Symbol:
Lhfpl2
Name:
LHFPL tetraspan subfamily member 2
RGD ID:
1309869
Description:
Predicted to be involved in development of primary female sexual characteristics; development of primary male sexual characteristics; and positive regulation of fertilization. Predicted to be active in membrane. Orthologous to human LHFPL2 (LHFPL tetraspan subfamily member 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; all-trans-retinoic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
lipoma HMGIC fusion partner-like 2; lipoma HMGIC fusion partner-like 2 protein; LOC294643
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 27,016,404 - 27,169,830 (+) NCBI GRCr8 mRatBN7.2 2 25,281,771 - 25,428,128 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 25,281,901 - 25,427,950 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 32,373,260 - 32,456,118 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 30,473,524 - 30,556,383 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 25,298,201 - 25,380,341 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 23,705,491 - 23,852,021 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 23,770,721 - 23,852,021 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 42,878,147 - 43,023,911 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 24,407,387 - 24,489,407 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 24,384,047 - 24,406,455 (+) NCBI Celera 2 21,418,069 - 21,501,439 (+) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lhfpl2 Rat 1,2-dichloroethane increases expression ISO RGD:1320444 6480464 ethylene dichloride results in increased expression of LHFPL2 mRNA CTD PMID:28960355 Lhfpl2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1320444 6480464 1,2-Dimethylhydrazine results in decreased expression of LHFPL2 mRNA CTD PMID:22206623 Lhfpl2 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1320444 6480464 Ethinyl Estradiol results in increased expression of LHFPL2 mRNA CTD PMID:17942748 Lhfpl2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1320444 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LHFPL2 mRNA CTD PMID:17942748 Lhfpl2 Rat 17beta-estradiol multiple interactions ISO RGD:1320443 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of LHFPL2 mRNA CTD PMID:30165855 Lhfpl2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of LHFPL2 mRNA CTD PMID:27291303 Lhfpl2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1320444 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of LHFPL2 mRNA CTD PMID:17942748 Lhfpl2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1320444 6480464 Tetrachlorodibenzodioxin affects the expression of LHFPL2 mRNA CTD PMID:21570461 Lhfpl2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1320444 6480464 Tetrachlorodibenzodioxin results in decreased expression of LHFPL2 mRNA CTD PMID:19465110|PMID:19770486 Lhfpl2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1320444 6480464 Tetrachlorodibenzodioxin results in increased expression of LHFPL2 mRNA CTD PMID:17942748 Lhfpl2 Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:1320443 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Lhfpl2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1320443 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Lhfpl2 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1320444 6480464 4,4'-diaminodiphenylmethane results in increased expression of LHFPL2 mRNA CTD PMID:18648102 Lhfpl2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1320443 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Lhfpl2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1320444 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of LHFPL2 mRNA CTD PMID:30951980 Lhfpl2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1320444 6480464 bisphenol S results in increased expression of LHFPL2 mRNA CTD PMID:30951980 Lhfpl2 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1320444 6480464 Fenretinide results in decreased expression of LHFPL2 mRNA CTD PMID:28973697 Lhfpl2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of LHFPL2 mRNA CTD PMID:22504374 Lhfpl2 Rat aflatoxin B1 decreases expression ISO RGD:1320444 6480464 Aflatoxin B1 results in decreased expression of LHFPL2 mRNA CTD PMID:19770486 Lhfpl2 Rat aflatoxin B1 increases methylation ISO RGD:1320443 6480464 Aflatoxin B1 results in increased methylation of LHFPL2 intron CTD PMID:30157460 Lhfpl2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of LHFPL2 mRNA CTD PMID:20488242 Lhfpl2 Rat all-trans-retinoic acid multiple interactions ISO RGD:1320444 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of LHFPL2 mRNA CTD PMID:30951980 Lhfpl2 Rat all-trans-retinoic acid increases expression ISO RGD:1320443 6480464 Tretinoin results in increased expression of LHFPL2 mRNA CTD PMID:23724009 Lhfpl2 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of LHFPL2 mRNA CTD PMID:37876353 Lhfpl2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of LHFPL2 mRNA CTD PMID:30779732 Lhfpl2 Rat aristolochic acid A decreases expression ISO RGD:1320443 6480464 aristolochic acid I results in decreased expression of LHFPL2 mRNA CTD PMID:33212167 Lhfpl2 Rat atrazine decreases expression ISO RGD:1320443 6480464 Atrazine results in decreased expression of LHFPL2 mRNA CTD PMID:22378314 Lhfpl2 Rat benzene increases expression ISO RGD:1320443 6480464 Benzene results in increased expression of LHFPL2 mRNA CTD PMID:19162166 Lhfpl2 Rat benzo[a]pyrene decreases expression ISO RGD:1320443 6480464 Benzo(a)pyrene results in decreased expression of LHFPL2 mRNA CTD PMID:20064835 Lhfpl2 Rat benzo[a]pyrene affects methylation ISO RGD:1320443 6480464 Benzo(a)pyrene affects the methylation of LHFPL2 5' UTR; Benzo(a)pyrene affects the methylation of LHFPL2 intron; more ... CTD PMID:27901495|PMID:30157460 Lhfpl2 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LHFPL2 mRNA CTD PMID:21839799 Lhfpl2 Rat benzo[a]pyrene decreases expression ISO RGD:1320444 6480464 Benzo(a)pyrene results in decreased expression of LHFPL2 mRNA CTD PMID:19770486 Lhfpl2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1320444 6480464 Diethylhexyl Phthalate results in decreased expression of LHFPL2 mRNA CTD PMID:34319233 Lhfpl2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of LHFPL2 mRNA CTD PMID:25181051 Lhfpl2 Rat bisphenol A increases methylation ISO RGD:1320443 6480464 bisphenol A results in increased methylation of LHFPL2 gene CTD PMID:31601247 Lhfpl2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LHFPL2 mRNA CTD PMID:33296240 Lhfpl2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LHFPL2 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Lhfpl2 Rat bisphenol A multiple interactions ISO RGD:1320443 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LHFPL2 gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Lhfpl2 Rat bisphenol A increases expression ISO RGD:1320443 6480464 bisphenol A results in increased expression of LHFPL2 mRNA CTD PMID:25047013|PMID:27685785|PMID:29275510 Lhfpl2 Rat bisphenol F decreases expression ISO RGD:1320444 6480464 bisphenol F results in decreased expression of LHFPL2 mRNA CTD PMID:38685157 Lhfpl2 Rat cadmium atom multiple interactions ISO RGD:1320443 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Lhfpl2 Rat cadmium dichloride multiple interactions ISO RGD:1320443 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Lhfpl2 Rat calcitriol increases expression ISO RGD:1320443 6480464 Calcitriol results in increased expression of LHFPL2 mRNA CTD PMID:21592394 Lhfpl2 Rat calcitriol multiple interactions ISO RGD:1320443 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LHFPL2 mRNA CTD PMID:21592394 Lhfpl2 Rat carbon nanotube increases expression ISO RGD:1320444 6480464 Nanotubes, Carbon analog results in increased expression of LHFPL2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Lhfpl2 Rat CGP 52608 multiple interactions ISO RGD:1320443 6480464 CGP 52608 promotes the reaction [RORA protein binds to LHFPL2 gene] CTD PMID:28238834 Lhfpl2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of LHFPL2 mRNA CTD PMID:26033743 Lhfpl2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of LHFPL2 mRNA CTD PMID:26033743 Lhfpl2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LHFPL2 mRNA CTD PMID:27523638 Lhfpl2 Rat cyclosporin A increases expression ISO RGD:1320444 6480464 Cyclosporine results in increased expression of LHFPL2 mRNA CTD PMID:19770486 Lhfpl2 Rat cyclosporin A increases expression ISO RGD:1320443 6480464 Cyclosporine results in increased expression of LHFPL2 mRNA CTD PMID:20106945|PMID:25562108 Lhfpl2 Rat dexamethasone decreases expression ISO RGD:1320444 6480464 Dexamethasone results in decreased expression of LHFPL2 mRNA CTD PMID:22733784 Lhfpl2 Rat dexamethasone multiple interactions ISO RGD:1320443 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Lhfpl2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of LHFPL2 mRNA CTD PMID:21266533 Lhfpl2 Rat dimethylarsinic acid multiple interactions ISO RGD:1320444 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lhfpl2 Rat ethanol multiple interactions ISO RGD:1320443 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 Lhfpl2 Rat ethanol increases expression ISO RGD:1320444 6480464 Ethanol results in increased expression of LHFPL2 mRNA CTD PMID:30319688 Lhfpl2 Rat ethanol affects expression ISO RGD:1320444 6480464 Ethanol affects the expression of LHFPL2 mRNA CTD PMID:30319688 Lhfpl2 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of LHFPL2 mRNA CTD PMID:23962444 Lhfpl2 Rat fulvestrant multiple interactions ISO RGD:1320443 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LHFPL2 gene CTD PMID:31601247 Lhfpl2 Rat genistein increases expression ISO RGD:1320444 6480464 Genistein results in increased expression of LHFPL2 mRNA CTD PMID:32186404 Lhfpl2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of LHFPL2 mRNA CTD PMID:33387578 Lhfpl2 Rat indometacin multiple interactions ISO RGD:1320443 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Lhfpl2 Rat lipopolysaccharide decreases expression ISO RGD:1320444 6480464 Lipopolysaccharides results in decreased expression of LHFPL2 mRNA CTD PMID:26582142 Lhfpl2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of LHFPL2 mRNA CTD PMID:28801915 Lhfpl2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of LHFPL2 mRNA CTD PMID:22504374 Lhfpl2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of LHFPL2 gene CTD PMID:35440735 Lhfpl2 Rat methylarsonic acid multiple interactions ISO RGD:1320444 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lhfpl2 Rat N-Nitrosopyrrolidine increases expression ISO RGD:1320443 6480464 N-Nitrosopyrrolidine results in increased expression of LHFPL2 mRNA CTD PMID:32234424 Lhfpl2 Rat nevirapine decreases expression ISO RGD:1320444 6480464 Nevirapine results in decreased expression of LHFPL2 mRNA CTD PMID:38636494 Lhfpl2 Rat okadaic acid increases expression ISO RGD:1320443 6480464 Okadaic Acid results in increased expression of LHFPL2 mRNA CTD PMID:38832940 Lhfpl2 Rat ozone multiple interactions ISO RGD:1320444 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Lhfpl2 Rat paracetamol increases expression ISO RGD:1320443 6480464 Acetaminophen results in increased expression of LHFPL2 mRNA CTD PMID:29067470 Lhfpl2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of LHFPL2 mRNA CTD PMID:33387578 Lhfpl2 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1320444 6480464 perfluorohexanesulfonic acid results in increased expression of LHFPL2 mRNA CTD PMID:37995155 Lhfpl2 Rat perfluorononanoic acid increases expression ISO RGD:1320443 6480464 perfluoro-n-nonanoic acid results in increased expression of LHFPL2 mRNA CTD PMID:32588087 Lhfpl2 Rat phenobarbital affects expression ISO RGD:1320443 6480464 Phenobarbital affects the expression of LHFPL2 mRNA CTD PMID:19159669 Lhfpl2 Rat phenobarbital affects expression ISO RGD:1320444 6480464 Phenobarbital affects the expression of LHFPL2 mRNA CTD PMID:23091169 Lhfpl2 Rat piroxicam increases expression ISO RGD:1320443 6480464 Piroxicam results in increased expression of LHFPL2 mRNA CTD PMID:21858171 Lhfpl2 Rat silicon dioxide increases expression ISO RGD:1320444 6480464 Silicon Dioxide results in increased expression of LHFPL2 mRNA CTD PMID:29203145|PMID:29341224|PMID:38811393 Lhfpl2 Rat sodium arsenate decreases expression ISO RGD:1320444 6480464 sodium arsenate results in decreased expression of LHFPL2 mRNA CTD PMID:21795629 Lhfpl2 Rat sodium arsenate multiple interactions ISO RGD:1320444 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lhfpl2 Rat sodium arsenite multiple interactions ISO RGD:1320444 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ... CTD PMID:34876320 Lhfpl2 Rat sodium arsenite decreases expression ISO RGD:1320444 6480464 sodium arsenite results in decreased expression of LHFPL2 mRNA CTD PMID:37682722 Lhfpl2 Rat testosterone multiple interactions ISO RGD:1320443 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LHFPL2 mRNA CTD PMID:21592394 Lhfpl2 Rat testosterone increases expression ISO RGD:1320443 6480464 Testosterone results in increased expression of LHFPL2 mRNA CTD PMID:21592394 Lhfpl2 Rat tetrachloromethane affects expression ISO RGD:1320444 6480464 Carbon Tetrachloride affects the expression of LHFPL2 mRNA CTD PMID:17484886 Lhfpl2 Rat thapsigargin decreases expression ISO RGD:1320443 6480464 Thapsigargin results in decreased expression of LHFPL2 mRNA CTD PMID:22378314 Lhfpl2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of LHFPL2 mRNA CTD PMID:34492290 Lhfpl2 Rat titanium dioxide decreases methylation ISO RGD:1320444 6480464 titanium dioxide results in decreased methylation of LHFPL2 gene CTD PMID:35295148 Lhfpl2 Rat tremolite asbestos increases expression ISO RGD:1320444 6480464 tremolite results in increased expression of LHFPL2 mRNA CTD PMID:29279043 Lhfpl2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of LHFPL2 mRNA CTD PMID:33387578 Lhfpl2 Rat triclosan decreases expression ISO RGD:1320443 6480464 Triclosan results in decreased expression of LHFPL2 mRNA CTD PMID:30510588 Lhfpl2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of LHFPL2 mRNA CTD PMID:30589522 Lhfpl2 Rat triptonide decreases expression ISO RGD:1320444 6480464 triptonide results in decreased expression of LHFPL2 mRNA CTD PMID:33045310 Lhfpl2 Rat troglitazone increases expression ISO RGD:1320444 6480464 troglitazone results in increased expression of LHFPL2 mRNA CTD PMID:28973697 Lhfpl2 Rat tunicamycin decreases expression ISO RGD:1320443 6480464 Tunicamycin results in decreased expression of LHFPL2 mRNA CTD PMID:22378314 Lhfpl2 Rat valproic acid affects expression ISO RGD:1320443 6480464 Valproic Acid affects the expression of LHFPL2 mRNA CTD PMID:25979313 Lhfpl2 Rat valproic acid increases expression ISO RGD:1320444 6480464 Valproic Acid results in increased expression of LHFPL2 mRNA CTD PMID:24896083 Lhfpl2 Rat vancomycin decreases expression ISO RGD:1320444 6480464 Vancomycin results in decreased expression of LHFPL2 mRNA CTD PMID:18930951
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-bromohexadecanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) allopurinol (EXP) amphetamine (EXP) aristolochic acid A (ISO) atrazine (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dimethylarsinic acid (ISO) ethanol (ISO) fipronil (EXP) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) indometacin (ISO) lipopolysaccharide (ISO) manganese(II) chloride (EXP) methimazole (EXP) methoxychlor (EXP) methylarsonic acid (ISO) N-Nitrosopyrrolidine (ISO) nevirapine (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) phenobarbital (ISO) piroxicam (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) tremolite asbestos (ISO) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO)
Lhfpl2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 27,016,404 - 27,169,830 (+) NCBI GRCr8 mRatBN7.2 2 25,281,771 - 25,428,128 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 25,281,901 - 25,427,950 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 32,373,260 - 32,456,118 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 30,473,524 - 30,556,383 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 25,298,201 - 25,380,341 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 23,705,491 - 23,852,021 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 23,770,721 - 23,852,021 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 42,878,147 - 43,023,911 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 24,407,387 - 24,489,407 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 24,384,047 - 24,406,455 (+) NCBI Celera 2 21,418,069 - 21,501,439 (+) NCBI Celera Cytogenetic Map 2 q12 NCBI
LHFPL2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 78,485,230 - 78,648,772 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 78,485,215 - 78,770,021 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 77,781,053 - 77,944,595 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 77,816,794 - 77,980,404 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 77,816,809 - 77,841,867 NCBI Celera 5 73,674,222 - 73,837,829 (-) NCBI Celera Cytogenetic Map 5 q14.1 NCBI HuRef 5 72,987,888 - 73,135,012 (-) NCBI HuRef CHM1_1 5 77,214,339 - 77,377,632 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 78,966,706 - 79,251,841 (-) NCBI T2T-CHM13v2.0
Lhfpl2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 94,193,659 - 94,331,918 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 94,194,304 - 94,331,917 (+) Ensembl GRCm39 Ensembl GRCm38 13 94,057,152 - 94,195,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 94,057,796 - 94,195,409 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 94,827,751 - 94,965,364 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 95,158,549 - 95,296,163 (+) NCBI MGSCv36 mm8 Celera 13 97,679,541 - 97,817,771 (+) NCBI Celera Cytogenetic Map 13 C3 NCBI cM Map 13 49.03 NCBI
Lhfpl2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 22,504,107 - 22,557,970 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 22,398,503 - 22,556,667 (+) NCBI ChiLan1.0 ChiLan1.0
LHFPL2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 36,655,122 - 36,819,286 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 34,809,565 - 34,972,913 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 36,663,171 - 36,825,272 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 37,151,995 - 37,314,043 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 37,289,046 - 37,314,043 (+) Ensembl panpan1.1 panPan2
LHFPL2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 28,255,389 - 28,279,510 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 29,367,033 - 29,520,677 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 28,049,631 - 28,203,008 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 3 27,985,849 - 28,139,437 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 27,964,071 - 28,117,601 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 28,291,124 - 28,444,925 (+) NCBI UU_Cfam_GSD_1.0
Lhfpl2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 184,321,166 - 184,460,783 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936549 6,397,810 - 6,418,937 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936549 6,398,190 - 6,537,832 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LHFPL2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 87,322,934 - 87,349,878 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 87,321,119 - 87,498,686 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 88,879,254 - 88,970,752 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LHFPL2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 72,738,214 - 72,769,384 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 72,737,678 - 72,835,153 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 21,585,518 - 21,745,975 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lhfpl2
.
Predicted Target Of
Count of predictions: 442 Count of miRNA genes: 236 Interacting mature miRNAs: 310 Transcripts: ENSRNOT00000014795 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat
D2Rat182
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 27,148,328 - 27,148,557 (+) Marker Load Pipeline mRatBN7.2 2 25,413,423 - 25,413,652 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,837,491 - 23,837,719 NCBI Rnor6.0 Rnor_5.0 2 43,009,380 - 43,009,608 UniSTS Rnor5.0 RGSC_v3.4 2 24,474,447 - 24,474,676 RGD RGSC3.4 RGSC_v3.4 2 24,474,448 - 24,474,676 UniSTS RGSC3.4 RGSC_v3.1 2 24,394,817 - 24,395,045 RGD Celera 2 21,486,419 - 21,486,647 UniSTS RH 3.4 Map 2 13.3 RGD RH 3.4 Map 2 13.3 UniSTS RH 2.0 Map 2 76.4 RGD SHRSP x BN Map 2 6.9998 RGD FHH x ACI Map 2 11.3699 RGD Cytogenetic Map 2 q12 UniSTS
RH128002
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,427,571 - 25,427,771 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,851,639 - 23,851,838 NCBI Rnor6.0 Rnor_5.0 2 43,023,528 - 43,023,727 UniSTS Rnor5.0 RGSC_v3.4 2 24,489,025 - 24,489,224 UniSTS RGSC3.4 Celera 2 21,501,057 - 21,501,256 UniSTS Cytogenetic Map 2 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014795 ⟹ ENSRNOP00000014795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,281,901 - 25,427,950 (+) Ensembl Rnor_6.0 Ensembl 2 23,770,721 - 23,852,021 (+) Ensembl
RefSeq Acc Id:
NM_001106402 ⟹ NP_001099872
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,081,085 - 27,162,859 (+) NCBI mRatBN7.2 2 25,346,171 - 25,427,954 (+) NCBI Rnor_6.0 2 23,770,708 - 23,852,021 (+) NCBI Rnor_5.0 2 42,878,147 - 43,023,911 (+) NCBI RGSC_v3.4 2 24,407,387 - 24,489,407 (+) RGD Celera 2 21,418,069 - 21,501,439 (+) RGD
Sequence:
GTGGTGTTTTTCTAAAGTTGTTCACTGAGGCTTCTCAGCATTGCTGCCAAGATAAACAGGTGAGGCTGCTGGCCGCTGGGACTCAGCACTCCGTATGAATGCCGTCAGCCCGGGATCCAGACCTCACT
hide sequence
RefSeq Acc Id:
XM_017590688 ⟹ XP_017446177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,016,696 - 27,169,830 (+) NCBI mRatBN7.2 2 25,281,776 - 25,428,128 (+) NCBI Rnor_6.0 2 23,705,491 - 23,851,218 (+) NCBI
Sequence:
GGGATGCTGTGTGGCAGCGGCCGGCCTGGGCTGCGAGGTTCGGCCGCCTCCTCCCGCTGCGCCC
hide sequence
RefSeq Acc Id:
XM_017590692 ⟹ XP_017446181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,133,184 - 27,169,830 (+) NCBI mRatBN7.2 2 25,398,288 - 25,428,128 (+) NCBI Rnor_6.0 2 23,821,139 - 23,848,816 (+) NCBI
Sequence:
GTGTCTGTGTGTCTGTGTGTGTCTGTCTAGACAGTGGCACACATCACTGCTTGGGGGGGCACAG
hide sequence
RefSeq Acc Id:
XM_039101908 ⟹ XP_038957836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,133,162 - 27,169,830 (+) NCBI mRatBN7.2 2 25,398,264 - 25,428,128 (+) NCBI
RefSeq Acc Id:
XM_039101909 ⟹ XP_038957837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,136,854 - 27,169,830 (+) NCBI mRatBN7.2 2 25,401,949 - 25,428,128 (+) NCBI
RefSeq Acc Id:
XM_039101911 ⟹ XP_038957839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,016,698 - 27,169,830 (+) NCBI mRatBN7.2 2 25,281,771 - 25,428,128 (+) NCBI
RefSeq Acc Id:
XM_039101912 ⟹ XP_038957840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,137,121 - 27,169,830 (+) NCBI mRatBN7.2 2 25,402,554 - 25,428,128 (+) NCBI
RefSeq Acc Id:
XM_063281486 ⟹ XP_063137556
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,016,404 - 27,067,283 (+) NCBI
RefSeq Acc Id:
XM_063281487 ⟹ XP_063137557
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,021,414 - 27,067,283 (+) NCBI
RefSeq Acc Id:
XM_063281488 ⟹ XP_063137558
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,021,162 - 27,169,830 (+) NCBI
RefSeq Acc Id:
XM_063281489 ⟹ XP_063137559
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,137,280 - 27,169,830 (+) NCBI
RefSeq Acc Id:
NP_001099872 ⟸ NM_001106402
- UniProtKB:
D4A0X7 (UniProtKB/TrEMBL), A6I4W3 (UniProtKB/TrEMBL)
- Sequence:
MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGDEQAGMDSEPHYLGILCLRTPAMQQVPRDTLCGTYAKSFGEIASGFWQATAIFLAMGIFILCVVALVSVFTMCVQSIMRKSIFNV
hide sequence
RefSeq Acc Id:
XP_017446177 ⟸ XM_017590688
- Peptide Label:
isoform X3
- Sequence:
MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGDEQAGMDSEPHYLGILCLRTPAMQQVPRDTLCGTYAKSFGEIASGFWQATAIFLAMGIFILCVVALVSVFTMCVQSIMRKSIFNV
hide sequence
RefSeq Acc Id:
XP_017446181 ⟸ XM_017590692
- Peptide Label:
isoform X3
- UniProtKB:
D4A0X7 (UniProtKB/TrEMBL), A6I4W3 (UniProtKB/TrEMBL)
- Sequence:
MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGDEQAGMDSEPHYLGILCLRTPAMQQVPRDTLCGTYAKSFGEIASGFWQATAIFLAMGIFILCVVALVSVFTMCVQSIMRKSIFNV
hide sequence
Ensembl Acc Id:
ENSRNOP00000014795 ⟸ ENSRNOT00000014795
RefSeq Acc Id:
XP_038957839 ⟸ XM_039101911
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038957836 ⟸ XM_039101908
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038957837 ⟸ XM_039101909
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038957840 ⟸ XM_039101912
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063137556 ⟸ XM_063281486
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063137558 ⟸ XM_063281488
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063137557 ⟸ XM_063281487
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063137559 ⟸ XM_063281489
- Peptide Label:
isoform X3
- UniProtKB:
A6I4W3 (UniProtKB/TrEMBL), D4A0X7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-07-05
Lhfpl2
LHFPL tetraspan subfamily member 2
Lhfpl2
lipoma HMGIC fusion partner-like 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Lhfpl2
lipoma HMGIC fusion partner-like 2
Lhfpl2_predicted
lipoma HMGIC fusion partner-like 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Lhfpl2_predicted
lipoma HMGIC fusion partner-like 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
