Symbol:
Vamp4
Name:
vesicle-associated membrane protein 4
RGD ID:
1309753
Description:
Involved in endosomal transport; regulation of synaptic vesicle endocytosis; and vesicle-mediated transport in synapse. Is active in glutamatergic synapse. Orthologous to human VAMP4 (vesicle associated membrane protein 4); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC364033
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 77,453,135 - 77,475,909 (+) NCBI GRCr8 mRatBN7.2 13 74,919,872 - 74,942,791 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 74,919,880 - 74,933,686 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 77,495,346 - 77,520,525 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 78,802,728 - 78,825,319 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 76,062,597 - 76,085,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 80,460,699 - 80,483,597 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 80,460,694 - 80,483,600 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 85,352,779 - 85,375,559 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 78,247,189 - 78,269,770 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 78,261,180 - 78,280,664 (+) NCBI Celera 13 74,670,256 - 74,692,771 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vamp4 Rat (S)-nicotine increases expression ISO RGD:1320259 6480464 Nicotine results in increased expression of VAMP4 mRNA CTD PMID:17997037 Vamp4 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1320259 6480464 1,2-Dimethylhydrazine results in decreased expression of VAMP4 mRNA CTD PMID:22206623 Vamp4 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1320258 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in increased expression of VAMP4 mRNA CTD PMID:19095052 Vamp4 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1320259 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of VAMP4 mRNA CTD PMID:30294300 Vamp4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1320259 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of VAMP4 mRNA] CTD PMID:15034205 Vamp4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1320259 6480464 Tetrachlorodibenzodioxin results in increased expression of VAMP4 mRNA CTD PMID:15034205 Vamp4 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1320258 6480464 Lactic Acid results in decreased expression of VAMP4 mRNA CTD PMID:30851411 Vamp4 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1320258 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Vamp4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of VAMP4 mRNA CTD PMID:30047161 Vamp4 Rat aflatoxin B1 increases expression ISO RGD:1320259 6480464 Aflatoxin B1 results in increased expression of VAMP4 mRNA CTD PMID:19770486 Vamp4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of VAMP4 mRNA CTD PMID:30047161 Vamp4 Rat arsane multiple interactions ISO RGD:1320258 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat arsenic atom multiple interactions ISO RGD:1320258 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat arsenite(3-) multiple interactions ISO RGD:1320258 6480464 arsenite promotes the reaction [G3BP1 protein binds to VAMP4 mRNA] CTD PMID:32406909 Vamp4 Rat arsenous acid increases expression ISO RGD:1320258 6480464 Arsenic Trioxide results in increased expression of VAMP4 mRNA CTD PMID:20458559 Vamp4 Rat benzo[a]pyrene multiple interactions ISO RGD:1320259 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of VAMP4 mRNA] CTD PMID:15034205 Vamp4 Rat benzo[a]pyrene increases expression ISO RGD:1320259 6480464 Benzo(a)pyrene results in increased expression of VAMP4 mRNA CTD PMID:15034205|PMID:22228805 Vamp4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of VAMP4 mRNA CTD PMID:25181051 Vamp4 Rat bisphenol A decreases expression ISO RGD:1320259 6480464 bisphenol A results in decreased expression of VAMP4 mRNA CTD PMID:33221593 Vamp4 Rat bisphenol A multiple interactions ISO RGD:1320258 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Vamp4 Rat bisphenol F multiple interactions ISO RGD:1320258 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Vamp4 Rat butanal decreases expression ISO RGD:1320258 6480464 butyraldehyde results in decreased expression of VAMP4 mRNA CTD PMID:26079696 Vamp4 Rat cadmium atom multiple interactions ISO RGD:1320258 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VAMP4 more ... CTD PMID:35301059 Vamp4 Rat cadmium dichloride decreases expression ISO RGD:1320258 6480464 Cadmium Chloride results in decreased expression of VAMP4 mRNA CTD PMID:38382870 Vamp4 Rat cadmium dichloride multiple interactions ISO RGD:1320258 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VAMP4 more ... CTD PMID:35301059 Vamp4 Rat carbon nanotube decreases expression ISO RGD:1320259 6480464 Nanotubes, Carbon analog results in decreased expression of VAMP4 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Vamp4 Rat carmustine affects response to substance ISO RGD:1320258 6480464 VAMP4 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Vamp4 Rat CGP 52608 multiple interactions ISO RGD:1320258 6480464 CGP 52608 promotes the reaction [RORA protein binds to VAMP4 gene] CTD PMID:28238834 Vamp4 Rat cisplatin decreases expression ISO RGD:1320258 6480464 Cisplatin results in decreased expression of VAMP4 mRNA CTD PMID:27392435 Vamp4 Rat cobalt dichloride increases expression ISO RGD:1320258 6480464 cobaltous chloride results in increased expression of VAMP4 mRNA CTD PMID:19376846 Vamp4 Rat copper(II) sulfate decreases expression ISO RGD:1320258 6480464 Copper Sulfate results in decreased expression of VAMP4 mRNA CTD PMID:19549813 Vamp4 Rat cyclosporin A increases expression ISO RGD:1320258 6480464 Cyclosporine results in increased expression of VAMP4 mRNA CTD PMID:20106945|PMID:25562108|PMID:27989131 Vamp4 Rat deoxynivalenol increases expression ISO RGD:1320258 6480464 deoxynivalenol results in increased expression of VAMP4 mRNA CTD PMID:23792671 Vamp4 Rat dexamethasone multiple interactions ISO RGD:1320258 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Vamp4 Rat diarsenic trioxide increases expression ISO RGD:1320258 6480464 Arsenic Trioxide results in increased expression of VAMP4 mRNA CTD PMID:20458559 Vamp4 Rat dicrotophos decreases expression ISO RGD:1320258 6480464 dicrotophos results in decreased expression of VAMP4 mRNA CTD PMID:28302478 Vamp4 Rat disodium selenite decreases expression ISO RGD:1320258 6480464 Sodium Selenite results in decreased expression of VAMP4 mRNA CTD PMID:18175754 Vamp4 Rat epoxiconazole increases expression ISO RGD:1320259 6480464 epoxiconazole results in increased expression of VAMP4 mRNA CTD PMID:35436446 Vamp4 Rat ethanol multiple interactions ISO RGD:1320259 6480464 Ethanol affects the expression of and affects the splicing of VAMP4 mRNA CTD PMID:30319688 Vamp4 Rat ethyl methanesulfonate increases expression ISO RGD:1320258 6480464 Ethyl Methanesulfonate results in increased expression of VAMP4 mRNA CTD PMID:23649840 Vamp4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of VAMP4 mRNA CTD PMID:24136188 Vamp4 Rat formaldehyde increases expression ISO RGD:1320258 6480464 Formaldehyde results in increased expression of VAMP4 mRNA CTD PMID:23649840 Vamp4 Rat FR900359 increases phosphorylation ISO RGD:1320258 6480464 FR900359 results in increased phosphorylation of VAMP4 protein CTD PMID:37730182 Vamp4 Rat GSK-J4 increases expression ISO RGD:1320258 6480464 GSK-J4 results in increased expression of VAMP4 mRNA CTD PMID:29301935 Vamp4 Rat hexadecanoic acid multiple interactions ISO RGD:1320258 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of VAMP4 more ... CTD PMID:30547786 Vamp4 Rat indometacin multiple interactions ISO RGD:1320258 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Vamp4 Rat manganese atom multiple interactions ISO RGD:1320258 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat manganese(0) multiple interactions ISO RGD:1320258 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat manganese(II) chloride multiple interactions ISO RGD:1320258 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of VAMP4 mRNA CTD PMID:30467583 Vamp4 Rat methidathion increases expression ISO RGD:1320259 6480464 methidathion results in increased expression of VAMP4 mRNA CTD PMID:34813904 Vamp4 Rat methyl methanesulfonate increases expression ISO RGD:1320258 6480464 Methyl Methanesulfonate results in increased expression of VAMP4 mRNA CTD PMID:23649840 Vamp4 Rat methylazoxymethanol increases expression ISO RGD:1320259 6480464 methylazoxymethanol results in increased expression of VAMP4 mRNA CTD PMID:17107856 Vamp4 Rat methylmercury chloride decreases expression ISO RGD:1320258 6480464 methylmercuric chloride results in decreased expression of VAMP4 mRNA CTD PMID:28001369 Vamp4 Rat niclosamide increases expression ISO RGD:1320258 6480464 Niclosamide results in increased expression of VAMP4 mRNA CTD PMID:36318118 Vamp4 Rat nicotine increases expression ISO RGD:1320259 6480464 Nicotine results in increased expression of VAMP4 mRNA CTD PMID:17997037 Vamp4 Rat oleic acid multiple interactions ISO RGD:1320258 6480464 [Palmitic Acid co-treated with Oleic Acid co-treated with TNF protein] affects the expression of VAMP4 more ... CTD PMID:30547786 Vamp4 Rat pentanal decreases expression ISO RGD:1320258 6480464 pentanal results in decreased expression of VAMP4 mRNA CTD PMID:26079696 Vamp4 Rat phenobarbital affects expression ISO RGD:1320258 6480464 Phenobarbital affects the expression of VAMP4 mRNA CTD PMID:19159669 Vamp4 Rat rac-lactic acid decreases expression ISO RGD:1320258 6480464 Lactic Acid results in decreased expression of VAMP4 mRNA CTD PMID:30851411 Vamp4 Rat silicon dioxide decreases expression ISO RGD:1320259 6480464 Silicon Dioxide results in decreased expression of VAMP4 mRNA CTD PMID:19073995 Vamp4 Rat sodium arsenite decreases expression ISO RGD:1320258 6480464 sodium arsenite results in decreased expression of VAMP4 mRNA CTD PMID:28595984|PMID:34032870 Vamp4 Rat sodium arsenite multiple interactions ISO RGD:1320258 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VAMP4 more ... CTD PMID:39836092 Vamp4 Rat sodium arsenite increases expression ISO RGD:1320258 6480464 sodium arsenite results in increased expression of VAMP4 mRNA CTD PMID:38568856 Vamp4 Rat Soman increases expression EXP 6480464 Soman results in increased expression of VAMP4 mRNA CTD PMID:19281266 Vamp4 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of VAMP4 mRNA CTD PMID:30047161 Vamp4 Rat temozolomide affects response to substance ISO RGD:1320258 6480464 VAMP4 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Vamp4 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of VAMP4 mRNA CTD PMID:23411599 Vamp4 Rat titanium dioxide decreases methylation ISO RGD:1320259 6480464 titanium dioxide results in decreased methylation of VAMP4 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Vamp4 Rat triphenyl phosphate affects expression ISO RGD:1320258 6480464 triphenyl phosphate affects the expression of VAMP4 mRNA CTD PMID:37042841 Vamp4 Rat triptonide affects expression ISO RGD:1320259 6480464 triptonide affects the expression of VAMP4 mRNA CTD PMID:33045310 Vamp4 Rat tunicamycin increases expression ISO RGD:1320258 6480464 Tunicamycin results in increased expression of VAMP4 mRNA CTD PMID:22378314 Vamp4 Rat valproic acid increases expression ISO RGD:1320258 6480464 Valproic Acid results in increased expression of VAMP4 mRNA CTD PMID:29154799 Vamp4 Rat valproic acid affects expression ISO RGD:1320258 6480464 Valproic Acid affects the expression of VAMP4 mRNA CTD PMID:25979313 Vamp4 Rat valproic acid decreases expression ISO RGD:1320258 6480464 Valproic Acid results in decreased expression of VAMP4 mRNA CTD PMID:23179753 Vamp4 Rat valproic acid affects expression ISO RGD:1320259 6480464 Valproic Acid affects the expression of VAMP4 mRNA CTD PMID:17963808 Vamp4 Rat zinc atom decreases expression ISO RGD:1320258 6480464 Zinc deficiency results in decreased expression of VAMP4 mRNA CTD PMID:22171008 Vamp4 Rat zinc(0) decreases expression ISO RGD:1320258 6480464 Zinc deficiency results in decreased expression of VAMP4 mRNA CTD PMID:22171008
Vamp4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 77,453,135 - 77,475,909 (+) NCBI GRCr8 mRatBN7.2 13 74,919,872 - 74,942,791 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 74,919,880 - 74,933,686 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 77,495,346 - 77,520,525 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 78,802,728 - 78,825,319 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 76,062,597 - 76,085,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 80,460,699 - 80,483,597 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 80,460,694 - 80,483,600 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 85,352,779 - 85,375,559 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 78,247,189 - 78,269,770 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 78,261,180 - 78,280,664 (+) NCBI Celera 13 74,670,256 - 74,692,771 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
VAMP4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 171,700,160 - 171,742,065 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 171,700,160 - 171,742,074 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 171,669,300 - 171,711,205 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 169,938,783 - 169,977,837 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 144,778,698 - 144,820,780 (-) NCBI Celera Cytogenetic Map 1 q24.3 NCBI HuRef 1 142,893,046 - 142,935,123 (-) NCBI HuRef CHM1_1 1 173,091,387 - 173,133,527 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 171,056,627 - 171,098,537 (-) NCBI T2T-CHM13v2.0
Vamp4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 162,398,084 - 162,426,651 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 162,398,084 - 162,426,653 (+) Ensembl GRCm39 Ensembl GRCm38 1 162,570,515 - 162,599,082 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 162,570,515 - 162,599,084 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 164,500,959 - 164,529,209 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 164,407,503 - 164,435,753 (+) NCBI MGSCv36 mm8 Celera 1 165,015,226 - 165,045,414 (+) NCBI Celera Cytogenetic Map 1 H2.1 NCBI cM Map 1 70.29 NCBI
Vamp4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 12,223,736 - 12,260,317 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 12,223,736 - 12,260,506 (-) NCBI ChiLan1.0 ChiLan1.0
VAMP4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 78,013,280 - 78,058,507 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 77,687,698 - 77,732,898 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 147,192,001 - 147,233,945 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 150,903,134 - 150,944,815 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 150,903,134 - 150,944,815 (-) Ensembl panpan1.1 panPan2
VAMP4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 27,278,200 - 27,303,499 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 27,278,231 - 27,302,225 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 26,797,085 - 26,827,670 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 27,078,744 - 27,107,216 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 27,051,313 - 27,107,216 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 26,900,757 - 26,958,730 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 26,935,355 - 26,993,045 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 27,207,418 - 27,232,436 (+) NCBI UU_Cfam_GSD_1.0
Vamp4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 97,634,092 - 97,669,945 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 15,480,879 - 15,516,945 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 15,480,865 - 15,515,851 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VAMP4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 114,138,330 - 114,174,979 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 114,138,350 - 114,174,996 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 125,606,175 - 125,638,921 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VAMP4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 57,381,143 - 57,421,886 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 57,384,757 - 57,421,893 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 59,006,290 - 59,051,034 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vamp4
.
Predicted Target Of
Count of predictions: 664 Count of miRNA genes: 249 Interacting mature miRNAs: 341 Transcripts: ENSRNOT00000004243 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 8655951 Rf63 Renal function QTL 63 12.2 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 13 69060519 77046890 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 11530006 Niddm72 Non-insulin dependent diabetes mellitus QTL 72 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 74023918 80753406 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
RH134702
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 74,942,533 - 74,942,730 (+) MAPPER mRatBN7.2 Rnor_6.0 13 80,483,340 - 80,483,536 NCBI Rnor6.0 Rnor_5.0 13 85,375,420 - 85,375,616 UniSTS Rnor5.0 RGSC_v3.4 13 78,269,639 - 78,269,835 UniSTS RGSC3.4 Celera 13 74,692,640 - 74,692,836 UniSTS RH 3.4 Map 13 456.2 UniSTS Cytogenetic Map 13 q22 UniSTS
RH139431
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 74,926,254 - 74,926,403 (+) MAPPER mRatBN7.2 Rnor_6.0 13 80,467,061 - 80,467,209 NCBI Rnor6.0 Rnor_5.0 13 85,359,141 - 85,359,289 UniSTS Rnor5.0 RGSC_v3.4 13 78,253,360 - 78,253,508 UniSTS RGSC3.4 Celera 13 74,676,427 - 74,676,575 UniSTS RH 3.4 Map 13 455.4 UniSTS Cytogenetic Map 13 q22 UniSTS
RH139439
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 74,939,042 - 74,939,287 (+) MAPPER mRatBN7.2 Rnor_6.0 13 80,479,849 - 80,480,093 NCBI Rnor6.0 Rnor_5.0 13 85,371,929 - 85,372,173 UniSTS Rnor5.0 RGSC_v3.4 13 78,266,148 - 78,266,392 UniSTS RGSC3.4 Celera 13 74,689,149 - 74,689,393 UniSTS RH 3.4 Map 13 456.7 UniSTS Cytogenetic Map 13 q22 UniSTS
RH139631
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 74,939,078 - 74,939,287 (+) MAPPER mRatBN7.2 Rnor_6.0 13 80,479,885 - 80,480,093 NCBI Rnor6.0 Rnor_5.0 13 85,371,965 - 85,372,173 UniSTS Rnor5.0 RGSC_v3.4 13 78,266,184 - 78,266,392 UniSTS RGSC3.4 Celera 13 74,689,185 - 74,689,393 UniSTS RH 3.4 Map 13 455.4 UniSTS Cytogenetic Map 13 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004243 ⟹ ENSRNOP00000004243
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 80,460,890 - 80,483,471 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076324 ⟹ ENSRNOP00000068349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 74,919,880 - 74,926,159 (+) Ensembl Rnor_6.0 Ensembl 13 80,464,348 - 80,467,272 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076601
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 80,460,786 - 80,483,600 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076922 ⟹ ENSRNOP00000068049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 74,919,883 - 74,933,686 (+) Ensembl Rnor_6.0 Ensembl 13 80,460,694 - 80,479,449 (+) Ensembl
RefSeq Acc Id:
NM_001108856 ⟹ NP_001102326
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,320 - 77,475,901 (+) NCBI mRatBN7.2 13 74,920,083 - 74,942,665 (+) NCBI Rnor_6.0 13 80,460,890 - 80,483,471 (+) NCBI Rnor_5.0 13 85,352,779 - 85,375,559 (+) NCBI RGSC_v3.4 13 78,247,189 - 78,269,770 (+) RGD Celera 13 74,670,256 - 74,692,771 (+) RGD
Sequence:
CCCCTGCCTACCGCCCCCAACGTCCGCTGGGGCTGGGAGCTGGCCTGCGCGAGGGCCGGGTGGTGGATACTTATTCTGTTGGGAAATACAGCAAGAGTATTTGTGAGCAGAAAGTATGCCTCCCAAGT
hide sequence
RefSeq Acc Id:
XM_006250184 ⟹ XP_006250246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,135 - 77,475,909 (+) NCBI mRatBN7.2 13 74,919,872 - 74,942,673 (+) NCBI Rnor_6.0 13 80,460,699 - 80,483,471 (+) NCBI Rnor_5.0 13 85,352,779 - 85,375,559 (+) NCBI
Sequence:
GGGGCGCTGCAGCAGAGCGGAGCGGTGGCGGGTCTGTGCCCTCGGCCTTCCCCCTCCCACCCTC
hide sequence
RefSeq Acc Id:
XM_006250186 ⟹ XP_006250248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,135 - 77,475,909 (+) NCBI mRatBN7.2 13 74,919,878 - 74,942,791 (+) NCBI Rnor_6.0 13 80,460,707 - 80,483,597 (+) NCBI Rnor_5.0 13 85,352,779 - 85,375,559 (+) NCBI
Sequence:
GCAGCAGAGCGGAGCGGTGGCGGGTCTGTGCCCTCGGCCTTCCCCCTCCCACCCTCCTTCCTCA
hide sequence
RefSeq Acc Id:
XM_039090952 ⟹ XP_038946880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,550 - 77,475,909 (+) NCBI mRatBN7.2 13 74,920,423 - 74,942,673 (+) NCBI
RefSeq Acc Id:
XM_039090953 ⟹ XP_038946881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,135 - 77,466,711 (+) NCBI mRatBN7.2 13 74,919,878 - 74,933,408 (+) NCBI
RefSeq Acc Id:
XM_063272518 ⟹ XP_063128588
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,550 - 77,475,909 (+) NCBI
RefSeq Acc Id:
XR_005492263
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 77,453,135 - 77,475,909 (+) NCBI mRatBN7.2 13 74,919,872 - 74,942,673 (+) NCBI
RefSeq Acc Id:
NP_001102326 ⟸ NM_001108856
- UniProtKB:
A6ID94 (UniProtKB/TrEMBL), A0A096MJ99 (UniProtKB/TrEMBL)
- Sequence:
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILL
hide sequence
RefSeq Acc Id:
XP_006250246 ⟸ XM_006250184
- Peptide Label:
isoform X1
- Sequence:
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVI
hide sequence
RefSeq Acc Id:
XP_006250248 ⟸ XM_006250186
- Peptide Label:
isoform X2
- Sequence:
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALAAAILL
hide sequence
Ensembl Acc Id:
ENSRNOP00000004243 ⟸ ENSRNOT00000004243
Ensembl Acc Id:
ENSRNOP00000068049 ⟸ ENSRNOT00000076922
Ensembl Acc Id:
ENSRNOP00000068349 ⟸ ENSRNOT00000076324
RefSeq Acc Id:
XP_038946881 ⟸ XM_039090953
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038946880 ⟸ XM_039090952
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063128588 ⟸ XM_063272518
- Peptide Label:
isoform X2
RGD ID: 13698949 Promoter ID: EPDNEW_R9465 Type: multiple initiation site Name: Vamp4_1 Description: vesicle-associated membrane protein 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 80,460,691 - 80,460,751 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Vamp4
vesicle-associated membrane protein 4
Vamp4_predicted
vesicle-associated membrane protein 4 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Vamp4_predicted
vesicle-associated membrane protein 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
