Advanced Search (OLGA)

Gene: Ola1 (Obg-like ATPase 1) Rattus norvegicus

Analyze

Symbol:

Ola1

Name:

Obg-like ATPase 1

RGD ID:

1307982

Description:

Predicted to enable ATP binding activity and ATP hydrolysis activity. Predicted to be involved in ATP metabolic process. Predicted to be located in centrosome and cytosol. Predicted to be active in cytoplasm. Orthologous to human OLA1 (Obg like ATPase 1); INTERACTS WITH 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GTP-binding protein PTD004; LOC296488; MGC156509; PTD004; RGD1307982; similar to RIKEN cDNA 2810409H07

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OLA1 (Obg like ATPase 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ola1 (Obg-like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ola1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OLA1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OLA1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ola1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OLA1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OLA1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ola1 (Obg like ATPase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ola1 (Obg-like ATPase 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OLA1 (Obg like ATPase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ola1 (Obg-like ATPase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1354	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OLA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YLF2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ola-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ola1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	78,374,440 - 78,493,401 (-)	NCBI		GRCr8
mRatBN7.2	3	57,966,896 - 58,085,955 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	57,966,896 - 58,084,480 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,359,662 - 61,478,892 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	69,943,325 - 70,062,547 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	67,708,346 - 67,827,580 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	59,802,007 - 59,920,935 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	59,802,008 - 59,920,935 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,275,427 - 66,395,046 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	55,596,308 - 55,715,568 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,492,679 - 55,638,046 (-)	NCBI
Celera	3	57,503,973 - 57,622,241 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

prostate cancer (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dimethoxyphenol (ISO)

3,4-methylenedioxymethamphetamine (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

Brodifacoum (EXP)

buspirone (EXP)

butanal (ISO)

carbon nanotube (ISO)

clofibric acid (EXP)

cocaine (EXP)

copper(II) sulfate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

furfural (ISO)

glafenine (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

ivermectin (ISO)

lead(0) (ISO)

methidathion (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

Propiverine (EXP)

quinoline (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP metabolic process (ISO)

Cellular Component

centrosome (ISO)

cytoplasm (IBA,ISO)

cytosol (ISO)

nucleolus (IEA)

Molecular Function

ATP binding (IEA,ISO)

ATP hydrolysis activity (IBA,IEA,ISO)

GTP binding (IEA)

metal ion binding (IEA)

protein binding (ISO)

ribosomal large subunit binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1639225	PMID:8889548	PMID:12060780	PMID:12477932	PMID:12947022	PMID:15489334	PMID:17430889	PMID:19056867	PMID:19946888	PMID:20458337	PMID:23376485	PMID:25468996
PMID:31505169

Genomics

Comparative Map Data

Ola1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	78,374,440 - 78,493,401 (-)	NCBI		GRCr8
mRatBN7.2	3	57,966,896 - 58,085,955 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	57,966,896 - 58,084,480 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,359,662 - 61,478,892 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	69,943,325 - 70,062,547 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	67,708,346 - 67,827,580 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	59,802,007 - 59,920,935 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	59,802,008 - 59,920,935 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,275,427 - 66,395,046 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	55,596,308 - 55,715,568 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,492,679 - 55,638,046 (-)	NCBI
Celera	3	57,503,973 - 57,622,241 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

OLA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	174,072,447 - 174,248,532 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	174,072,447 - 174,248,599 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	174,937,175 - 175,113,260 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	174,645,421 - 174,821,611 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	168,550,691 - 168,726,869 (-)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	166,816,707 - 166,992,907 (-)	NCBI		HuRef
CHM1_1	2	174,944,205 - 175,120,008 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	174,558,800 - 174,736,966 (-)	NCBI		T2T-CHM13v2.0

Ola1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	72,923,145 - 73,044,791 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	72,923,145 - 73,049,268 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	73,092,801 - 73,214,447 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	73,092,801 - 73,218,924 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	72,930,858 - 73,052,504 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	72,893,640 - 73,015,286 (-)	NCBI		MGSCv36	mm8
Celera	2	74,779,299 - 74,901,014 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	43.35	NCBI

Ola1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	1,086,385 - 1,242,368 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	1,086,385 - 1,240,523 (+)	NCBI	ChiLan1.0	ChiLan1.0

OLA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	76,739,702 - 76,913,281 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	76,754,676 - 76,927,955 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	61,349,811 - 61,525,617 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	178,809,783 - 178,982,725 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	178,809,783 - 178,981,763 (-)	Ensembl	panpan1.1		panPan2

OLA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	18,178,239 - 18,340,284 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	18,178,511 - 18,360,446 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	18,185,540 - 18,349,204 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	18,309,355 - 18,473,115 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	18,300,144 - 18,473,152 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	18,389,254 - 18,552,939 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	18,387,624 - 18,551,288 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	18,491,741 - 18,661,839 (-)	NCBI		UU_Cfam_GSD_1.0

Ola1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	135,347,755 - 135,500,062 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	3,901,511 - 4,052,319 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	3,901,657 - 4,053,964 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OLA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	80,078,924 - 80,253,741 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	80,081,568 - 80,253,776 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	89,391,951 - 89,461,914 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OLA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	59,589,475 - 59,766,259 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	139,824,794 - 139,993,850 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ola1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	11,298,505 - 11,482,540 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	11,298,506 - 11,484,085 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	33
Count of miRNA genes:	30
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000026040
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	85062403	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

RH134409

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	57,967,113 - 57,967,311 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	59,802,225 - 59,802,422	NCBI	Rnor6.0
Rnor_5.0	3	66,275,645 - 66,275,842	UniSTS	Rnor5.0
RGSC_v3.4	3	55,596,526 - 55,596,723	UniSTS	RGSC3.4
Celera	3	57,504,191 - 57,504,388	UniSTS
Cytogenetic Map	3	q22	UniSTS

RH142333

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	78,374,523 - 78,374,680 (+)	Marker Load Pipeline
mRatBN7.2	3	57,966,978 - 57,967,136 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	59,802,090 - 59,802,247	NCBI	Rnor6.0
Rnor_5.0	3	66,275,510 - 66,275,667	UniSTS	Rnor5.0
RGSC_v3.4	3	55,596,391 - 55,596,548	UniSTS	RGSC3.4
Celera	3	57,504,056 - 57,504,213	UniSTS
Cytogenetic Map	3	q22	UniSTS

RH142679

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	58,077,818 - 58,078,108 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	59,912,887 - 59,913,176	NCBI	Rnor6.0
Rnor_5.0	3	66,386,998 - 66,387,287	UniSTS	Rnor5.0
RGSC_v3.4	3	55,707,520 - 55,707,809	UniSTS	RGSC3.4
Celera	3	57,614,223 - 57,614,512	UniSTS
Cytogenetic Map	3	q22	UniSTS

RH143639

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	57,966,994 - 57,967,119 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	59,802,106 - 59,802,230	NCBI	Rnor6.0
Rnor_5.0	3	66,275,526 - 66,275,650	UniSTS	Rnor5.0
RGSC_v3.4	3	55,596,407 - 55,596,531	UniSTS	RGSC3.4
Celera	3	57,504,072 - 57,504,196	UniSTS
Cytogenetic Map	3	q22	UniSTS

AU047449

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	58,071,037 - 58,071,188 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	59,906,107 - 59,906,257	NCBI	Rnor6.0
Rnor_5.0	3	66,380,218 - 66,380,368	UniSTS	Rnor5.0
RGSC_v3.4	3	55,700,740 - 55,700,890	UniSTS	RGSC3.4
Celera	3	57,607,443 - 57,607,593	UniSTS
Cytogenetic Map	3	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001033927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG664368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB608471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB782771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK478110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK845210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV119424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV797114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U21721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026040 ⟹ ENSRNOP00000026040

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	57,966,896 - 58,084,480 (-)	Ensembl
Rnor_6.0 Ensembl	3	59,802,008 - 59,920,935 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094817 ⟹ ENSRNOP00000082362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	57,966,899 - 58,084,480 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114936 ⟹ ENSRNOP00000084022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	57,967,306 - 58,084,480 (-)	Ensembl

RefSeq Acc Id:

NM_001033927 ⟹ NP_001029099

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	78,374,440 - 78,493,401 (-)	NCBI
mRatBN7.2	3	57,966,896 - 58,085,869 (-)	NCBI
Rnor_6.0	3	59,802,007 - 59,920,935 (-)	NCBI
Rnor_5.0	3	66,275,427 - 66,395,046 (-)	NCBI
RGSC_v3.4	3	55,596,308 - 55,715,568 (-)	RGD
Celera	3	57,503,973 - 57,622,241 (-)	RGD

Sequence:

show sequence

ACCTCCGGCTGCCGGCGACACCGGTCTTTGCAGTCTGGGACCCCGTGCGATCTTTAGCCCGGTG
CACGATGCCCCCGAAAAAGGGAGGAGATGGACTTAAACCGCCTCCGATCATTGGAAGGTTTGGA
ACCTCACTGAAAATTGGTATTGTTGGATTGCCAAATGTTGGGAAGTCTACCTTCTTCAATGTGT
TAACCAATAGTCAGGCCTCAGCAGAAAACTTCCCTTTCTGCACTATTGACCCTAACGAGAGCAG
AGTGCCTGTGCCAGACGAGAGGTTTGACTTCCTTTGCCAGTGTCACAAGCCAGCAAGCAAGATT
CCTGCTTTCCTTAATGTAGTGGATATTGCTGGCCTTGTGAAAGGAGCTCACAATGGGCAGGGTT
TGGGGAATGCCTTTTTATCTCATATTAGTGCCTGTGATGGGATTTTTCATCTAACGCGTGCTTT
TGAAGATGATGATATCACACACGTTGAAGGAAGTGTAGATCCCATTCGAGATATAGAAATCATT
CATGAAGAGCTTCAGCTGAAAGATGAGGAAATGATTGGGCCCATTATAGATAAACTAGAGAAGG
TGGCCGTGAGAGGCGGTGATAAGAAACTAAAGCCCGAATATGACATAATGTGCAAAGTCAAGTC
TTGGGTTATAGATCAAAAGAAACCTGTTCGCTTCTATCATGACTGGAATGACAAGGAGATTGAA
GTGTTGAATAAACACTTACTTTTGACTTCCAAACCAATGGTCTACTTGGTGAACCTTTCAGAAA
AAGACTACATAAGAAAGAAAAACAAGTGGTTGATAAAAATTAAAGAGTGGGTGGACAAGTCTGA
CCCAGGCGCCTTGGTCATTCCTTTTAGTGGGGCCTTGGAACTCAAGTTGCAAGAATTGAGTGCT
GAGGAGAGACAGAAGTATCTGGAAGCGAACATGACACAAAGTGCTCTGCCAAAGATCATTAAGG
CTGGATTTGCAGCACTCCAACTAGAATACTTTTTCACTGCAGGCCCAGATGAAGTGCGTGCGTG
GACCATCAGGAAAGGAACGAAGGCTCCTCAGGCTGCAGGAAAGATTCACACCGATTTTGAAAAG
GGATTCATTATGGCAGAAGTAATGAAGTACGACGACTTTAAAGATGAGGGCTCTGAGAATGCAG
TCAAGGCTGCTGGAAAATACAGACAGCAAGGGAGGAATTATATTGTTGAAGATGGAGATATTAT
CTTCTTCAAATTTAATACACCTCAGCAATCAAAAAAGAAATAAATCTAGTTATCACCCAGATCG
ACATACAGCTTCTAAAATGCATATATTGGGTTTGGGGGGAAGGGGTTGTTTTTTAAATTAAAGT
TTCTGAAATCTAAAGAGACAGTTAGGAGTGGAAATCTTCTACAAACAAATTATTTTTTATTTGT
TTTAAAATTATAAGCTACTCTGTACCTTCAATGAAATGCAAGTTACTAAGCGTGAACGGCTTTG
CTTTTTCACGTGATTAAGACCCTACTTCAAACTGTAGAAGCTTTTCAAGAGCCATATTACTCTC
CTGATACTTCATTAATCTCCATCATGTATGCCAAGCCTGACACATGTGACAGAGAAGACAATGT
GGCTTGCTCCTTTTTGAATCTAAAGATAATGCATGTTTTACAGTACTCCAGATGTCTACACTCA
ATAAAACATTTGACAAAACCAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001029099	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A0JPJ7	(Get FASTA)	NCBI Sequence Viewer
	AAI27458	(Get FASTA)	NCBI Sequence Viewer
	EDL79133	(Get FASTA)	NCBI Sequence Viewer
	EDL79134	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026040.4
	ENSRNOP00000082362.1
	ENSRNOP00000084022.1
	ENSRNOP00055031855
	ENSRNOP00060003144
	ENSRNOP00065022937

RefSeq Acc Id:

NP_001029099 ⟸ NM_001033927

- UniProtKB:

A0JPJ7 (UniProtKB/Swiss-Prot), A6HM82 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPPKKGGDGLKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRV
PVPDERFDFLCQCHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFE
DDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSW
VIDQKKPVRFYHDWNDKEIEVLNKHLLLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKSDP
GALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWT
IRKGTKAPQAAGKIHTDFEKGFIMAEVMKYDDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIF
FKFNTPQQSKKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000026040 ⟸ ENSRNOT00000026040

Ensembl Acc Id:

ENSRNOP00000082362 ⟸ ENSRNOT00000094817

Ensembl Acc Id:

ENSRNOP00000084022 ⟸ ENSRNOT00000114936

Protein Domains

OBG-type G TGS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0JPJ7-F1-model_v2	AlphaFold	A0JPJ7	1-396	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692142

Promoter ID:

EPDNEW_R2667

Type:

multiple initiation site

Name:

Ola1_1

Description:

Obg-like ATPase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	59,920,945 - 59,921,005	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307982	AgrOrtholog
BioCyc Gene	G2FUF-49378	BioCyc
Ensembl Genes	ENSRNOG00000019047	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055022850	UniProtKB/Swiss-Prot
	ENSRNOG00060002766	UniProtKB/Swiss-Prot
	ENSRNOG00065017348	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026040.6	UniProtKB/Swiss-Prot
	ENSRNOT00000094817.1	UniProtKB/TrEMBL
	ENSRNOT00000114936.1	UniProtKB/TrEMBL
	ENSRNOT00055039271	UniProtKB/Swiss-Prot
	ENSRNOT00060004449	UniProtKB/Swiss-Prot
	ENSRNOT00065028971	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.150.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.10.20.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8363318	IMAGE-MGC_LOAD
InterPro	ATPase_YchF/OLA1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Beta-grasp_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_OBG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GTP-bd	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGS-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGS-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	YchF_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	YchF_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:296488	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156509	IMAGE-MGC_LOAD
NCBI Gene	296488	ENTREZGENE
PANTHER	OBG GTPASE FAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OBG-LIKE ATPASE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MMR_HSR1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	YchF-GTPase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ola1	PhenoGen
PIRSF	CHP00092	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	GTP1OBG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_OBG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019047	RatGTEx
	ENSRNOG00055022850	RatGTEx
	ENSRNOG00060002766	RatGTEx
	ENSRNOG00065017348	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF81271	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZUT1_RAT	UniProtKB/TrEMBL
	A0A8I5ZYJ5_RAT	UniProtKB/TrEMBL
	A0JPJ7	ENTREZGENE
	A6HM82	ENTREZGENE, UniProtKB/TrEMBL
	OLA1_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Ola1	Obg-like ATPase 1	RGD1307982	similar to RIKEN cDNA 2810409H07	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307982	similar to RIKEN cDNA 2810409H07	RGD1307982_predicted	similar to RIKEN cDNA 2810409H07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307982_predicted	similar to RIKEN cDNA 2810409H07 (predicted)	LOC296488_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC296488_predicted	similar to RIKEN cDNA 2810409H07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar