLTSD
hide sequence
Ensembl Acc Id:
ENSRNOP00000072989 ⟸ ENSRNOT00000087067
Ensembl Acc Id:
ENSRNOP00000023329 ⟸ ENSRNOT00000023329
Ensembl Acc Id:
ENSRNOP00000089037 ⟸ ENSRNOT00000095307
RefSeq Acc Id:
NP_001402901 ⟸ NM_001415972
- UniProtKB:
F1M5N4 (UniProtKB/TrEMBL), A0A8I6AK15 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123049 ⟸ XM_063266979
- Peptide Label:
isoform X2
RGD ID: 13690183 Promoter ID: EPDNEW_R707 Type: single initiation site Name: Me3_1 Description: malic enzyme 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 153,861,552 - 153,861,612 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Me3
malic enzyme 3
Me3
malic enzyme 3, NADP(+)-dependent, mitochondrial
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Me3
malic enzyme 3, NADP(+)-dependent, mitochondrial
Me3_predicted
malic enzyme 3, NADP(+)-dependent, mitochondrial (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Me3_predicted
malic enzyme 3, NADP(+)-dependent, mitochondrial (predicted)
Symbol and Name status set to approved
70820 APPROVED
