Advanced Search (OLGA)

Gene: Rnf139 (ring finger protein 139) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rnf139

Name:

ring finger protein 139

RGD ID:

1306670

Description:

Predicted to enable protease binding activity and ubiquitin protein ligase activity. Predicted to be involved in several processes, including proteasomal protein catabolic process; protein destabilization; and regulation of protein metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be part of Derlin-1 retrotranslocation complex. Predicted to be active in endomembrane system. Human ortholog(s) of this gene implicated in renal cell carcinoma. Orthologous to human RNF139 (ring finger protein 139); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase RNF139; LOC315000; TRC8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RNF139 (ring finger protein 139)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Rnf139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rnf139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RNF139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RNF139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnf139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RNF139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RNF139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rnf139 (ring finger protein 139)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RNF139 (ring finger protein 139)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnf139 (ring finger protein 139)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rnf139 (ring finger protein 139)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Trc8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rnf139	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	92,329,201 - 92,340,386 (+)	NCBI		GRCr8
mRatBN7.2	7	90,439,726 - 90,450,911 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	90,436,621 - 90,488,009 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	92,329,252 - 92,340,556 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	94,530,408 - 94,541,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	94,357,784 - 94,368,970 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	98,770,840 - 98,782,025 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	98,770,840 - 98,782,025 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	99,371,253 - 99,382,438 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	95,659,052 - 95,661,624 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	95,691,439 - 95,695,125 (+)	NCBI
Celera	7	87,205,052 - 87,216,237 (+)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	renal cell carcinoma		ISO	RGD:1315417	1599629		RGD
Rnf139	Rat	renal cell carcinoma		ISO	RGD:1315417	2289870		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:1315417	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal dysplasia type I	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	renal cell carcinoma		ISO	RGD:1315417	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	renal cell carcinoma		ISO	RGD:1315417	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	(+)-catechin	multiple interactions	ISO	RGD:1315417	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of RNF139 mRNA	CTD	PMID:24763279
Rnf139	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1550548	6480464	1,2-Dimethylhydrazine results in decreased expression of RNF139 mRNA	CTD	PMID:22206623
Rnf139	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1550548	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of RNF139 mRNA]	CTD	PMID:22206623
Rnf139	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1315417	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of RNF139 mRNA	CTD	PMID:21453500
Rnf139	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of RNF139 mRNA	CTD	PMID:32145629
Rnf139	Rat	17beta-estradiol	decreases expression	ISO	RGD:1315417	6480464	Estradiol results in decreased expression of RNF139 mRNA	CTD	PMID:21453500
Rnf139	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RNF139 mRNA	CTD	PMID:18796159\|PMID:21215274\|PMID:33387578
Rnf139	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1550548	6480464	Tetrachlorodibenzodioxin affects the expression of RNF139 mRNA	CTD	PMID:21570461
Rnf139	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1550548	6480464	Tetrachlorodibenzodioxin results in increased expression of RNF139 mRNA	CTD	PMID:21354282
Rnf139	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1315417	6480464	Aflatoxin B1 results in decreased methylation of RNF139 gene	CTD	PMID:27153756
Rnf139	Rat	aflatoxin M1	decreases expression	ISO	RGD:1315417	6480464	Aflatoxin M1 results in decreased expression of RNF139 mRNA	CTD	PMID:30928695
Rnf139	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of RNF139 mRNA	CTD	PMID:16483693
Rnf139	Rat	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of RNF139 mRNA	CTD	PMID:21839799
Rnf139	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RNF139 mRNA	CTD	PMID:25181051
Rnf139	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RNF139 mRNA	CTD	PMID:30816183
Rnf139	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of RNF139 mRNA	CTD	PMID:24136188
Rnf139	Rat	cadmium dichloride	decreases expression	ISO	RGD:1315417	6480464	Cadmium Chloride results in decreased expression of RNF139 mRNA	CTD	PMID:38568856
Rnf139	Rat	CGP 52608	multiple interactions	ISO	RGD:1315417	6480464	CGP 52608 promotes the reaction [RORA protein binds to RNF139 gene]	CTD	PMID:28238834
Rnf139	Rat	diazinon	increases methylation	ISO	RGD:1315417	6480464	Diazinon results in increased methylation of RNF139 gene	CTD	PMID:22964155
Rnf139	Rat	dicrotophos	decreases expression	ISO	RGD:1315417	6480464	dicrotophos results in decreased expression of RNF139 mRNA	CTD	PMID:28302478
Rnf139	Rat	doxorubicin	decreases expression	ISO	RGD:1315417	6480464	Doxorubicin results in decreased expression of RNF139 mRNA	CTD	PMID:29803840
Rnf139	Rat	folic acid	multiple interactions	ISO	RGD:1550548	6480464	Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of RNF139 mRNA]	CTD	PMID:22206623
Rnf139	Rat	FR900359	affects phosphorylation	ISO	RGD:1315417	6480464	FR900359 affects the phosphorylation of RNF139 protein	CTD	PMID:37730182
Rnf139	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of RNF139 mRNA	CTD	PMID:33387578
Rnf139	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of RNF139 mRNA	CTD	PMID:24136188
Rnf139	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of RNF139 mRNA	CTD	PMID:24136188
Rnf139	Rat	paracetamol	affects expression	ISO	RGD:1550548	6480464	Acetaminophen affects the expression of RNF139 mRNA	CTD	PMID:17562736
Rnf139	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RNF139 mRNA	CTD	PMID:33387578
Rnf139	Rat	piroxicam	decreases expression	ISO	RGD:1315417	6480464	Piroxicam results in decreased expression of RNF139 mRNA	CTD	PMID:21858171
Rnf139	Rat	progesterone	multiple interactions	ISO	RGD:1315417	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of RNF139 mRNA	CTD	PMID:21453500
Rnf139	Rat	testosterone	decreases expression	ISO	RGD:1315417	6480464	Testosterone results in decreased expression of RNF139 mRNA	CTD	PMID:33359661
Rnf139	Rat	titanium dioxide	increases methylation	ISO	RGD:1550548	6480464	titanium dioxide results in increased methylation of RNF139 promoter	CTD	PMID:35295148
Rnf139	Rat	titanium dioxide	decreases methylation	ISO	RGD:1550548	6480464	titanium dioxide results in decreased methylation of RNF139 gene	CTD	PMID:35295148
Rnf139	Rat	trichostatin A	affects expression	ISO	RGD:1315417	6480464	trichostatin A affects the expression of RNF139 mRNA	CTD	PMID:28542535
Rnf139	Rat	triphenyl phosphate	affects expression	ISO	RGD:1315417	6480464	triphenyl phosphate affects the expression of RNF139 mRNA	CTD	PMID:37042841
Rnf139	Rat	urethane	increases expression	ISO	RGD:1315417	6480464	Urethane results in increased expression of RNF139 mRNA	CTD	PMID:28818685
Rnf139	Rat	valproic acid	affects expression	ISO	RGD:1315417	6480464	Valproic Acid affects the expression of RNF139 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	biological_process		ND		1598407	2/2007: no relevant rat data	RGD
Rnf139	Rat	ERAD pathway	involved_in	ISO	RGD:1315417	1624291	PMID:25239945	RGD	PMID:25239945
Rnf139	Rat	ERAD pathway	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	ERAD pathway	involved_in	IBA	MGI:1921376\|PANTHER:PTN004564711\|PomBase:SPBC17D11.02c\|TAIR:locus:2014993\|TAIR:locus:2093422\|UniProtKB:Q4WCD2\|UniProtKB:Q86TM6\|UniProtKB:Q8WU17	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf139	Rat	mitochondrial electron transport, NADH to ubiquinone	involved_in	IEA	InterPro:IPR033034	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rnf139	Rat	negative regulation of cell population proliferation	involved_in	ISO	RGD:1315417	1624291	PMID:17016439	RGD	PMID:17016439
Rnf139	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	negative regulation of translation	involved_in	ISO	RGD:1315417	1624291	PMID:20068067	RGD	PMID:20068067
Rnf139	Rat	negative regulation of translation	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	positive regulation of ubiquitin-dependent protein catabolic process	involved_in	ISO	RGD:1315417	1624291	PMID:25239945	RGD	PMID:25239945
Rnf139	Rat	positive regulation of ubiquitin-dependent protein catabolic process	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN004563991\|PomBase:SPBC2A9.04c\|PomBase:SPBC947.10	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf139	Rat	protein destabilization	involved_in	ISO	RGD:1315417	1624291	PMID:25239945	RGD	PMID:25239945
Rnf139	Rat	protein destabilization	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	protein ubiquitination	involved_in	ISO	RGD:1315417	1624291	PMID:10500182, PMID:17016439, PMID:19720873	RGD	PMID:10500182\|PMID:17016439\|PMID:19720873
Rnf139	Rat	protein ubiquitination	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	regulation of ER to Golgi vesicle-mediated transport	involved_in	ISO	RGD:1315417	1624291	PMID:19706601	RGD	PMID:19706601
Rnf139	Rat	regulation of ER to Golgi vesicle-mediated transport	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	regulation of protein processing	involved_in	ISO	RGD:1315417	1624291	PMID:19706601	RGD	PMID:19706601
Rnf139	Rat	regulation of protein processing	involved_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	Derlin-1 retrotranslocation complex	part_of	ISO	RGD:1315417	1624291	PMID:25239945	RGD	PMID:25239945
Rnf139	Rat	Derlin-1 retrotranslocation complex	part_of	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	Derlin-1 retrotranslocation complex	part_of	IBA	PANTHER:PTN000967628\|UniProtKB:Q8WU17	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf139	Rat	endomembrane system	is_active_in	IBA	FB:FBgn0039668\|MGI:1921376\|PANTHER:PTN004563991\|SGD:S000001517\|TAIR:locus:2121333\|UniProtKB:Q86TM6\|UniProtKB:Q8WU17\|WB:WBGene00022471	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf139	Rat	endoplasmic reticulum	located_in	ISO	RGD:1315417	1624291	PMID:12032852	RGD	PMID:12032852
Rnf139	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rnf139	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Rnf139	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-SubCell:SL-0168	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Rnf139	Rat	mitochondrial inner membrane	located_in	IEA	UniProtKB-KW:KW-0999	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rnf139	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rnf139	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rnf139	Rat	protease binding	enables	ISO	RGD:1315417	1624291	UniProtKB:Q8TCT9 PMID:25239945	RGD	PMID:25239945
Rnf139	Rat	protease binding	enables	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	protein binding	enables	ISO	RGD:1315417	1624291	UniProtKB:O95487\|UniProtKB:P17861-1\|UniProtKB:P40337\|UniProtKB:P54253\|UniProtKB:Q12770\|UniProtKB:Q12772\|UniProtKB:Q8TCT9\|UniProtKB:Q9Y679 PMID:12032852, PMID:19706601, PMID:19720873, PMID:23223569, PMID:25239945, PMID:32814053	RGD	PMID:12032852\|PMID:19706601\|PMID:19720873\|PMID:23223569\|PMID:25239945\|PMID:32814053
Rnf139	Rat	ubiquitin protein ligase activity	enables	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	ubiquitin protein ligase activity	enables	IBA	FB:FBgn0039875\|MGI:1921376\|PANTHER:PTN004563991\|PomBase:SPBC17D11.02c\|PomBase:SPBC2A9.04c\|PomBase:SPBC947.10\|UniProtKB:Q86TM6\|UniProtKB:Q8WU17	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rnf139	Rat	ubiquitin protein ligase activity	enables	ISO	RGD:1315417	1624291	PMID:10500182	RGD	PMID:10500182
Rnf139	Rat	ubiquitin-like protein transferase activity	enables	ISO	RGD:1315417	1624291	PMID:17016439	RGD	PMID:17016439
Rnf139	Rat	ubiquitin-like protein transferase activity	enables	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	ubiquitin-protein transferase activity	enables	ISO	RGD:1315417	1624291	PMID:17016439, PMID:19720873	RGD	PMID:17016439\|PMID:19720873
Rnf139	Rat	ubiquitin-protein transferase activity	enables	IEA	UniProtKB:Q8WU17\|ensembl:ENSP00000304051	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rnf139	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rnf139	Rat	zinc ion binding	enables	IEA	InterPro:IPR011016	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The hereditary renal cell carcinoma 3;8 translocation fuses FHIT to a patched-related gene, TRC8.	Gemmill RM, etal., Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9572-7.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	A constitutional balanced t(3;8)(p14;q24.1) translocation results in disruption of the TRC8 gene and predisposition to clear cell renal cell carcinoma.	Poland KS, etal., Genes Chromosomes Cancer. 2007 Sep;46(9):805-12.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:10500182	PMID:12032852	PMID:12477932	PMID:17016439	PMID:19706601	PMID:19720873	PMID:20068067	PMID:25239945

Rnf139
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	92,329,201 - 92,340,386 (+)	NCBI		GRCr8
mRatBN7.2	7	90,439,726 - 90,450,911 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	90,436,621 - 90,488,009 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	92,329,252 - 92,340,556 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	94,530,408 - 94,541,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	94,357,784 - 94,368,970 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	98,770,840 - 98,782,025 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	98,770,840 - 98,782,025 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	99,371,253 - 99,382,438 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	95,659,052 - 95,661,624 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	95,691,439 - 95,695,125 (+)	NCBI
Celera	7	87,205,052 - 87,216,237 (+)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

RNF139
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	124,474,880 - 124,488,618 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	124,474,866 - 124,488,618 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	125,487,121 - 125,500,859 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	125,556,189 - 125,570,040 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	125,556,188 - 125,570,040	NCBI
Celera	8	121,675,173 - 121,688,974 (+)	NCBI		Celera
Cytogenetic Map	8	q24.13	NCBI
HuRef	8	120,812,471 - 120,826,584 (+)	NCBI		HuRef
CHM1_1	8	125,527,264 - 125,541,113 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	125,607,587 - 125,621,646 (+)	NCBI		T2T-CHM13v2.0

Rnf139
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	58,760,975 - 58,774,239 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	58,761,078 - 58,778,906 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	58,889,229 - 58,902,390 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	58,889,229 - 58,907,057 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	58,720,784 - 58,733,945 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	58,719,381 - 58,730,937 (+)	NCBI		MGSCv36	mm8
MGSCv36	15	59,311,394 - 59,322,950 (+)	NCBI		MGSCv36	mm8
Celera	15	60,427,522 - 60,431,604 (+)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	25.09	NCBI

Rnf139
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955540	3,140,649 - 3,153,546 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955540	3,140,649 - 3,153,546 (+)	NCBI	ChiLan1.0	ChiLan1.0

RNF139
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	141,895,692 - 141,908,853 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	117,406,772 - 117,420,595 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	121,158,715 - 121,172,069 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	123,912,589 - 123,924,984 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	123,912,589 - 123,924,720 (+)	Ensembl	panpan1.1		panPan2

RNF139
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	22,560,180 - 22,572,986 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	22,543,543 - 22,572,308 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	22,525,691 - 22,538,625 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	22,902,085 - 22,915,033 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	22,885,460 - 22,915,135 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	22,622,475 - 22,635,430 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	22,732,278 - 22,745,227 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	22,975,117 - 22,988,074 (+)	NCBI		UU_Cfam_GSD_1.0

Rnf139
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	15,731,213 - 15,742,466 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	23,152,765 - 23,168,571 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	23,157,312 - 23,168,565 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RNF139
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	15,154,331 - 15,197,511 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	15,157,571 - 15,182,520 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	15,570,618 - 15,592,862 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RNF139
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	119,041,885 - 119,055,119 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	119,042,223 - 119,054,486 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	21,131,138 - 21,167,922 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rnf139
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	30,715,384 - 30,726,862 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	30,715,373 - 30,726,591 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rnf139
43 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	29
Interacting mature miRNAs:	39
Transcripts:	ENSRNOT00000011891
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
10450828	Scl79	Serum cholesterol level QTL 79	3.5	0.001	blood HDL cholesterol amount (VT:0000184)	blood low density lipoprotein cholesterol level (CMO:0000053)	7	89867376	101773158	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

EST3C7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	90,450,217 - 90,450,347 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	98,781,332 - 98,781,461	NCBI	Rnor6.0
Rnor_5.0	7	99,381,745 - 99,381,874	UniSTS	Rnor5.0
RGSC_v3.4	7	95,660,931 - 95,661,060	UniSTS	RGSC3.4
Celera	7	87,215,544 - 87,215,673	UniSTS
Cytogenetic Map	7	q33	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001127545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH009105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011891 ⟹ ENSRNOP00000067352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	90,439,726 - 90,450,911 (+)	Ensembl
Rnor_6.0 Ensembl	7	98,770,840 - 98,782,025 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000012616 ⟹ ENSRNOP00000012616

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	90,481,001 - 90,488,009 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101966 ⟹ ENSRNOP00000084114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	90,436,621 - 90,488,009 (+)	Ensembl

RefSeq Acc Id:

NM_001127545 ⟹ NP_001121017

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	92,329,201 - 92,340,386 (+)	NCBI
mRatBN7.2	7	90,439,726 - 90,450,911 (+)	NCBI
Rnor_6.0	7	98,770,840 - 98,782,025 (+)	NCBI
Rnor_5.0	7	99,371,253 - 99,382,438 (+)	NCBI
RGSC_v3.4	7	95,659,052 - 95,661,624 (+)	RGD
Celera	7	87,205,052 - 87,216,237 (+)	RGD

Sequence:

show sequence

GGCCCCCGCAGCAGCAGGTGCGGATGGCCCAGCAGCAGGTCTGGGCGGCGCTCGAAGTGGCGCTCCGGGTGCCCTGCCTCTACATCATCGACGCCATCTTCAACTCCTACTACGATTCCAGCCAAAGC
CGGTTCTGCATCGGGCTTCAGATCTTTCTCCGGCTCCTCGGTATAGTTGTATCCAGTATTGTTCTGATCTTGTCACAGCGATCACTTTTCAAGTTTTACATGTACAGCTCAGCCTTTCTATTAGCTGC
AACTTCAGTGTTGGTGAACTACTATGCTGCTTTGCACATTGACTTCTACGGTGCCTACAACACGTCAGCATTTGGAATTGAGTTGCTTCCTCGGAAAGGGCCCTCACTGTGGATGGCACTCATCGTTC
TGCAGCTAACCTTTGGAATCGGATACGTCACTCTACTCCACATTCAGTCTATCTATTCACAGCTGATTATTCTGAATATCTTGGTTCCTGTAATCGGCTTAATCACAGAGCTACCATTACACATCAGA
GAGACGTTAGTTTTCATGTCTTCCTTGATTCTCATATTTAACACAATGCTTGTCTTGGCAGTGAAACTTAAGTGGTTTTATTACTCTACTCGGTATGTTTACTTGTTAGTGAGGCATATGTACCGAAT
TTATGGATTACAGTTATTGATGGAGGACACATGGAAGCGGATTCGTTTCCCAGACATACTTCGGGTCTTCTGGCTAACAAGGATTACAGCTCAGGCTACAGTGTTGATGTACATTTTAAGGATGGCGA
ATGAGACTGAGTCCTTCCTTATTTCTTGGGATGATTTCTGGGACATCATTTGCAATCTAATAATTAGTGGGTGCGATTCTACACTAACTGTACTAGGCATGAGTGCTGTAATTTCTTCAATAGCCCAT
TACTTGGGCCTTGGAATATTGGCCTTTATTGGATCAACTGAAGAAGATGACAGGCGGCTTGGCTTTGTAGCACCTGTTTTATTTTTCATTTTGGCTCTTCAGACTGGTTTAAGTGGGCTGAGACCTGA
AGAGAGACTTATTCGCTTAAGTAGAAACATGTGCCTTTTATTAACTGCAGTCCTACATTTCATCCACGGAATGACAGACCCCGTGTTAATGTCTCTCAGTGCCTCCCACGTGTCATCTTTCCACAGAC
ATTTTCCTGTGCTGTTTGTCTCTGCTTGCCTGTTTATTCTTCCTGTTTTACTCAGTTATGTCCTTTGGCACCACTATGCACTAAACACGTGGCTGTTTGCAGTTACAGCCTTCTGTGTGGAACTCTGC
TTGAAAGTAATTGTTTCCCTCACTGTCTACACGCTATTCATGATTGATGGCTACTATAATGTCCTCTGGGAAAAGCTTGATGATTATGTCTACTTTGTTCGCTCGACAGGCAATATTATCGAATTTAT
ATTTGGAGTAGTAATGTTTGGGAATGGGGCCTATACCATGATGTTTGAGTCAGGAAGTAAAATCCGGGCTTGTATGATGTGCCTACATGCATATTTTAACATCTACTTACAAGTAAAAAATGGCTGGA
AGACATTCATGAATCGTAGAACTGCTGTTAAGAAAATTAATTCACTTCCTGAAATAAAAGGGAGCCACTTGCAAGAAATAGATGATGTTTGTGCCATCTGCTATCATGAGTTCACAACGTCTGCTCGG
ATTACACCGTGTAACCATTATTTCCATGCACTCTGCCTTCGGAAATGGCTGTACATTCAAGATACTTGTCCAATGTGTCATCAGAAAGTGTACATCGAAGACGATATCAAGGACAATTCAAATGTATC
TAACAACAACGGATTTATTGCACCCAATGAAAATCAAAACCCAGAGGAAGCTTTAAGAGAAGATGCTGCTGGATCTGACCGAGAAATGAACGAGGATGACAGTACAGACTGTGATGATGATATTCAAA
GAGAAAGAAACGGGGGGATTCAGCACACAGGCGCAGCAGCAGCAGCAGCAGAATTTAATGATGACACTGATTAAAGTAGCATTTACTAATCATTGAGGTATTTGTTTAAAATTCAGTTCATCCAAAAT
GGAGTAATATGCTTCACGTCAGTGTGTAACCAAGCACAAAAACAGTATCGATGTTGAAACTGTGAATGATTTTCCGTTTACTGTGATGTGCTACTGTAAATATACCTCTTTAATTACTTCTGGTCTCT
TTGGTGACCTATTTAAATTTGTGTACATTATTGTACATAGAATAAAATGTTTTCACGTTTTTATGACAAAATTTGAACAAATAACTTCTTAATAGAGATAATGATCACACGGTGCGTCAAGTGTGCCA
AAGAGCCCTCAATGAAATCAGAATCTGTCTAATGCTGCACTCTAGTTTTTCTTTAAAACGAAGGGAAAATGAAAATGCCGAATAAAGGAATGTTAGTATAAGAGACAGGAGATAAAATAATCTTGAGT
AGAAAGGCTTTCTAAATAAAATGTTTTCTAAAACTAAGGCAAGATACCCTGCTAGAAGCAACTGAGAAACTTGAAATCTGAGTGCAGCTTAGAGGCAGGTTCAAAAGTCACACAAATCAAGGACAGAA
TTGAGAAATAGGCTTGTTATCAACTAAACTTTGACATAAACCAGGACATGCTGTCTAAGTTTTAGGTAGAAGCATCACTGTGTTTGCAGTGAGAGTGTAAAACTGTCCTTTCAGACTTCTGATGAGAT
TACACAATAAAAAGGCTGTCACTGTTACCTAAAGC

hide sequence


Protein RefSeqs	NP_001121017	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF28720	(Get FASTA)	NCBI Sequence Viewer
	AAI61975	(Get FASTA)	NCBI Sequence Viewer
	EDM16213	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067352
	ENSRNOP00000067352.1
	ENSRNOP00000084114.1

RefSeq Acc Id:

NP_001121017 ⟸ NM_001127545

- UniProtKB:

M0RCM9 (UniProtKB/TrEMBL), A6HRK9 (UniProtKB/TrEMBL), B1WC23 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAQQQVWAALEVALRVPCLYIIDAIFNSYYDSSQSRFCIGLQIFLRLLGIVVSSIVLILSQRSLFKFYMYSSAFLLAATSVLVNYYAALHIDFYGAYNTSAFGIELLPRKGPSLWMALIVLQLTFGIG
YVTLLHIQSIYSQLIILNILVPVIGLITELPLHIRETLVFMSSLILIFNTMLVLAVKLKWFYYSTRYVYLLVRHMYRIYGLQLLMEDTWKRIRFPDILRVFWLTRITAQATVLMYILRMANETESFLI
SWDDFWDIICNLIISGCDSTLTVLGMSAVISSIAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEERLIRLSRNMCLLLTAVLHFIHGMTDPVLMSLSASHVSSFHRHFPVLFVS
ACLFILPVLLSYVLWHHYALNTWLFAVTAFCVELCLKVIVSLTVYTLFMIDGYYNVLWEKLDDYVYFVRSTGNIIEFIFGVVMFGNGAYTMMFESGSKIRACMMCLHAYFNIYLQVKNGWKTFMNRRT
AVKKINSLPEIKGSHLQEIDDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIAPNENQNPEEALREDAAGSDREMNEDDSTDCDDDIQRERNGGIQ
HTGAAAAAAEFNDDTD

hide sequence

Ensembl Acc Id:

ENSRNOP00000067352 ⟸ ENSRNOT00000011891

Ensembl Acc Id:

ENSRNOP00000012616 ⟸ ENSRNOT00000012616

Ensembl Acc Id:

ENSRNOP00000084114 ⟸ ENSRNOT00000101966

Protein Domains

Complex 1 LYR protein RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RCM9-F1-model_v2	AlphaFold	M0RCM9	1-656	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695352

Promoter ID:

EPDNEW_R5877

Type:

multiple initiation site

Name:

Rnf139_1

Description:

ring finger protein 139

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	98,770,805 - 98,770,865	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-33298	BioCyc
Ensembl Genes	ENSRNOG00000008987	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011891	ENTREZGENE
	ENSRNOT00000011891.8	UniProtKB/TrEMBL
	ENSRNOT00000101966.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9029542	IMAGE-MGC_LOAD
InterPro	Complex1_LYR_dom	UniProtKB/TrEMBL
	Complex1_LYR_NDUFB9_LYRM3	UniProtKB/TrEMBL
	HRD1_E3_ubiq-ligases	UniProtKB/TrEMBL
	NDUFB9	UniProtKB/TrEMBL
	TRC8_N_dom	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING-CH	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
KEGG Report	rno:315000	UniProtKB/TrEMBL
MGC_CLONE	MGC:187786	IMAGE-MGC_LOAD
NCBI Gene	315000	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE RNF139	UniProtKB/TrEMBL
	NADH DEHYDROGENASE [UBIQUINONE] 1 BETA SUBCOMPLEX SUBUNIT 9	UniProtKB/TrEMBL
	PTHR12868	UniProtKB/TrEMBL
	RING ZINC FINGER PROTEIN	UniProtKB/TrEMBL
Pfam	Complex1_LYR	UniProtKB/TrEMBL
	TRC8_N	UniProtKB/TrEMBL
	zf-RING_2	UniProtKB/TrEMBL
PhenoGen	Rnf139	PhenoGen
PROSITE	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008987	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	RINGv	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A8I6A1A8_RAT	UniProtKB/TrEMBL
	A6HRK9	ENTREZGENE, UniProtKB/TrEMBL
	B1WC23	ENTREZGENE, UniProtKB/TrEMBL
	M0RCM9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rnf139	ring finger protein 139	Rnf139_predicted	ring finger protein 139 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rnf139_predicted	ring finger protein 139 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM