Predicted to have signaling receptor binding activity. Predicted to be involved in immunoglobulin production in mucosal tissue; positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains; and positive regulation of cell population proliferation. Predicted to localize to cytoplasm; external side of plasma membrane; and extracellular space. Human ortholog(s) of this gene implicated in B-lymphoblastic leukemia/lymphoma. Orthologous to human TNFSF13 (TNF superfamily member 13); PARTICIPATES IN adaptive immune response pathway; cytokine mediated signaling pathway; rheumatoid arthritis pathway; INTERACTS WITH (+)-pilocarpine; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
[Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of TNFSF13 mRNA, [Dietary Carbohydrates co-treated with Acetaminophen] results in increased expression of TNFSF13 mRNA
MPASSPGNMGGSVREPALSVTLWLSWGAVLGAVTCAVALLIQQAELQSLRREVSRLQRSGGASQ KRGEPPWQSLWEQSPDVLGAWKDGAKSRRRRAVLTQKHKKKQSVLHLVPINITSKADSDMTEVM WQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMP SDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGGFVHCAKPYPLDCIQNSTT I
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin