Ruvbl2 (RuvB-like AAA ATPase 2) - Rat Genome Database

Name: Ruvbl2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ruvbl2 (RuvB-like AAA ATPase 2) Rattus norvegicus

Analyze

Symbol:

Ruvbl2

Name:

RuvB-like AAA ATPase 2

RGD ID:

1306509

Description:

Predicted to enable several functions, including DNA binding activity; adenyl ribonucleotide binding activity; and general transcription initiation factor binding activity. Predicted to be involved in several processes, including box C/D snoRNP assembly; cellular response to estradiol stimulus; and regulation of nucleobase-containing compound metabolic process. Predicted to be located in centrosome; cytosol; and nucleoplasm. Predicted to be part of several cellular components, including MLL1 complex; R2TP complex; and chromatin. Orthologous to human RUVBL2 (RuvB like AAA ATPase 2); PARTICIPATES IN INO80 family mediated chromatin remodeling pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC292907; RuvB-like 2; RuvB-like 2 (E. coli); RuvB-like protein 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RUVBL2 (RuvB like AAA ATPase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ruvbl2 (RuvB-like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ruvbl2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RUVBL2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RUVBL2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ruvbl2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RUVBL2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RUVBL2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ruvbl2 (RuvB like AAA ATPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RUVBL2 (RuvB like AAA ATPase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ruvbl2 (RuvB-like AAA ATPase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ruvbl2 (RuvB-like AAA ATPase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ruvb-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RVB2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	rept	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ruvbl2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Ruvbl2-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	95,902,014 - 95,915,247 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,901,701 - 95,915,342 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,287,438 - 101,300,671 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,760,116 - 109,773,349 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	103,050,515 - 103,063,748 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,413,766 - 101,426,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,413,766 - 101,426,852 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,493,176 - 102,506,380 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,894,029 - 95,906,885 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	95,972,140 - 95,985,010 (-)	NCBI
Celera	1	90,157,605 - 90,170,691 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

progressive familial heart block type IB (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dinitrotoluene (EXP)

3,3'-Dichlorobenzidine (ISO)

4-amino-2,6-dinitrotoluene (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

Cuprizon (EXP)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

geraniol (ISO)

glyphosate (EXP)

hydrogen peroxide (ISO)

hypochlorous acid (ISO)

imiquimod (ISO)

ivermectin (ISO)

lead(0) (ISO)

linalool (ISO)

lovastatin (ISO)

methidathion (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

quercetin (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

T-2 toxin (EXP,ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiophenes (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

box C/D snoRNP assembly (IBA)

cellular response to estradiol stimulus (ISO)

cellular response to UV (ISO)

chromatin remodeling (IBA,ISO)

DNA duplex unwinding (IEA)

DNA recombination (IEA)

DNA repair (IEA)

establishment of protein localization to chromatin (ISO)

negative regulation of canonical Wnt signaling pathway (ISO)

negative regulation of DNA-templated transcription (IEA)

positive regulation of DNA repair (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of double-strand break repair via homologous recombination (ISO)

positive regulation of telomerase RNA localization to Cajal body (ISO)

positive regulation of telomere maintenance in response to DNA damage (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of cell cycle (ISO)

regulation of chromosome organization (ISO)

regulation of DNA repair (ISO)

regulation of DNA replication (ISO)

regulation of DNA strand elongation (ISO)

regulation of embryonic development (ISO)

regulation of transcription by RNA polymerase II (IBA)

telomere maintenance (ISO)

Cellular Component

centrosome (IEA,ISO)

cytoplasm (ISO)

cytosol (IEA,ISO)

dynein axonemal particle (IEA)

euchromatin (ISO)

Ino80 complex (IBA,ISO)

MLL1 complex (ISO)

NuA4 histone acetyltransferase complex (IBA,ISO)

nucleoplasm (ISO)

nucleosome (ISO)

nucleus (ISO)

protein folding chaperone complex (ISO)

R2TP complex (IBA,ISO)

ribonucleoprotein complex (ISO)

RPAP3/R2TP/prefoldin-like complex (ISO)

Swr1 complex (IBA,ISO)

Molecular Function

ADP binding (ISO)

ATP binding (ISO)

ATP hydrolysis activity (ISO)

ATPase binding (ISO)

beta-catenin binding (ISO)

chromatin DNA binding (ISO)

DNA helicase activity (IBA,ISO)

identical protein binding (ISO)

promoter-enhancer loop anchoring activity (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

RNA polymerase II core promoter sequence-specific DNA binding (ISO)

TBP-class protein binding (ISO)

TFIID-class transcription factor complex binding (ISO)

transcription corepressor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

INO80 family mediated chromatin remodeling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	The INO80 family of chromatin-remodeling enzymes: regulators of histone variant dynamics.	Watanabe S and Peterson CL, Cold Spring Harb Symp Quant Biol. 2010;75:35-42. doi: 10.1101/sqb.2010.75.063. Epub 2011 Apr 18.

Additional References at PubMed

PMID:10524211	PMID:10966108	PMID:11080158	PMID:14966270	PMID:15960975	PMID:17353931	PMID:17636026	PMID:18026119	PMID:19299493	PMID:19433865	PMID:20458337	PMID:21303910
PMID:21799128	PMID:21988832	PMID:22748767	PMID:23376485	PMID:23637611	PMID:24463511	PMID:24625528	PMID:25467444	PMID:26711270

Genomics

Comparative Map Data

Ruvbl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	95,902,014 - 95,915,247 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,901,701 - 95,915,342 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,287,438 - 101,300,671 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,760,116 - 109,773,349 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	103,050,515 - 103,063,748 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,413,766 - 101,426,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,413,766 - 101,426,852 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,493,176 - 102,506,380 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,894,029 - 95,906,885 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	95,972,140 - 95,985,010 (-)	NCBI
Celera	1	90,157,605 - 90,170,691 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

RUVBL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	48,993,448 - 49,015,995 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	48,993,562 - 49,015,970 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	49,496,705 - 49,519,252 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	54,188,968 - 54,210,994 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	54,188,967 - 54,210,994	NCBI
Celera	19	46,364,487 - 46,386,389 (+)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	45,873,862 - 45,895,902 (+)	NCBI		HuRef
CHM1_1	19	49,499,385 - 49,521,406 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	51,988,347 - 52,010,769 (+)	NCBI		T2T-CHM13v2.0

Ruvbl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	45,071,320 - 45,084,817 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	45,071,184 - 45,087,520 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,421,896 - 45,436,171 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,421,760 - 45,438,096 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,677,268 - 52,689,834 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	45,290,000 - 45,302,337 (-)	NCBI		MGSCv36	mm8
Celera	7	40,877,932 - 40,890,498 (-)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.3	NCBI

Ruvbl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,654,059 - 1,674,272 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,657,241 - 1,674,272 (-)	NCBI	ChiLan1.0	ChiLan1.0

RUVBL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	57,025,412 - 57,047,842 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	45,995,394 - 46,017,835 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	54,739,474 - 54,761,407 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	54,739,474 - 54,761,407 (-)	Ensembl	panpan1.1		panPan2

RUVBL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	107,384,328 - 107,400,849 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	107,384,342 - 107,400,505 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	106,910,707 - 106,923,430 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	107,908,904 - 107,925,482 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	107,908,893 - 107,925,182 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,576,740 - 107,593,066 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	107,222,909 - 107,239,405 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	108,058,521 - 108,075,019 (-)	NCBI		UU_Cfam_GSD_1.0

Ruvbl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,377,118 - 21,392,373 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	2,995,213 - 3,010,853 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936664	2,995,212 - 3,010,563 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RUVBL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,250,515 - 54,266,893 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	54,250,494 - 54,263,492 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	50,065,154 - 50,078,153 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RUVBL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	42,227,982 - 42,247,204 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	42,227,821 - 42,249,707 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	22,110,661 - 22,134,370 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ruvbl2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	5,014,484 - 5,028,885 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	5,014,484 - 5,028,868 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ruvbl2
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	100
Count of miRNA genes:	84
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000028217
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	94494440	117601394	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat

Markers in Region

RH141058

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	95,902,281 - 95,902,816 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	101,414,034 - 101,414,568	NCBI	Rnor6.0
Rnor_5.0	1	102,493,444 - 102,493,978	UniSTS	Rnor5.0
RGSC_v3.4	1	95,894,297 - 95,894,831	UniSTS	RGSC3.4
Celera	1	90,157,873 - 90,158,407	UniSTS
RH 3.4 Map	1	908.5	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	52	36	19	36	4	7	74	35	41	11	4
Low		7	5	5		5	4	4					4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM049444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000028217 ⟹ ENSRNOP00000028217

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	95,902,014 - 95,915,342 (-)	Ensembl
Rnor_6.0 Ensembl	1	101,413,766 - 101,426,852 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097056 ⟹ ENSRNOP00000079618

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	95,902,014 - 95,914,889 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111472 ⟹ ENSRNOP00000088524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	95,901,701 - 95,911,440 (-)	Ensembl

RefSeq Acc Id:

NM_001025405 ⟹ NP_001020576

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	95,902,014 - 95,915,247 (-)	NCBI
Rnor_6.0	1	101,413,766 - 101,426,852 (-)	NCBI
Rnor_5.0	1	102,493,176 - 102,506,380 (-)	NCBI
RGSC_v3.4	1	95,894,029 - 95,906,885 (-)	RGD
Celera	1	90,157,605 - 90,170,691 (-)	NCBI

Sequence:

show sequence

GCTAGGTAACGGGAGGAGGAGCAGGAGACGTCACGAACCCACCCTGGATTCAGAACACCCGCTT
TCCAATTTAGCCTCTCGGGTTGGGCGCGGTCTAGTGTACGCCCCCCAGGACAGTTTTACATAGT
TTATGAACCATAGAGATGACTGGATGACCGGGAGCCTAGAGAGCACGAAGGCCGCGCTCCTAGC
CCATTTCCGTTTCCGCTGAGGCATTGGCGGTTGGTGTGCATCATGGCAACCGTGGCAGCCACTA
CTAAAGTCCCTGAGATCCGAGATGTGACAAGAATCGAGCGAATCGGTGCTCACTCCCACATCCG
GGGCCTGGGACTGGATGATGCCCTGGAGCCAAGACAGGCTTCCCAGGGCATGGTGGGACAGCTA
GCTGCCCGGCGTGCAGCTGGCGTGGTGCTGGAGATGATCCGAGAAGGGAAGATTGCGGGGCGGG
CTGTCCTTATTGCTGGCCAGCCAGGCACAGGGAAGACAGCCATCGCCATGGGCATGGCCCAGGC
ATTGGGCCCCGACACACCGTTCACAGCCATCGCAGGCAGTGAGATCTTTTCTCTGGAGATGAGC
AAGACCGAGGCTCTAACACAAGCCTTCCGCCGTTCCATTGGTGTCCGTATCAAGGAGGAGACAG
AGATCATTGAAGGTGAGGTGGTGGAGATCCAGATTGATCGGCCAGCCACAGGCACGGGATCCAA
GGTGGGCAAACTGACTCTCAAGACCACGGAGATGGAGACCATCTACGATCTGGGTACCAAGATG
ATCGAGTCCCTGACCAAGGACAAGGTCCAGGCCGGGGACGTGATCACCATCGACAAGGCCACTG
GCAAGATTTCCAAGCTGGGCCGCTCTTTCACACGTGCCCGAGACTATGATGCCATGGGCTCCCA
GACCAAGTTTGTGCAGTGCCCAGACGGAGAGCTGCAAAAACGCAAGGAGGTGGTGCACACCGTG
TCCCTCCATGAGATTGACGTCATCAACTCCCGCACTCAGGGCTTCTTGGCTCTCTTCTCAGGAG
ACACAGGGGAGATCAAGTCAGAAGTCCGAGAACAGATCAATGCCAAGGTGGCAGAGTGGAGGGA
GGAGGGCAAAGCGGAGATCATCCCTGGGGTGCTGTTCATCGATGAGGTCCACATGCTGGACATT
GAGAGTTTCTCTTTCCTAAACCGGGCCCTGGAGAGTGACATGGCGCCTGTTCTTATCATGGCCA
CCAACCGAGGCATCACCCGGATCCGAGGCACCAGCTACCAAAGTCCCCACGGCATCCCCATTGA
CCTGCTAGACCGGCTGCTCATTGTGTCAACATCGCCCTACAGTGAGAAGGACACCAAACAGATC
CTACGTATCCGCTGTGAGGAGGAAGATGTGGAGATGAGTGAGGACGCCTACACAGTGCTGACCC
GCATTGGGCTCGAGACCTCCCTGCGCTACGCCATCCAGCTCATCACAGCGGCCAGCCTGGTGTG
CCGGAAACGAAAGGGCACGGAGGTGCAGGTGGACGACATCAAGCGCGTATACTCCCTCTTCCTG
GATGAATCCCGCTCCACACAGTACATGAAGGAATACCAGGACGCCTTCCTCTTCAATGAGCTCA
AAGGTGAAACAATGGACACCTCCTGAGCTGACACTGCACCCCAACCCTTCCCAGCCTGTTTTCT
ACAAGTTCTAACACTGTGACTTTGTATAAAATTATTGAAAACTGGA

hide sequence

RefSeq Acc Id:

XM_039105046 ⟹ XP_038960974

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	95,902,014 - 95,914,834 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020576	(Get FASTA)	NCBI Sequence Viewer
	XP_038960974	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98042	(Get FASTA)	NCBI Sequence Viewer
	EDM07354	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020576 ⟸ NM_001025405

- UniProtKB:

G3V8T5 (UniProtKB/TrEMBL), A6JB30 (UniProtKB/TrEMBL), Q4QQS4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATVAATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIR
EGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIG
VRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDV
ITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG
FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDM
APVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSE
DAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQD
AFLFNELKGETMDTS

hide sequence

RefSeq Acc Id:

ENSRNOP00000028217 ⟸ ENSRNOT00000028217

RefSeq Acc Id:	XP_038960974 ⟸ XM_039105046
- Peptide Label:	isoform X3
- UniProtKB:	G3V8T5 (UniProtKB/TrEMBL), Q4QQS4 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000079618 ⟸ ENSRNOT00000097056

RefSeq Acc Id:

ENSRNOP00000088524 ⟸ ENSRNOT00000111472

Protein Domains

AAA+ ATPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8T5-F1-model_v2	AlphaFold	G3V8T5	1-463	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306509	AgrOrtholog
BioCyc Gene	G2FUF-59685	BioCyc
Ensembl Genes	ENSRNOG00000020793	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000028217	ENTREZGENE
	ENSRNOP00000028217.5	UniProtKB/TrEMBL
	ENSRNOP00000079618	ENTREZGENE
	ENSRNOP00000079618.1	UniProtKB/TrEMBL
	ENSRNOP00000088524.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028217	ENTREZGENE
	ENSRNOT00000028217.7	UniProtKB/TrEMBL
	ENSRNOT00000097056	ENTREZGENE
	ENSRNOT00000097056.1	UniProtKB/TrEMBL
	ENSRNOT00000111472.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.60	UniProtKB/TrEMBL
	2.40.50.360	UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7129720	IMAGE-MGC_LOAD
	IMAGE:7457010	IMAGE-MGC_LOAD
InterPro	ATPase_AAA+_core	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	RuvB-like	UniProtKB/TrEMBL
	RuvB-like_C	UniProtKB/TrEMBL
	RUVBL2_DII	UniProtKB/TrEMBL
	TIP49_C	UniProtKB/TrEMBL
KEGG Report	rno:292907	UniProtKB/TrEMBL
MGC_CLONE	MGC:116199	IMAGE-MGC_LOAD
	MGC:95150	IMAGE-MGC_LOAD
NCBI Gene	292907	ENTREZGENE
PANTHER	PTHR11093	UniProtKB/TrEMBL
	PTHR11093:SF2	UniProtKB/TrEMBL
Pfam	TIP49	UniProtKB/TrEMBL
	TIP49_C	UniProtKB/TrEMBL
PharmGKB	RUVBL2	RGD
PhenoGen	Ruvbl2	PhenoGen
PRINTS	DNAREPAIRADA	UniProtKB/TrEMBL
SMART	AAA	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I5ZNN3_RAT	UniProtKB/TrEMBL
	A0A8I6AAZ0_RAT	UniProtKB/TrEMBL
	A6JB30	ENTREZGENE, UniProtKB/TrEMBL
	G3V8T5	ENTREZGENE, UniProtKB/TrEMBL
	Q4QQS4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-18	Ruvbl2	RuvB-like AAA ATPase 2	Ruvbl2	RuvB-like 2 (E. coli)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-30	Ruvbl2	RuvB-like 2 (E. coli)	Ruvbl2	RuvB-like protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Ruvbl2	RuvB-like protein 2	Ruvbl2	RuvB-like 2 (E. coli)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ruvbl2	RuvB-like 2 (E. coli)	Ruvbl2_predicted	RuvB-like 2 (E. coli) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ruvbl2_predicted	RuvB-like 2 (E. coli) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations