Symbol:
Kdm4c
Name:
lysine demethylase 4C
RGD ID:
1307528
Description:
Enables chromatin binding activity. Involved in positive regulation of gene expression and positive regulation of neuron differentiation. Located in chromatin. Human ortholog(s) of this gene implicated in autistic disorder; breast cancer; carcinoma (multiple); head and neck cancer; and withdrawal disorder. Orthologous to human KDM4C (lysine demethylase 4C); PARTICIPATES IN histone modification pathway; INTERACTS WITH bisphenol A; C60 fullerene; Cuprizon.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Jmjd2c; jumonji domain containing 2C; LOC108348059; LOC298144; lysine (K)-specific demethylase 4C; lysine-specific demethylase 4C; lysine-specific demethylase 4C-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 93,146,404 - 93,353,040 (+) NCBI GRCr8 mRatBN7.2 5 88,100,710 - 88,306,821 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 88,100,733 - 88,306,818 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 90,550,808 - 90,743,411 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 92,379,831 - 92,572,427 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 92,361,586 - 92,554,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 90,800,139 - 91,012,662 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 90,800,082 - 91,012,659 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 94,858,214 - 95,061,170 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 92,079,908 - 92,288,809 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 92,086,392 - 92,293,919 (+) NCBI Celera 5 86,814,234 - 87,010,862 (+) NCBI Celera Cytogenetic Map 5 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdm4c Rat (-)-epigallocatechin 3-gallate multiple interactions ISO KDM4C (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KDM4C mRNA CTD PMID:22079256 Kdm4c Rat (1->4)-beta-D-glucan multiple interactions ISO Kdm4c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KDM4C mRNA CTD PMID:36331819 Kdm4c Rat 1,2-dimethylhydrazine decreases expression ISO Kdm4c (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KDM4C mRNA CTD PMID:22206623 Kdm4c Rat 1,2-dimethylhydrazine multiple interactions ISO Kdm4c (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of KDM4C mRNA] CTD PMID:22206623 Kdm4c Rat 1,2-phenylenediamine affects response to substance ISO KDM4C (Homo sapiens) 6480464 KDM4C gene SNP affects the susceptibility to 1 and 2-diaminobenzene CTD PMID:25622337 Kdm4c Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO Kdm4c (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Kdm4c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kdm4c (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of JMJD2C mRNA CTD PMID:21570461 Kdm4c Rat 4,4'-sulfonyldiphenol affects methylation ISO Kdm4c (Mus musculus) 6480464 bisphenol S affects the methylation of KDM4C gene CTD PMID:31683443 Kdm4c Rat acrolein multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KDM4C mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of KDM4C mRNA CTD PMID:32699268 Kdm4c Rat aflatoxin B1 affects expression ISO KDM4C (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of KDM4C protein CTD PMID:20106945 Kdm4c Rat aflatoxin B1 decreases expression ISO KDM4C (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of KDM4C mRNA CTD PMID:22100608 Kdm4c Rat all-trans-retinoic acid increases expression ISO KDM4C (Homo sapiens) 6480464 Tretinoin results in increased expression of KDM4C mRNA CTD PMID:33167477 Kdm4c Rat alpha-pinene multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KDM4C mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of KDM4C mRNA CTD PMID:32699268 Kdm4c Rat aristolochic acid A decreases expression ISO KDM4C (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KDM4C mRNA CTD PMID:33212167 Kdm4c Rat atrazine decreases expression ISO KDM4C (Homo sapiens) 6480464 Atrazine results in decreased expression of KDM4C mRNA CTD PMID:22378314 Kdm4c Rat belinostat increases expression ISO KDM4C (Homo sapiens) 6480464 belinostat results in increased expression of KDM4C mRNA CTD PMID:27188386 Kdm4c Rat benzo[a]pyrene decreases expression ISO KDM4C (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of JMJD2C mRNA and Benzo(a)pyrene results in decreased expression of KDM4C mRNA CTD PMID:20064835 more ... Kdm4c Rat benzo[a]pyrene affects methylation ISO KDM4C (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KDM4C intron CTD PMID:30157460 Kdm4c Rat benzo[a]pyrene diol epoxide I decreases expression ISO KDM4C (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Kdm4c Rat bis(2-chloroethyl) sulfide decreases expression ISO Kdm4c (Mus musculus) 6480464 Mustard Gas results in decreased expression of KDM4C mRNA CTD PMID:26392148 Kdm4c Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KDM4C mRNA CTD PMID:34947998 Kdm4c Rat bisphenol A affects methylation ISO KDM4C (Homo sapiens) 6480464 bisphenol A affects the methylation of KDM4C gene CTD PMID:31601247 Kdm4c Rat butanal decreases expression ISO KDM4C (Homo sapiens) 6480464 butyraldehyde results in decreased expression of KDM4C mRNA CTD PMID:26079696 Kdm4c Rat C60 fullerene affects expression EXP 6480464 fullerene C60 affects the expression of KDM4C mRNA CTD PMID:19167457 Kdm4c Rat cadmium dichloride decreases expression ISO KDM4C (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KDM4C mRNA CTD PMID:38382870 Kdm4c Rat caffeine affects phosphorylation ISO KDM4C (Homo sapiens) 6480464 Caffeine affects the phosphorylation of KDM4C protein CTD PMID:35688186 Kdm4c Rat carbon nanotube decreases expression ISO Kdm4c (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of KDM4C mRNA CTD PMID:25554681 Kdm4c Rat chlorpyrifos increases expression ISO Kdm4c (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KDM4C mRNA CTD PMID:37019170 Kdm4c Rat cisplatin decreases expression ISO KDM4C (Homo sapiens) 6480464 Cisplatin results in decreased expression of KDM4C mRNA CTD PMID:24280081 and PMID:27594783 Kdm4c Rat cisplatin multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KDM4C mRNA CTD PMID:27392435 Kdm4c Rat cisplatin decreases expression ISO Kdm4c (Mus musculus) 6480464 Cisplatin results in decreased expression of KDM4C mRNA CTD PMID:24280081 Kdm4c Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of KDM4C mRNA CTD PMID:27523638 Kdm4c Rat diuron increases expression EXP 6480464 Diuron results in increased expression of KDM4C mRNA CTD PMID:25152437 Kdm4c Rat dorsomorphin multiple interactions ISO KDM4C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kdm4c Rat doxorubicin decreases expression ISO KDM4C (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KDM4C mRNA CTD PMID:29803840 Kdm4c Rat folic acid multiple interactions ISO Kdm4c (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of KDM4C mRNA] CTD PMID:22206623 Kdm4c Rat folic acid decreases expression ISO Kdm4c (Mus musculus) 6480464 Folic Acid results in decreased expression of KDM4C mRNA CTD PMID:25629700 Kdm4c Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KDM4C mRNA CTD PMID:33387578 Kdm4c Rat nitric oxide increases expression ISO KDM4C (Homo sapiens) 6480464 Nitric Oxide results in increased expression of KDM4C mRNA CTD PMID:23546878 Kdm4c Rat ozone multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of KDM4C mRNA more ... CTD PMID:32699268 Kdm4c Rat paracetamol decreases expression ISO KDM4C (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KDM4C mRNA CTD PMID:22230336 Kdm4c Rat pentanal decreases expression ISO KDM4C (Homo sapiens) 6480464 pentanal results in decreased expression of KDM4C mRNA CTD PMID:26079696 Kdm4c Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Kdm4c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of KDM4C mRNA CTD PMID:36331819 Kdm4c Rat phenylmercury acetate increases expression ISO KDM4C (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of KDM4C mRNA CTD PMID:26272509 Kdm4c Rat phenylmercury acetate multiple interactions ISO KDM4C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KDM4C mRNA CTD PMID:27188386 Kdm4c Rat potassium chromate decreases expression ISO KDM4C (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of KDM4C mRNA CTD PMID:22079256 Kdm4c Rat potassium chromate multiple interactions ISO KDM4C (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KDM4C mRNA CTD PMID:22079256 Kdm4c Rat potassium dichromate decreases expression ISO Kdm4c (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of JMJD2C mRNA CTD PMID:23608068 Kdm4c Rat resveratrol multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of KDM4C mRNA CTD PMID:23557933 Kdm4c Rat SB 431542 multiple interactions ISO KDM4C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kdm4c Rat sodium arsenite decreases expression ISO KDM4C (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KDM4C mRNA CTD PMID:32844245 Kdm4c Rat sodium arsenite increases expression ISO KDM4C (Homo sapiens) 6480464 sodium arsenite results in increased expression of KDM4C mRNA CTD PMID:38568856 Kdm4c Rat succimer multiple interactions ISO KDM4C (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of KDM4C mRNA CTD PMID:26378955 Kdm4c Rat sunitinib increases expression ISO KDM4C (Homo sapiens) 6480464 Sunitinib results in increased expression of KDM4C mRNA CTD PMID:31533062 Kdm4c Rat titanium dioxide decreases methylation ISO Kdm4c (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KDM4C gene CTD PMID:35295148 Kdm4c Rat trichostatin A increases expression ISO KDM4C (Homo sapiens) 6480464 trichostatin A results in increased expression of KDM4C mRNA CTD PMID:24935251 Kdm4c Rat triphenyl phosphate affects expression ISO KDM4C (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KDM4C mRNA CTD PMID:37042841 Kdm4c Rat valproic acid affects expression ISO KDM4C (Homo sapiens) 6480464 Valproic Acid affects the expression of KDM4C mRNA CTD PMID:25979313 Kdm4c Rat valproic acid increases expression ISO KDM4C (Homo sapiens) 6480464 Valproic Acid results in increased expression of KDM4C mRNA CTD PMID:23179753 more ... Kdm4c Rat valproic acid multiple interactions ISO KDM4C (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KDM4C mRNA CTD PMID:27188386 Kdm4c Rat zinc atom multiple interactions ISO KDM4C (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM4C mRNA CTD PMID:18593933 Kdm4c Rat zinc(0) multiple interactions ISO KDM4C (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM4C mRNA CTD PMID:18593933
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,2-phenylenediamine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) Cuprizon (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) folic acid (ISO) gentamycin (EXP) nitric oxide (ISO) ozone (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) potassium dichromate (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) succimer (ISO) sunitinib (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
2.
Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
Canova C, etal., Cancer Res. 2009 Apr 1;69(7):2956-65. doi: 10.1158/0008-5472.CAN-08-2604.
3.
Gene-Specific Methylation Control of H3K9 and H3K36 on Neurotrophic BDNF versus Astroglial GFAP Genes by KDM4A/C Regulates Neural Stem Cell Differentiation.
Cascante A, etal., J Mol Biol. 2014 Oct 9;426(20):3467-77. doi: 10.1016/j.jmb.2014.04.008. Epub 2014 Apr 18.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
A polymorphism in JMJD2C alters the cleavage by caspase-3 and the prognosis of human breast cancer.
Hong Q, etal., Oncotarget. 2014 Jul 15;5(13):4779-87.
6.
Genome-wide association study in esophageal cancer using GeneChip mapping 10K array.
Hu N, etal., Cancer Res. 2005 Apr 1;65(7):2542-6.
7.
Analysis of 9p24 and 11p12-13 regions in autism spectrum disorders: rs1340513 in the JMJD2C gene is associated with ASDs in Finnish sample.
Kantojarvi K, etal., Psychiatr Genet. 2010 Jun;20(3):102-8. doi: 10.1097/YPG.0b013e32833a2080.
8.
Renal cell neoplasms contain shared tumor type-specific copy number variations.
Krill-Burger JM, etal., Am J Pathol. 2012 Jun;180(6):2427-39. doi: 10.1016/j.ajpath.2012.01.044. Epub 2012 Apr 3.
9.
Genomic amplification and oncogenic properties of the GASC1 histone demethylase gene in breast cancer.
Liu G, etal., Oncogene. 2009 Dec 17;28(50):4491-500. doi: 10.1038/onc.2009.297. Epub 2009 Sep 28.
10.
Histone demethylase JMJD2C is a coactivator for hypoxia-inducible factor 1 that is required for breast cancer progression.
Luo W, etal., Proc Natl Acad Sci U S A. 2012 Dec 4;109(49):E3367-76. doi: 10.1073/pnas.1217394109. Epub 2012 Nov 5.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Multiple recurrent genetic events converge on control of histone lysine methylation in medulloblastoma.
Northcott PA, etal., Nat Genet. 2009 Apr;41(4):465-72. doi: 10.1038/ng.336. Epub 2009 Mar 8.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Genetic alterations and changes in expression of histone demethylases in prostate cancer.
Suikki HE, etal., Prostate. 2010 Jun 1;70(8):889-98. doi: 10.1002/pros.21123.
17.
Histone demethylase GASC1, a potential prognostic and predictive marker in esophageal squamous cell carcinoma.
Sun LL, etal., Am J Cancer Res. 2013 Nov 1;3(5):509-17. eCollection 2013.
18.
Genome-wide association study identifies 5q21 and 9p24.1 (KDM4C) loci associated with alcohol withdrawal symptoms.
Wang KS, etal., J Neural Transm. 2012 Apr;119(4):425-33. doi: 10.1007/s00702-011-0729-z. Epub 2011 Nov 11.
19.
[Expressions of Jumonji domain containing protein 2C and hypoxia-inducible factor-1alpha in gastric carcinoma and their clinical significance].
Xu Y, etal., Zhonghua Yi Xue Za Zhi. 2013 Nov 12;93(42):3375-8.
20.
Abnormal epigenetic modifications in peripheral blood mononuclear cells from patients with alopecia areata.
Zhao M, etal., Br J Dermatol. 2012 Feb;166(2):226-73. doi: 10.1111/j.1365-2133.2011.10646.x. Epub 2012 Jan 9.
Kdm4c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 93,146,404 - 93,353,040 (+) NCBI GRCr8 mRatBN7.2 5 88,100,710 - 88,306,821 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 88,100,733 - 88,306,818 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 90,550,808 - 90,743,411 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 92,379,831 - 92,572,427 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 92,361,586 - 92,554,190 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 90,800,139 - 91,012,662 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 90,800,082 - 91,012,659 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 94,858,214 - 95,061,170 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 92,079,908 - 92,288,809 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 92,086,392 - 92,293,919 (+) NCBI Celera 5 86,814,234 - 87,010,862 (+) NCBI Celera Cytogenetic Map 5 q31 NCBI
KDM4C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 6,720,863 - 7,175,648 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 6,720,863 - 7,175,648 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 6,720,863 - 7,175,648 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 6,747,654 - 7,165,648 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 6,748,082 - 7,165,647 NCBI Celera 9 6,649,815 - 7,106,122 (+) NCBI Celera Cytogenetic Map 9 p24.1 NCBI HuRef 9 6,675,237 - 7,130,973 (+) NCBI HuRef CHM1_1 9 6,721,531 - 7,175,696 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 6,715,554 - 7,172,114 (+) NCBI T2T-CHM13v2.0
Kdm4c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 74,160,734 - 74,324,101 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 74,160,734 - 74,324,097 (+) Ensembl GRCm39 Ensembl GRCm38 4 74,242,497 - 74,405,864 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 74,242,497 - 74,405,860 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 73,888,401 - 74,051,768 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 73,723,179 - 73,877,092 (+) NCBI MGSCv36 mm8 Celera 4 72,763,879 - 72,927,310 (+) NCBI Celera Cytogenetic Map 4 C3 NCBI cM Map 4 36.06 NCBI
Kdm4c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955434 10,685,704 - 11,000,644 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955434 10,646,524 - 11,000,589 (+) NCBI ChiLan1.0 ChiLan1.0
KDM4C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 117,411,246 - 117,821,826 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 117,417,193 - 117,832,340 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 6,568,569 - 6,978,741 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 6,746,265 - 7,155,378 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 6,746,265 - 7,155,298 (+) Ensembl panpan1.1 panPan2
KDM4C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 27,662,764 - 28,101,432 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 27,693,536 - 28,101,801 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 26,475,828 - 26,885,738 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 28,552,268 - 28,967,726 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 28,552,287 - 28,968,436 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 27,275,497 - 27,696,766 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 27,094,962 - 27,512,380 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 27,763,444 - 28,174,202 (+) NCBI UU_Cfam_GSD_1.0
Kdm4c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 142,745,730 - 143,127,317 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936539 1,198,147 - 1,580,082 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936539 1,198,105 - 1,580,078 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KDM4C
KDM4C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 72,346,194 - 72,763,040 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 72,347,071 - 72,761,666 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 60,686,049 - 60,981,876 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdm4c
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 56 Interacting mature miRNAs: 61 Transcripts: ENSRNOT00000009083 Prediction methods: Miranda Result types: miRGate_prediction
1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1357396 Bw44 Body weight QTL 44 4.19 body mass (VT:0001259) body weight (CMO:0000012) 5 68984307 104251008 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 61380 Edpm5 Estrogen-dependent pituitary mass QTL 5 4.5 0.92 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 5 68984307 104251008 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1357402 Bw46 Body weight QTL 46 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 2302381 Bw84 Body weight QTL 84 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1331782 Rf36 Renal function QTL 36 3.296 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 83840598 97059958 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2290005 Mcs24 Mammary carcinoma susceptibility QTL 24 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 64719390 109719390 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 2312671 Scl64 Serum cholesterol level QTL 64 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 68984307 104251008 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009083 ⟹ ENSRNOP00000009083
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 88,100,733 - 88,306,818 (+) Ensembl Rnor_6.0 Ensembl 5 90,818,736 - 91,012,659 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093206 ⟹ ENSRNOP00000076133
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 88,100,831 - 88,197,451 (+) Ensembl Rnor_6.0 Ensembl 5 90,800,166 - 90,888,305 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093480 ⟹ ENSRNOP00000076220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 90,818,736 - 90,827,576 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093696 ⟹ ENSRNOP00000076322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 90,800,082 - 90,827,576 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108118 ⟹ ENSRNOP00000085474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 88,100,752 - 88,306,818 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110293 ⟹ ENSRNOP00000088229
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 88,101,105 - 88,306,818 (+) Ensembl
RefSeq Acc Id:
NM_001106663 ⟹ NP_001100133
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,147,037 - 93,353,040 (+) NCBI mRatBN7.2 5 88,100,804 - 88,306,821 (+) NCBI Rnor_6.0 5 90,800,139 - 91,012,662 (+) NCBI Rnor_5.0 5 94,858,214 - 95,061,170 (+) NCBI Celera 5 86,814,234 - 87,010,862 (+) NCBI
Sequence:
AAGATTCCCAAAACCCTCAGGGGAGGCCGCACTTTCATCCCTTTCATTCGGGTGGCGTCTGGACCTCCTCCAGCGGCGCAGAGACATCTGTAGCCATCATGGAGGTGGTGGAGGTGGAGAGTCCCCTA
hide sequence
RefSeq Acc Id:
XM_039109496 ⟹ XP_038965424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,947 - 93,353,037 (+) NCBI mRatBN7.2 5 88,100,711 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_039109497 ⟹ XP_038965425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,160,010 - 93,353,037 (+) NCBI mRatBN7.2 5 88,113,780 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_039109498 ⟹ XP_038965426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,160,006 - 93,353,037 (+) NCBI mRatBN7.2 5 88,113,782 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_039109499 ⟹ XP_038965427
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,160,007 - 93,353,037 (+) NCBI mRatBN7.2 5 88,113,786 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_039109500 ⟹ XP_038965428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,168,016 - 93,353,037 (+) NCBI mRatBN7.2 5 88,121,785 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_039109502 ⟹ XP_038965430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,947 - 93,304,278 (+) NCBI mRatBN7.2 5 88,100,712 - 88,258,056 (+) NCBI
RefSeq Acc Id:
XM_039109503 ⟹ XP_038965431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,248,813 - 93,353,037 (+) NCBI mRatBN7.2 5 88,202,581 - 88,306,821 (+) NCBI
RefSeq Acc Id:
XM_063287361 ⟹ XP_063143431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,404 - 93,353,037 (+) NCBI
RefSeq Acc Id:
XM_063287362 ⟹ XP_063143432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,248,813 - 93,353,037 (+) NCBI
RefSeq Acc Id:
XM_063287363 ⟹ XP_063143433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,947 - 93,243,672 (+) NCBI
RefSeq Acc Id:
XM_063287364 ⟹ XP_063143434
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,946 - 93,225,766 (+) NCBI
RefSeq Acc Id:
XR_010066353
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 93,146,945 - 93,271,514 (+) NCBI
RefSeq Acc Id:
NP_001100133 ⟸ NM_001106663
- UniProtKB:
F1LS62 (UniProtKB/TrEMBL)
- Sequence:
MEVVEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKPMTVKEFRQLANSSKYCTPRYLDYEDLERKYWKNLT
hide sequence
Ensembl Acc Id:
ENSRNOP00000009083 ⟸ ENSRNOT00000009083
Ensembl Acc Id:
ENSRNOP00000076322 ⟸ ENSRNOT00000093696
Ensembl Acc Id:
ENSRNOP00000076220 ⟸ ENSRNOT00000093480
Ensembl Acc Id:
ENSRNOP00000076133 ⟸ ENSRNOT00000093206
RefSeq Acc Id:
XP_038965424 ⟸ XM_039109496
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A8Y8 (UniProtKB/TrEMBL), F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965430 ⟸ XM_039109502
- Peptide Label:
isoform X5
- UniProtKB:
A6J816 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965425 ⟸ XM_039109497
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A3B2 (UniProtKB/TrEMBL), F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965426 ⟸ XM_039109498
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A3B2 (UniProtKB/TrEMBL), F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965427 ⟸ XM_039109499
- Peptide Label:
isoform X4
- UniProtKB:
F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965428 ⟸ XM_039109500
- Peptide Label:
isoform X4
- UniProtKB:
F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965431 ⟸ XM_039109503
- Peptide Label:
isoform X6
Ensembl Acc Id:
ENSRNOP00000088229 ⟸ ENSRNOT00000110293
Ensembl Acc Id:
ENSRNOP00000085474 ⟸ ENSRNOT00000108118
RefSeq Acc Id:
XP_063143431 ⟸ XM_063287361
- Peptide Label:
isoform X3
- UniProtKB:
F1LS62 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143434 ⟸ XM_063287364
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063143433 ⟸ XM_063287363
- Peptide Label:
isoform X7
- UniProtKB:
B0BNJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143432 ⟸ XM_063287362
- Peptide Label:
isoform X6
RGD ID: 13693816 Promoter ID: EPDNEW_R4338 Type: initiation region Name: Kdm4c_1 Description: lysine demethylase 4C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 90,800,099 - 90,800,159 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Kdm4c
lysine demethylase 4C
LOC108348059
lysine-specific demethylase 4C-like
Data merged from RGD:11379415
737654 PROVISIONAL
2016-08-02
LOC108348059
lysine-specific demethylase 4C-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2016-02-17
Kdm4c
lysine demethylase 4C
Kdm4c
lysine (K)-specific demethylase 4C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-05-06
Kdm4c
lysine (K)-specific demethylase 4C
Jmjd2c
jumonji domain containing 2C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Jmjd2c
jumonji domain containing 2C
Jmjd2c_predicted
jumonji domain containing 2C (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Jmjd2c_predicted
jumonji domain containing 2C (predicted)
Symbol and Name status set to approved
70820 APPROVED
