Symbol:
Naga
Name:
alpha-N-acetylgalactosaminidase
RGD ID:
1306025
Description:
Predicted to enable alpha-N-acetylgalactosaminidase activity; alpha-galactosidase activity; and protein homodimerization activity. Predicted to be involved in several processes, including glycolipid catabolic process; glycoside catabolic process; and oligosaccharide metabolic process. Predicted to be located in lysosome and membrane. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in Kanzaki disease; Schindler disease type 1; angiokeratoma; and neuroaxonal dystrophy. Orthologous to human NAGA (alpha-N-acetylgalactosaminidase); PARTICIPATES IN globoside metabolic pathway; INTERACTS WITH (+)-schisandrin B; 4,4'-sulfonyldiphenol; aconitine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha-galactosidase B; LOC315165; N-acetyl galactosaminidase, alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NAGA (alpha-N-acetylgalactosaminidase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Naga (N-acetyl galactosaminidase, alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Naga (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NAGA (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NAGA (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Naga (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NAGA (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NAGA (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Naga (alpha-N-acetylgalactosaminidase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SLC8A2 (solute carrier family 8 member A2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
NAGA (alpha-N-acetylgalactosaminidase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Naga (N-acetyl galactosaminidase, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
naga (N-acetylgalactosaminidase, alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gana-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5731
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7997
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
naga
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,726,438 - 115,735,494 (-) NCBI GRCr8 mRatBN7.2 7 113,846,358 - 113,855,430 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,846,374 - 113,855,315 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,602,301 - 115,610,513 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,825,818 - 117,834,032 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,795,268 - 117,803,480 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,563,047 - 123,572,074 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,563,059 - 123,572,082 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,547,766 - 123,556,889 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,706,129 - 120,714,429 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,740,375 - 120,748,659 (-) NCBI Celera 7 110,161,450 - 110,169,578 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Naga Rat (+)-catechin multiple interactions ISO NAGA (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of NAGA mRNA CTD PMID:24763279 Naga Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NAGA mRNA] CTD PMID:31150632 Naga Rat 17alpha-ethynylestradiol increases expression ISO Naga (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of NAGA mRNA CTD PMID:17942748 Naga Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO NAGA (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Naga Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Naga (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NAGA mRNA CTD PMID:21570461 Naga Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Naga (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NAGA mRNA CTD PMID:33956508 Naga Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO NAGA (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of NAGA protein CTD PMID:31675489 Naga Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NAGA mRNA CTD PMID:36041667 Naga Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of NAGA protein CTD PMID:33236894 Naga Rat acrylamide decreases expression ISO NAGA (Homo sapiens) 6480464 Acrylamide results in decreased expression of NAGA mRNA CTD PMID:32763439 Naga Rat aflatoxin B1 increases methylation ISO NAGA (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of NAGA intron CTD PMID:30157460 Naga Rat all-trans-retinoic acid increases expression ISO NAGA (Homo sapiens) 6480464 Tretinoin results in increased expression of NAGA mRNA CTD PMID:33167477 Naga Rat antirheumatic drug decreases expression ISO NAGA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NAGA mRNA CTD PMID:24449571 Naga Rat aristolochic acid A decreases expression ISO NAGA (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NAGA mRNA CTD PMID:33212167 Naga Rat arsane multiple interactions ISO NAGA (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NAGA mRNA CTD PMID:39836092 Naga Rat arsenic atom multiple interactions ISO NAGA (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NAGA mRNA CTD PMID:39836092 Naga Rat benzo[a]pyrene affects methylation ISO NAGA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NAGA exon CTD PMID:27901495 Naga Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NAGA mRNA CTD PMID:25181051 Naga Rat bisphenol A increases expression ISO NAGA (Homo sapiens) 6480464 bisphenol A results in increased expression of NAGA protein CTD PMID:34186270 and PMID:37567409 Naga Rat bisphenol A affects expression ISO Naga (Mus musculus) 6480464 bisphenol A affects the expression of NAGA mRNA CTD PMID:35341816 Naga Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NAGA mRNA CTD PMID:36041667 Naga Rat bisphenol A decreases expression ISO NAGA (Homo sapiens) 6480464 bisphenol A results in decreased expression of NAGA protein CTD PMID:31675489 Naga Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NAGA mRNA CTD PMID:30816183 more ... Naga Rat bisphenol AF increases expression ISO NAGA (Homo sapiens) 6480464 bisphenol AF results in increased expression of NAGA protein CTD PMID:34186270 Naga Rat Bisphenol B increases expression ISO NAGA (Homo sapiens) 6480464 bisphenol B results in increased expression of NAGA protein CTD PMID:34186270 Naga Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of NAGA mRNA CTD PMID:36041667 Naga Rat butanal decreases expression ISO NAGA (Homo sapiens) 6480464 butyraldehyde results in decreased expression of NAGA mRNA CTD PMID:26079696 Naga Rat Calcimycin affects activity EXP 6480464 Calcimycin affects the activity of NAGA protein CTD PMID:18475545 Naga Rat carbon nanotube multiple interactions ISO Naga (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of NAGA protein CTD PMID:34864091 Naga Rat CGP 52608 multiple interactions ISO NAGA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NAGA gene] CTD PMID:28238834 Naga Rat chlorpyrifos increases expression ISO Naga (Mus musculus) 6480464 Chlorpyrifos results in increased expression of NAGA mRNA CTD PMID:37019170 Naga Rat chromium(6+) affects expression ISO Naga (Mus musculus) 6480464 chromium hexavalent ion affects the expression of NAGA mRNA CTD PMID:28472532 Naga Rat cisplatin increases expression ISO NAGA (Homo sapiens) 6480464 Cisplatin results in increased expression of NAGA mRNA CTD PMID:27594783 Naga Rat cisplatin multiple interactions ISO NAGA (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NAGA mRNA CTD PMID:27392435 Naga Rat clofibrate multiple interactions ISO Naga (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of NAGA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NAGA mRNA] CTD PMID:17585979 Naga Rat cobalt dichloride decreases expression ISO NAGA (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NAGA mRNA CTD PMID:19320972 Naga Rat copper(II) sulfate decreases expression ISO NAGA (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NAGA mRNA CTD PMID:19549813 Naga Rat crocidolite asbestos increases expression ISO Naga (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of NAGA mRNA CTD PMID:29279043 Naga Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of NAGA mRNA CTD PMID:26577399 Naga Rat cyclosporin A decreases expression ISO NAGA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NAGA mRNA CTD PMID:20106945 and PMID:25562108 Naga Rat DDE increases expression ISO NAGA (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NAGA mRNA CTD PMID:38568856 Naga Rat decabromodiphenyl ether decreases expression ISO NAGA (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of NAGA protein CTD PMID:31675489 Naga Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NAGA mRNA CTD PMID:21266533 Naga Rat dibutyl phthalate multiple interactions ISO Naga (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Nanotubes and Carbon] results in decreased expression of NAGA protein CTD PMID:34864091 Naga Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NAGA mRNA CTD PMID:24136188 Naga Rat formaldehyde decreases expression ISO NAGA (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NAGA mRNA CTD PMID:23649840 Naga Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of NAGA mRNA CTD PMID:24136188 Naga Rat lead diacetate increases expression ISO Naga (Mus musculus) 6480464 lead acetate results in increased expression of NAGA mRNA CTD PMID:21829687 Naga Rat methyl methanesulfonate decreases expression ISO NAGA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NAGA mRNA CTD PMID:23649840 Naga Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of NAGA mRNA CTD PMID:24136188 Naga Rat nickel atom decreases expression ISO NAGA (Homo sapiens) 6480464 Nickel results in decreased expression of NAGA mRNA CTD PMID:23195993 Naga Rat nickel atom increases expression ISO NAGA (Homo sapiens) 6480464 Nickel results in increased expression of NAGA mRNA CTD PMID:25583101 Naga Rat ochratoxin A decreases expression ISO NAGA (Homo sapiens) 6480464 ochratoxin A results in decreased expression of NAGA mRNA CTD PMID:19287073 Naga Rat paracetamol multiple interactions ISO Naga (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of NAGA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NAGA mRNA] CTD PMID:17585979 Naga Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NAGA mRNA CTD PMID:33387578 Naga Rat paracetamol increases expression ISO NAGA (Homo sapiens) 6480464 Acetaminophen results in increased expression of NAGA mRNA CTD PMID:22230336 Naga Rat pirinixic acid multiple interactions ISO NAGA (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NAGA mRNA CTD PMID:19710929 Naga Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of NAGA mRNA CTD PMID:19162173 Naga Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of NAGA protein CTD PMID:35544339 Naga Rat sodium arsenite affects methylation ISO NAGA (Homo sapiens) 6480464 sodium arsenite affects the methylation of NAGA gene CTD PMID:28589171 Naga Rat sodium arsenite multiple interactions ISO NAGA (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NAGA mRNA CTD PMID:39836092 Naga Rat sodium dichromate decreases expression ISO NAGA (Homo sapiens) 6480464 sodium bichromate results in decreased expression of NAGA mRNA CTD PMID:17685462 Naga Rat sodium fluoride decreases expression ISO Naga (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of NAGA protein CTD PMID:28918527 Naga Rat Soman increases expression EXP 6480464 Soman results in increased expression of NAGA mRNA CTD PMID:19281266 Naga Rat sunitinib decreases expression ISO NAGA (Homo sapiens) 6480464 Sunitinib results in decreased expression of NAGA mRNA CTD PMID:31533062 Naga Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NAGA mRNA] CTD PMID:31150632 Naga Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NAGA mRNA CTD PMID:31150632 Naga Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NAGA mRNA CTD PMID:23411599 and PMID:34492290 Naga Rat titanium dioxide decreases methylation ISO Naga (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NAGA promoter alternative form CTD PMID:35295148 Naga Rat tungsten increases expression ISO Naga (Mus musculus) 6480464 Tungsten results in increased expression of NAGA mRNA CTD PMID:30912803 Naga Rat valproic acid affects expression ISO NAGA (Homo sapiens) 6480464 Valproic Acid affects the expression of NAGA mRNA CTD PMID:25979313 Naga Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NAGA mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (+)-schisandrin B (EXP) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (EXP) aconitine (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) butanal (ISO) Calcimycin (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP,ISO) flutamide (EXP) formaldehyde (ISO) glafenine (EXP) lead diacetate (ISO) methyl methanesulfonate (ISO) nefazodone (EXP) nickel atom (ISO) ochratoxin A (ISO) paracetamol (EXP,ISO) pirinixic acid (EXP,ISO) rotenone (EXP) sodium arsenite (ISO) sodium dichromate (ISO) sodium fluoride (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
Naga Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,726,438 - 115,735,494 (-) NCBI GRCr8 mRatBN7.2 7 113,846,358 - 113,855,430 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,846,374 - 113,855,315 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,602,301 - 115,610,513 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,825,818 - 117,834,032 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,795,268 - 117,803,480 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,563,047 - 123,572,074 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,563,059 - 123,572,082 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,547,766 - 123,556,889 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,706,129 - 120,714,429 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,740,375 - 120,748,659 (-) NCBI Celera 7 110,161,450 - 110,169,578 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
NAGA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 42,058,334 - 42,070,842 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 42,058,334 - 42,070,842 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 42,454,338 - 42,466,846 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 40,784,331 - 40,796,719 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 40,778,884 - 40,791,273 NCBI Celera 22 26,260,520 - 26,273,049 (-) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 25,420,503 - 25,433,033 (-) NCBI HuRef CHM1_1 22 42,414,453 - 42,426,959 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 42,537,918 - 42,550,425 (-) NCBI T2T-CHM13v2.0
Naga Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 82,213,746 - 82,222,983 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 82,213,733 - 82,223,126 (-) Ensembl GRCm39 Ensembl GRCm38 15 82,329,532 - 82,338,884 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 82,329,532 - 82,338,925 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 82,159,962 - 82,169,256 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 82,157,307 - 82,166,570 (-) NCBI MGSCv36 mm8 Celera 15 84,453,684 - 84,462,981 (-) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.56 NCBI
Naga Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 27,461,998 - 27,472,273 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 27,463,931 - 27,472,273 (-) NCBI ChiLan1.0 ChiLan1.0
NAGA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 51,888,980 - 51,901,548 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 54,588,144 - 54,600,693 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 22,951,723 - 22,964,278 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 41,035,622 - 41,046,431 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 41,035,622 - 41,046,431 (-) Ensembl panpan1.1 panPan2
NAGA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 23,303,950 - 23,312,409 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 23,304,354 - 23,396,068 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 23,236,291 - 23,248,260 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 24,046,730 - 24,058,681 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 24,048,856 - 24,140,741 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 23,764,333 - 23,776,295 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 24,085,173 - 24,097,124 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 24,259,163 - 24,271,114 (+) NCBI UU_Cfam_GSD_1.0
Naga
NAGA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 6,571,020 - 6,588,055 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 6,580,141 - 6,587,550 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 3,969,705 - 3,986,467 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NAGA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 24,589,133 - 24,607,753 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 24,592,409 - 24,607,682 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 100,787,749 - 100,800,152 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Naga
.
Predicted Target Of
Count of predictions: 282 Count of miRNA genes: 161 Interacting mature miRNAs: 186 Transcripts: ENSRNOT00000068020 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068020 ⟹ ENSRNOP00000060590
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,846,374 - 113,855,315 (-) Ensembl Rnor_6.0 Ensembl 7 123,563,059 - 123,572,082 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097900 ⟹ ENSRNOP00000096846
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,846,521 - 113,855,287 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107846 ⟹ ENSRNOP00000089333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,851,035 - 113,855,315 (-) Ensembl
RefSeq Acc Id:
NM_001012120 ⟹ NP_001012120
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,726,601 - 115,734,818 (-) NCBI mRatBN7.2 7 113,846,521 - 113,854,738 (-) NCBI Rnor_6.0 7 123,563,203 - 123,571,420 (-) NCBI Rnor_5.0 7 123,547,766 - 123,556,889 (-) NCBI RGSC_v3.4 7 120,706,129 - 120,714,429 (-) RGD Celera 7 110,161,450 - 110,169,578 (-) RGD
Sequence:
TAAAACTGATAAGAGCAGATTCGATTGGGTCCTGAGATTTGACTCCGAGGCAATGTTGCAGAAGACAGTGCTCTTACTGGCCCTGGTGGCTCAGGTACTGATGCTGGAGAATGGGCTACTGCGGACAC
hide sequence
RefSeq Acc Id:
XM_006242087 ⟹ XP_006242149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,726,438 - 115,735,437 (-) NCBI mRatBN7.2 7 113,846,358 - 113,855,391 (-) NCBI Rnor_6.0 7 123,563,047 - 123,572,060 (-) NCBI Rnor_5.0 7 123,547,766 - 123,556,889 (-) NCBI
Sequence:
TTGGGGCGCAGAGAGAGGGCACGGCGTTGCTAAGGGATTCTGATTGGTTGCTCAGAAAGGGTTGTCCGGTGACATTCCGCTTCCCCGGTCACTATAGGTACGTGCGGCCGCGGCGGGGGCTTCCAGGG
hide sequence
RefSeq Acc Id:
XM_006242088 ⟹ XP_006242150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,726,438 - 115,735,494 (-) NCBI mRatBN7.2 7 113,846,358 - 113,855,430 (-) NCBI Rnor_6.0 7 123,563,047 - 123,572,074 (-) NCBI Rnor_5.0 7 123,547,766 - 123,556,889 (-) NCBI
Sequence:
ATGGAGGCTGGGAGTTGGGGCGCAGAGAGAGGGCACGGCGTTGCTAAGGGATTCTGATTGGTTG
hide sequence
RefSeq Acc Id:
NP_001012120 ⟸ NM_001012120
- Peptide Label:
precursor
- UniProtKB:
Q66H12 (UniProtKB/Swiss-Prot), A6HT60 (UniProtKB/TrEMBL), A0A8I6B4W8 (UniProtKB/TrEMBL)
- Sequence:
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCM
hide sequence
RefSeq Acc Id:
XP_006242150 ⟸ XM_006242088
- Peptide Label:
isoform X1
- UniProtKB:
Q66H12 (UniProtKB/Swiss-Prot), A6HT60 (UniProtKB/TrEMBL), A0A8I6B4W8 (UniProtKB/TrEMBL)
- Sequence:
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMADRLAQ
hide sequence
RefSeq Acc Id:
XP_006242149 ⟸ XM_006242087
- Peptide Label:
isoform X1
- UniProtKB:
Q66H12 (UniProtKB/Swiss-Prot), A6HT60 (UniProtKB/TrEMBL), A0A8I6B4W8 (UniProtKB/TrEMBL)
- Sequence:
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNINCEEDPKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDATGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYEDMGKMTCM
hide sequence
Ensembl Acc Id:
ENSRNOP00000060590 ⟸ ENSRNOT00000068020
Ensembl Acc Id:
ENSRNOP00000089333 ⟸ ENSRNOT00000107846
Ensembl Acc Id:
ENSRNOP00000096846 ⟸ ENSRNOT00000097900
RGD ID: 13695532 Promoter ID: EPDNEW_R6057 Type: initiation region Name: Naga_1 Description: alpha-N-acetylgalactosaminidase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 123,571,970 - 123,572,030 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-05-18
Naga
alpha-N-acetylgalactosaminidase
Naga
N-acetyl galactosaminidase, alpha
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Naga
N-acetyl galactosaminidase, alpha
Naga_predicted
N-acetyl galactosaminidase, alpha (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Naga_predicted
N-acetyl galactosaminidase, alpha (predicted)
Symbol and Name status set to approved
70820 APPROVED
