Symbol:
Ola1
Name:
Obg-like ATPase 1
RGD ID:
1307982
Description:
Predicted to enable ATP binding activity and ATP hydrolysis activity. Predicted to be involved in ATP metabolic process. Predicted to be located in centrosome and cytosol. Predicted to be active in cytoplasm. Orthologous to human OLA1 (Obg like ATPase 1); INTERACTS WITH 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GTP-binding protein PTD004; LOC296488; MGC156509; PTD004; RGD1307982; similar to RIKEN cDNA 2810409H07
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OLA1 (Obg like ATPase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ola1 (Obg-like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ola1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OLA1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OLA1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ola1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OLA1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OLA1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ola1 (Obg like ATPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ola1 (Obg-like ATPase 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OLA1 (Obg like ATPase 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ola1 (Obg-like ATPase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1354
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
OLA1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YLF2
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ola-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ola1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 78,374,440 - 78,493,401 (-) NCBI GRCr8 mRatBN7.2 3 57,966,896 - 58,085,955 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 57,966,896 - 58,084,480 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 61,359,662 - 61,478,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 69,943,325 - 70,062,547 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 67,708,346 - 67,827,580 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 59,802,007 - 59,920,935 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 59,802,008 - 59,920,935 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 66,275,427 - 66,395,046 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 55,596,308 - 55,715,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 55,492,679 - 55,638,046 (-) NCBI Celera 3 57,503,973 - 57,622,241 (-) NCBI Celera Cytogenetic Map 3 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ola1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1317488 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OLA1 mRNA CTD PMID:22206623 Ola1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:1604016 6480464 Dinitrochlorobenzene binds to OLA1 protein CTD PMID:32991956 Ola1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1317488 6480464 Tetrachlorodibenzodioxin affects the expression of OLA1 mRNA CTD PMID:21570461 Ola1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1604016 6480464 Tetrachlorodibenzodioxin affects the expression of OLA1 mRNA CTD PMID:22574217 Ola1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of OLA1 protein CTD PMID:19954255 Ola1 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1604016 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Ola1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of OLA1 mRNA CTD PMID:30071829 Ola1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1317488 6480464 bisphenol S results in increased expression of OLA1 mRNA CTD PMID:39298647 Ola1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1604016 6480464 bisphenol S results in increased expression of OLA1 protein CTD PMID:34186270 Ola1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1604016 6480464 bisphenol S results in decreased methylation of OLA1 gene CTD PMID:31601247 Ola1 Rat 5-aza-2'-deoxycytidine decreases expression ISO RGD:1604016 6480464 Decitabine results in decreased expression of OLA1 mRNA CTD PMID:19363521 Ola1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO RGD:1604016 6480464 TP53 protein affects the reaction [Decitabine results in decreased expression of OLA1 mRNA] CTD PMID:19363521 Ola1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of OLA1 mRNA CTD PMID:30047161 Ola1 Rat actinomycin D multiple interactions ISO RGD:1604016 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of OLA1 protein CTD PMID:38460933 Ola1 Rat all-trans-retinoic acid increases expression ISO RGD:1604016 6480464 Tretinoin results in increased expression of OLA1 mRNA CTD PMID:23724009 Ola1 Rat all-trans-retinoic acid decreases expression ISO RGD:1604016 6480464 Tretinoin results in decreased expression of OLA1 mRNA CTD PMID:33167477 Ola1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of OLA1 mRNA CTD PMID:30047161 Ola1 Rat aristolochic acid A decreases expression ISO RGD:1604016 6480464 aristolochic acid I results in decreased expression of OLA1 mRNA CTD PMID:33212167 Ola1 Rat aristolochic acid A increases expression ISO RGD:1604016 6480464 aristolochic acid I results in increased expression of OLA1 protein CTD PMID:33212167 Ola1 Rat arsenite(3-) multiple interactions ISO RGD:1604016 6480464 arsenite promotes the reaction [G3BP1 protein binds to OLA1 mRNA] CTD PMID:32406909 Ola1 Rat benzatropine increases expression ISO RGD:1604016 6480464 Benztropine results in increased expression of OLA1 protein CTD PMID:34122009 Ola1 Rat benzo[a]pyrene decreases methylation ISO RGD:1604016 6480464 Benzo(a)pyrene results in decreased methylation of OLA1 5' UTR CTD PMID:27901495 Ola1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1604016 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of OLA1 more ... CTD PMID:33872906 Ola1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OLA1 mRNA CTD PMID:25181051 Ola1 Rat bisphenol A decreases expression ISO RGD:1317488 6480464 bisphenol A results in decreased expression of OLA1 mRNA CTD PMID:33221593 Ola1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OLA1 mRNA CTD PMID:32145629 Ola1 Rat bisphenol AF increases expression ISO RGD:1604016 6480464 bisphenol AF results in increased expression of OLA1 protein CTD PMID:34186270 Ola1 Rat Bisphenol B increases expression ISO RGD:1604016 6480464 bisphenol B results in increased expression of OLA1 protein CTD PMID:34186270 Ola1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of OLA1 protein CTD PMID:28903499 Ola1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of OLA1 mRNA CTD PMID:24136188 Ola1 Rat butanal increases expression ISO RGD:1604016 6480464 butyraldehyde results in increased expression of OLA1 mRNA CTD PMID:26079696 Ola1 Rat carbon nanotube multiple interactions ISO RGD:1604016 6480464 [Nanotubes, Carbon co-treated with calfactant] results in increased expression of OLA1 protein CTD PMID:23026733 Ola1 Rat carbon nanotube increases expression ISO RGD:1317488 6480464 Nanotubes, Carbon analog results in increased expression of OLA1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Ola1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of OLA1 mRNA CTD PMID:17602206 Ola1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of OLA1 mRNA CTD PMID:17602206 Ola1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of OLA1 mRNA CTD PMID:20187946 Ola1 Rat copper(II) sulfate increases expression ISO RGD:1604016 6480464 Copper Sulfate results in increased expression of OLA1 mRNA CTD PMID:19549813 Ola1 Rat dibutyl phthalate decreases expression ISO RGD:1317488 6480464 Dibutyl Phthalate results in decreased expression of OLA1 mRNA CTD PMID:21266533 Ola1 Rat dioxygen multiple interactions ISO RGD:1317488 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of OLA1 mRNA CTD PMID:30529165 Ola1 Rat dorsomorphin multiple interactions ISO RGD:1604016 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Ola1 Rat doxorubicin decreases expression ISO RGD:1604016 6480464 Doxorubicin results in decreased expression of OLA1 mRNA CTD PMID:29803840 Ola1 Rat elemental selenium decreases expression ISO RGD:1604016 6480464 Selenium results in decreased expression of OLA1 mRNA CTD PMID:19244175 Ola1 Rat enzyme inhibitor multiple interactions ISO RGD:1604016 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Ola1 Rat ethanol affects splicing ISO RGD:1317488 6480464 Ethanol affects the splicing of OLA1 mRNA CTD PMID:30319688 Ola1 Rat ethanol increases expression ISO RGD:1317488 6480464 Ethanol results in increased expression of OLA1 mRNA CTD PMID:30319688 Ola1 Rat fenthion increases expression ISO RGD:1317488 6480464 Fenthion results in increased expression of OLA1 mRNA CTD PMID:34813904 Ola1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of OLA1 mRNA CTD PMID:24136188 Ola1 Rat folic acid multiple interactions ISO RGD:1317488 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OLA1 mRNA CTD PMID:22206623 Ola1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of OLA1 gene CTD PMID:22079235 Ola1 Rat furfural multiple interactions ISO RGD:1604016 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ... CTD PMID:38598786 Ola1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of OLA1 mRNA CTD PMID:24136188 Ola1 Rat hydrogen peroxide affects expression ISO RGD:1604016 6480464 Hydrogen Peroxide affects the expression of OLA1 mRNA CTD PMID:20044591 Ola1 Rat inulin multiple interactions ISO RGD:1317488 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OLA1 mRNA CTD PMID:36331819 Ola1 Rat ivermectin decreases expression ISO RGD:1604016 6480464 Ivermectin results in decreased expression of OLA1 protein CTD PMID:32959892 Ola1 Rat lead(0) affects splicing ISO RGD:1604016 6480464 Lead affects the splicing of OLA1 mRNA CTD PMID:28903495 Ola1 Rat methidathion increases expression ISO RGD:1317488 6480464 methidathion results in increased expression of OLA1 mRNA CTD PMID:34813904 Ola1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of OLA1 mRNA CTD PMID:30047161 Ola1 Rat methylmercury chloride decreases expression ISO RGD:1604016 6480464 methylmercuric chloride results in decreased expression of OLA1 mRNA CTD PMID:28001369 Ola1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1604016 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of OLA1 more ... CTD PMID:33872906 Ola1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of OLA1 mRNA CTD PMID:17602206 Ola1 Rat Nutlin-3 multiple interactions ISO RGD:1604016 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of OLA1 protein CTD PMID:38460933 Ola1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of OLA1 mRNA CTD PMID:25729387 Ola1 Rat ozone multiple interactions ISO RGD:1317488 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Ola1 Rat ozone multiple interactions ISO RGD:1604016 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of OLA1 mRNA CTD PMID:35430440 Ola1 Rat panobinostat multiple interactions ISO RGD:1604016 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Ola1 Rat panobinostat decreases expression ISO RGD:1604016 6480464 panobinostat results in decreased expression of OLA1 mRNA CTD PMID:26272509 Ola1 Rat paracetamol affects expression ISO RGD:1317488 6480464 Acetaminophen affects the expression of OLA1 mRNA CTD PMID:17562736 Ola1 Rat pentanal increases expression ISO RGD:1604016 6480464 pentanal results in increased expression of OLA1 mRNA CTD PMID:26079696 Ola1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1317488 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OLA1 mRNA CTD PMID:36331819 Ola1 Rat phenylmercury acetate decreases expression ISO RGD:1604016 6480464 Phenylmercuric Acetate results in decreased expression of OLA1 mRNA CTD PMID:26272509 Ola1 Rat phenylmercury acetate multiple interactions ISO RGD:1604016 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ola1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of OLA1 mRNA CTD PMID:19162173 Ola1 Rat Propiverine affects binding EXP 6480464 propiverine binds to OLA1 protein CTD PMID:29273565 Ola1 Rat quinoline decreases expression ISO RGD:1604016 6480464 quinoline analog results in decreased expression of OLA1 protein CTD PMID:18645022 Ola1 Rat SB 431542 multiple interactions ISO RGD:1604016 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of OLA1 more ... CTD PMID:27188386|PMID:37664457 Ola1 Rat selenium atom decreases expression ISO RGD:1604016 6480464 Selenium results in decreased expression of OLA1 mRNA CTD PMID:19244175 Ola1 Rat sodium arsenite increases expression ISO RGD:1317488 6480464 sodium arsenite results in increased expression of OLA1 protein CTD PMID:29044176 Ola1 Rat sodium chloride multiple interactions ISO RGD:1604016 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ... CTD PMID:38598786 Ola1 Rat sodium fluoride decreases expression ISO RGD:1317488 6480464 Sodium Fluoride results in decreased expression of OLA1 mRNA; Sodium Fluoride results in decreased expression more ... CTD PMID:27862939|PMID:28918527 Ola1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of OLA1 mRNA CTD PMID:30047161 Ola1 Rat sunitinib decreases expression ISO RGD:1604016 6480464 Sunitinib results in decreased expression of OLA1 mRNA CTD PMID:31533062 Ola1 Rat tert-butyl hydroperoxide increases expression ISO RGD:1604016 6480464 tert-Butylhydroperoxide results in increased expression of OLA1 mRNA CTD PMID:15336504 Ola1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of OLA1 protein CTD PMID:35544339 Ola1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of OLA1 mRNA CTD PMID:34492290 Ola1 Rat titanium dioxide decreases methylation ISO RGD:1317488 6480464 titanium dioxide results in decreased methylation of OLA1 gene CTD PMID:35295148 Ola1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of OLA1 mRNA CTD PMID:25729387 Ola1 Rat trichostatin A decreases expression ISO RGD:1604016 6480464 trichostatin A results in decreased expression of OLA1 mRNA CTD PMID:24935251|PMID:26272509 Ola1 Rat trichostatin A multiple interactions ISO RGD:1604016 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Ola1 Rat trimellitic anhydride increases expression ISO RGD:1317488 6480464 trimellitic anhydride results in increased expression of OLA1 mRNA CTD PMID:19042947 Ola1 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of OLA1 mRNA CTD PMID:30589522 Ola1 Rat triptonide decreases expression ISO RGD:1317488 6480464 triptonide results in decreased expression of OLA1 mRNA CTD PMID:33045310 Ola1 Rat valproic acid decreases expression ISO RGD:1604016 6480464 Valproic Acid results in decreased expression of OLA1 mRNA CTD PMID:24383497|PMID:24935251|PMID:26272509 Ola1 Rat valproic acid multiple interactions ISO RGD:1604016 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dimethoxyphenol (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) Brodifacoum (EXP) buspirone (EXP) butanal (ISO) carbon nanotube (ISO) clofibric acid (EXP) cocaine (EXP) copper(II) sulfate (ISO) dibutyl phthalate (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) furfural (ISO) glafenine (EXP) hydrogen peroxide (ISO) inulin (ISO) ivermectin (ISO) lead(0) (ISO) methidathion (ISO) methimazole (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-nitrosodiethylamine (EXP) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) panobinostat (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (EXP) Propiverine (EXP) quinoline (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) triptonide (ISO) valproic acid (ISO)
Ola1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 78,374,440 - 78,493,401 (-) NCBI GRCr8 mRatBN7.2 3 57,966,896 - 58,085,955 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 57,966,896 - 58,084,480 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 61,359,662 - 61,478,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 69,943,325 - 70,062,547 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 67,708,346 - 67,827,580 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 59,802,007 - 59,920,935 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 59,802,008 - 59,920,935 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 66,275,427 - 66,395,046 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 55,596,308 - 55,715,568 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 55,492,679 - 55,638,046 (-) NCBI Celera 3 57,503,973 - 57,622,241 (-) NCBI Celera Cytogenetic Map 3 q23 NCBI
OLA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 174,072,447 - 174,248,532 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 174,072,447 - 174,248,599 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 174,937,175 - 175,113,260 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 174,645,421 - 174,821,611 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 168,550,691 - 168,726,869 (-) NCBI Celera Cytogenetic Map 2 q31.1 NCBI HuRef 2 166,816,707 - 166,992,907 (-) NCBI HuRef CHM1_1 2 174,944,205 - 175,120,008 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 174,558,800 - 174,736,966 (-) NCBI T2T-CHM13v2.0
Ola1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 72,923,145 - 73,044,791 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 72,923,145 - 73,049,268 (-) Ensembl GRCm39 Ensembl GRCm38 2 73,092,801 - 73,214,447 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 73,092,801 - 73,218,924 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 72,930,858 - 73,052,504 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 72,893,640 - 73,015,286 (-) NCBI MGSCv36 mm8 Celera 2 74,779,299 - 74,901,014 (-) NCBI Celera Cytogenetic Map 2 C3 NCBI cM Map 2 43.35 NCBI
Ola1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 1,086,385 - 1,242,368 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 1,086,385 - 1,240,523 (+) NCBI ChiLan1.0 ChiLan1.0
OLA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 76,739,702 - 76,913,281 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 76,754,676 - 76,927,955 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 61,349,811 - 61,525,617 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 178,809,783 - 178,982,725 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 178,809,783 - 178,981,763 (-) Ensembl panpan1.1 panPan2
OLA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 18,178,239 - 18,340,284 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 18,178,511 - 18,360,446 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 18,185,540 - 18,349,204 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 18,309,355 - 18,473,115 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 18,300,144 - 18,473,152 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 18,389,254 - 18,552,939 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 18,387,624 - 18,551,288 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 18,491,741 - 18,661,839 (-) NCBI UU_Cfam_GSD_1.0
Ola1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 135,347,755 - 135,500,062 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936509 3,901,511 - 4,052,319 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936509 3,901,657 - 4,053,964 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OLA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 80,078,924 - 80,253,741 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 80,081,568 - 80,253,776 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 89,391,951 - 89,461,914 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OLA1
Ola1
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 30 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000026040 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1582249 Bw77 Body weight QTL 77 3.2 0.0025 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 64655484 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 61377 Edpm3 Estrogen-dependent pituitary mass QTL 3 7.05 0.038 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 53184692 89878207 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
RH134409
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 57,967,113 - 57,967,311 (+) MAPPER mRatBN7.2 Rnor_6.0 3 59,802,225 - 59,802,422 NCBI Rnor6.0 Rnor_5.0 3 66,275,645 - 66,275,842 UniSTS Rnor5.0 RGSC_v3.4 3 55,596,526 - 55,596,723 UniSTS RGSC3.4 Celera 3 57,504,191 - 57,504,388 UniSTS Cytogenetic Map 3 q22 UniSTS
RH142333
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 78,374,523 - 78,374,680 (+) Marker Load Pipeline mRatBN7.2 3 57,966,978 - 57,967,136 (+) MAPPER mRatBN7.2 Rnor_6.0 3 59,802,090 - 59,802,247 NCBI Rnor6.0 Rnor_5.0 3 66,275,510 - 66,275,667 UniSTS Rnor5.0 RGSC_v3.4 3 55,596,391 - 55,596,548 UniSTS RGSC3.4 Celera 3 57,504,056 - 57,504,213 UniSTS Cytogenetic Map 3 q22 UniSTS
RH142679
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 58,077,818 - 58,078,108 (+) MAPPER mRatBN7.2 Rnor_6.0 3 59,912,887 - 59,913,176 NCBI Rnor6.0 Rnor_5.0 3 66,386,998 - 66,387,287 UniSTS Rnor5.0 RGSC_v3.4 3 55,707,520 - 55,707,809 UniSTS RGSC3.4 Celera 3 57,614,223 - 57,614,512 UniSTS Cytogenetic Map 3 q22 UniSTS
RH143639
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 57,966,994 - 57,967,119 (+) MAPPER mRatBN7.2 Rnor_6.0 3 59,802,106 - 59,802,230 NCBI Rnor6.0 Rnor_5.0 3 66,275,526 - 66,275,650 UniSTS Rnor5.0 RGSC_v3.4 3 55,596,407 - 55,596,531 UniSTS RGSC3.4 Celera 3 57,504,072 - 57,504,196 UniSTS Cytogenetic Map 3 q22 UniSTS
AU047449
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 58,071,037 - 58,071,188 (+) MAPPER mRatBN7.2 Rnor_6.0 3 59,906,107 - 59,906,257 NCBI Rnor6.0 Rnor_5.0 3 66,380,218 - 66,380,368 UniSTS Rnor5.0 RGSC_v3.4 3 55,700,740 - 55,700,890 UniSTS RGSC3.4 Celera 3 57,607,443 - 57,607,593 UniSTS Cytogenetic Map 3 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026040 ⟹ ENSRNOP00000026040
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 57,966,896 - 58,084,480 (-) Ensembl Rnor_6.0 Ensembl 3 59,802,008 - 59,920,935 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094817 ⟹ ENSRNOP00000082362
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 57,966,899 - 58,084,480 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114936 ⟹ ENSRNOP00000084022
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 57,967,306 - 58,084,480 (-) Ensembl
RefSeq Acc Id:
NM_001033927 ⟹ NP_001029099
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 78,374,440 - 78,493,401 (-) NCBI mRatBN7.2 3 57,966,896 - 58,085,869 (-) NCBI Rnor_6.0 3 59,802,007 - 59,920,935 (-) NCBI Rnor_5.0 3 66,275,427 - 66,395,046 (-) NCBI RGSC_v3.4 3 55,596,308 - 55,715,568 (-) RGD Celera 3 57,503,973 - 57,622,241 (-) RGD
Sequence:
ACCTCCGGCTGCCGGCGACACCGGTCTTTGCAGTCTGGGACCCCGTGCGATCTTTAGCCCGGTGCACGATGCCCCCGAAAAAGGGAGGAGATGGACTTAAACCGCCTCCGATCATTGGAAGGTTTGGA
hide sequence
RefSeq Acc Id:
NP_001029099 ⟸ NM_001033927
- UniProtKB:
A0JPJ7 (UniProtKB/Swiss-Prot), A6HM82 (UniProtKB/TrEMBL)
- Sequence:
MPPKKGGDGLKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQCHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFE
hide sequence
Ensembl Acc Id:
ENSRNOP00000026040 ⟸ ENSRNOT00000026040
Ensembl Acc Id:
ENSRNOP00000082362 ⟸ ENSRNOT00000094817
Ensembl Acc Id:
ENSRNOP00000084022 ⟸ ENSRNOT00000114936
RGD ID: 13692142 Promoter ID: EPDNEW_R2667 Type: multiple initiation site Name: Ola1_1 Description: Obg-like ATPase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 59,920,945 - 59,921,005 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-26
Ola1
Obg-like ATPase 1
RGD1307982
similar to RIKEN cDNA 2810409H07
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1307982
similar to RIKEN cDNA 2810409H07
RGD1307982_predicted
similar to RIKEN cDNA 2810409H07 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307982_predicted
similar to RIKEN cDNA 2810409H07 (predicted)
LOC296488_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC296488_predicted
similar to RIKEN cDNA 2810409H07 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
