Symbol:
Snu13 (Ensembl: Snu13-ps5)
Name:
small nuclear ribonucleoprotein 13 (Ensembl:small nuclear ribonucleoprotein 13, pseudogene 5)
RGD ID:
1303103
Description:
Predicted to enable ATPase binding activity and RNA binding activity. Predicted to contribute to snoRNA binding activity. Predicted to be involved in box C/D snoRNP assembly; mRNA splicing, via spliceosome; and maturation of SSU-rRNA. Predicted to act upstream of or within single fertilization. Predicted to be located in dense fibrillar component. Predicted to be part of several cellular components, including U2-type precatalytic spliceosome; box C/D methylation guide snoRNP complex; and spliceosomal snRNP complex. Predicted to be active in nucleolus. Orthologous to human SNU13 (small nuclear ribonucleoprotein 13); PARTICIPATES IN ribosome biogenesis pathway; spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
high mobility group-like nuclear protein 2 homolog 1; MGC72932; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); NHP2-like protein 1; Nhp2l1; Otk27; similar to NHP2-like protein 1 (High mobility group-like nuclear protein 2 homolog 1) ([U4/U6.U5] tri-snRNP 15.5 kDa protein) (OTK27); SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5); U4/U6.U5 small nuclear ribonucleoprotein SNU13; U4/U6.U5 tri-snRNP 15.5 kDa protein; U4/U6.U5] tri-snRNP 15.5 kDa protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Snu13-ps5
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,445,415 - 115,451,008 (-) NCBI GRCr8 mRatBN7.2 7 113,565,293 - 113,570,887 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,565,295 - 113,570,872 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 1 259,715,711 - 259,716,758 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,321,804 - 115,327,398 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,545,304 - 117,550,897 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,514,748 - 117,520,342 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,282,754 - 123,287,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,282,754 - 123,287,721 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,267,419 - 123,272,386 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,425,064 - 120,430,031 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,459,293 - 120,464,261 (-) NCBI Celera 7 109,881,746 - 109,886,713 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Snu13 Rat (1->4)-beta-D-glucan multiple interactions ISO Snu13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SNU13 mRNA CTD PMID:36331819 Snu13 Rat 1,2-dimethylhydrazine multiple interactions ISO Snu13 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SNU13 mRNA CTD PMID:22206623 Snu13 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO SNU13 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to SNU13 protein CTD PMID:32991956 Snu13 Rat 17alpha-ethynylestradiol multiple interactions ISO Snu13 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNU13 mRNA CTD PMID:17942748 Snu13 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Snu13 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Snu13 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Snu13 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SNU13 mRNA CTD PMID:21570461 Snu13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SNU13 mRNA CTD PMID:33387578 Snu13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Snu13 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SNU13 mRNA CTD PMID:21354282 Snu13 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Snu13 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SNU13 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to SNU13 promoter] CTD PMID:17942748 and PMID:19654925 Snu13 Rat 2-hydroxypropanoic acid decreases expression ISO SNU13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNU13 mRNA CTD PMID:30851411 Snu13 Rat 4,4'-sulfonyldiphenol increases expression ISO Snu13 (Mus musculus) 6480464 bisphenol S results in increased expression of SNU13 mRNA CTD PMID:39298647 Snu13 Rat 4,4'-sulfonyldiphenol increases expression ISO SNU13 (Homo sapiens) 6480464 bisphenol S results in increased expression of SNU13 protein CTD PMID:34186270 Snu13 Rat 5-azacytidine increases expression ISO SNU13 (Homo sapiens) 6480464 Azacitidine results in increased expression of SNU13 mRNA CTD PMID:20823114 Snu13 Rat acrolein multiple interactions ISO SNU13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNU13 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNU13 mRNA CTD PMID:32699268 Snu13 Rat alpha-pinene multiple interactions ISO SNU13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNU13 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of SNU13 mRNA CTD PMID:32699268 Snu13 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SNU13 mRNA CTD PMID:16483693 Snu13 Rat arsane affects expression ISO SNU13 (Homo sapiens) 6480464 Arsenic affects the expression of SNU13 mRNA CTD PMID:18414638 Snu13 Rat arsenic atom affects expression ISO SNU13 (Homo sapiens) 6480464 Arsenic affects the expression of SNU13 mRNA CTD PMID:18414638 Snu13 Rat arsenite(3-) multiple interactions ISO SNU13 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to SNU13 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to SNU13 protein] CTD PMID:32406909 Snu13 Rat arsenous acid decreases expression ISO SNU13 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SNU13 protein CTD PMID:25419056 Snu13 Rat benzo[a]pyrene increases expression ISO Snu13 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SNU13 mRNA CTD PMID:22228805 Snu13 Rat benzo[a]pyrene increases methylation ISO SNU13 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SNU13 3' UTR CTD PMID:27901495 Snu13 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SNU13 mRNA CTD PMID:25181051 Snu13 Rat bisphenol A decreases expression ISO SNU13 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SNU13 protein CTD PMID:34186270 Snu13 Rat butan-1-ol multiple interactions ISO SNU13 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of SNU13 mRNA CTD PMID:29432896 Snu13 Rat carbon nanotube increases expression ISO Snu13 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SNU13 mRNA CTD PMID:25554681 Snu13 Rat CGP 52608 multiple interactions ISO SNU13 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SNU13 gene] CTD PMID:28238834 Snu13 Rat choline multiple interactions ISO Snu13 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SNU13 gene CTD PMID:20938992 Snu13 Rat chromium(6+) affects expression ISO Snu13 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of SNU13 mRNA CTD PMID:28472532 Snu13 Rat cobalt dichloride decreases expression ISO SNU13 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SNU13 mRNA CTD PMID:19320972 Snu13 Rat decabromodiphenyl ether decreases expression ISO SNU13 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SNU13 protein CTD PMID:31675489 Snu13 Rat diarsenic trioxide decreases expression ISO SNU13 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SNU13 protein CTD PMID:25419056 Snu13 Rat disodium selenite increases expression ISO SNU13 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SNU13 mRNA CTD PMID:18175754 Snu13 Rat elemental selenium increases expression ISO SNU13 (Homo sapiens) 6480464 Selenium results in increased expression of SNU13 mRNA CTD PMID:19244175 Snu13 Rat emodin decreases expression ISO Snu13 (Mus musculus) 6480464 Emodin results in decreased expression of SNU13 mRNA CTD PMID:15612046 Snu13 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SNU13 mRNA CTD PMID:29391264 Snu13 Rat ethyl methanesulfonate decreases expression ISO SNU13 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of SNU13 mRNA CTD PMID:23649840 Snu13 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SNU13 mRNA CTD PMID:24136188 Snu13 Rat folic acid multiple interactions ISO Snu13 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Snu13 Rat FR900359 increases phosphorylation ISO SNU13 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SNU13 protein CTD PMID:37730182 Snu13 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SNU13 mRNA CTD PMID:24136188 Snu13 Rat hydralazine multiple interactions ISO SNU13 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SNU13 mRNA CTD PMID:17183730 Snu13 Rat ivermectin decreases expression ISO SNU13 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SNU13 protein CTD PMID:32959892 Snu13 Rat L-methionine multiple interactions ISO Snu13 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of SNU13 gene CTD PMID:20938992 Snu13 Rat lead(0) decreases expression ISO SNU13 (Homo sapiens) 6480464 Lead results in decreased expression of SNU13 mRNA CTD PMID:19921347 Snu13 Rat methyl methanesulfonate decreases expression ISO SNU13 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SNU13 mRNA CTD PMID:23649840 Snu13 Rat miconazole increases expression ISO Snu13 (Mus musculus) 6480464 Miconazole results in increased expression of SNU13 mRNA CTD PMID:27462272 Snu13 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SNU13 mRNA CTD PMID:24136188 Snu13 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of SNU13 mRNA CTD PMID:24136188 Snu13 Rat ozone multiple interactions ISO SNU13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of SNU13 mRNA more ... CTD PMID:32699268 Snu13 Rat pentachlorophenol increases expression ISO Snu13 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of SNU13 mRNA CTD PMID:23892564 Snu13 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Snu13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SNU13 mRNA CTD PMID:36331819 Snu13 Rat propiconazole increases expression ISO Snu13 (Mus musculus) 6480464 propiconazole results in increased expression of SNU13 mRNA CTD PMID:21278054 Snu13 Rat quinolin-8-ol decreases expression ISO Snu13 (Mus musculus) 6480464 Oxyquinoline results in decreased expression of SNU13 mRNA CTD PMID:15612046 Snu13 Rat rac-lactic acid decreases expression ISO SNU13 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SNU13 mRNA CTD PMID:30851411 Snu13 Rat rotenone increases expression ISO Snu13 (Mus musculus) 6480464 Rotenone results in increased expression of SNU13 mRNA CTD PMID:32937126 Snu13 Rat SB 431542 multiple interactions ISO SNU13 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of SNU13 protein CTD PMID:37664457 Snu13 Rat selenium atom increases expression ISO SNU13 (Homo sapiens) 6480464 Selenium results in increased expression of SNU13 mRNA CTD PMID:19244175 Snu13 Rat sodium arsenite decreases expression ISO SNU13 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SNU13 mRNA CTD PMID:38568856 Snu13 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SNU13 mRNA CTD PMID:19281266 Snu13 Rat T-2 toxin increases expression ISO SNU13 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of SNU13 mRNA CTD PMID:34581912 Snu13 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SNU13 mRNA CTD PMID:31150632 Snu13 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SNU13 mRNA CTD PMID:33387578 Snu13 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SNU13 mRNA CTD PMID:34492290 Snu13 Rat thiram decreases expression ISO SNU13 (Homo sapiens) 6480464 Thiram results in decreased expression of SNU13 mRNA CTD PMID:38568856 Snu13 Rat titanium dioxide decreases methylation ISO Snu13 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NHP2L1 gene CTD PMID:35295148 Snu13 Rat trimellitic anhydride increases expression ISO Snu13 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of SNU13 mRNA CTD PMID:19042947 Snu13 Rat tungsten increases expression ISO Snu13 (Mus musculus) 6480464 Tungsten results in increased expression of SNU13 mRNA CTD PMID:30912803 Snu13 Rat valproic acid multiple interactions ISO SNU13 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SNU13 mRNA CTD PMID:17183730 Snu13 Rat valproic acid increases methylation ISO SNU13 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SNU13 gene CTD PMID:29154799 Snu13 Rat valproic acid affects expression ISO SNU13 (Homo sapiens) 6480464 Valproic Acid affects the expression of SNU13 mRNA CTD PMID:25979313 Snu13 Rat vincristine decreases expression ISO SNU13 (Homo sapiens) 6480464 Vincristine results in decreased expression of SNU13 mRNA CTD PMID:23649840 Snu13 Rat vitamin E increases expression ISO SNU13 (Homo sapiens) 6480464 Vitamin E results in increased expression of SNU13 mRNA CTD PMID:19244175 Snu13 Rat Yessotoxin decreases expression ISO SNU13 (Homo sapiens) 6480464 yessotoxin analog results in decreased expression of SNU13 mRNA CTD PMID:30679557
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) acrolein (ISO) alpha-pinene (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) cobalt dichloride (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) disodium selenite (ISO) elemental selenium (ISO) emodin (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) glafenine (EXP) hydralazine (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) miconazole (ISO) nefazodone (EXP) nimesulide (EXP) ozone (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) propiconazole (ISO) quinolin-8-ol (ISO) rac-lactic acid (ISO) rotenone (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) Soman (EXP) T-2 toxin (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) tungsten (ISO) valproic acid (ISO) vincristine (ISO) vitamin E (ISO) Yessotoxin (ISO)
Cellular Component
box C/D methylation guide snoRNP complex (IBA,ISO) dense fibrillar component (ISO) nucleolus (IBA,IEA,ISO) nucleus (IEA,ISO,ISS) precatalytic spliceosome (IBA) protein-containing complex (ISO) ribonucleoprotein complex (IEA) small-subunit processome (IBA,ISO,ISS) spliceosomal complex (IEA) U2-type precatalytic spliceosome (ISO,ISS) U4/U6 x U5 tri-snRNP complex (IBA,ISO,ISS) U4atac snRNP (ISO,ISS)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
3.
GOA pipeline
RGD automated data pipeline
4.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Comprehensive gene review and curation
RGD comprehensive gene curation
7.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.
The spliceosome: design principles of a dynamic RNP machine.
Wahl MC, etal., Cell. 2009 Feb 20;136(4):701-18. doi: 10.1016/j.cell.2009.02.009.
9.
The box C/D and H/ACA snoRNPs: key players in the modification, processing and the dynamic folding of ribosomal RNA.
Watkins NJ and Bohnsack MT, Wiley Interdiscip Rev RNA. 2012 May-Jun;3(3):397-414. doi: 10.1002/wrna.117. Epub 2011 Nov 7.
Snu13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 115,445,415 - 115,451,008 (-) NCBI GRCr8 mRatBN7.2 7 113,565,293 - 113,570,887 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 113,565,295 - 113,570,872 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 1 259,715,711 - 259,716,758 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 115,321,804 - 115,327,398 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 117,545,304 - 117,550,897 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 117,514,748 - 117,520,342 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 123,282,754 - 123,287,721 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 123,282,754 - 123,287,721 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 123,267,419 - 123,272,386 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 120,425,064 - 120,430,031 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 120,459,293 - 120,464,261 (-) NCBI Celera 7 109,881,746 - 109,886,713 (-) NCBI Celera Cytogenetic Map 7 q34 NCBI
SNU13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 41,673,933 - 41,690,480 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 41,673,933 - 41,690,504 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 42,069,937 - 42,084,871 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 40,399,883 - 40,414,859 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 40,394,437 - 40,403,056 NCBI Celera 22 25,876,373 - 25,891,348 (-) NCBI Celera Cytogenetic Map 22 q13.2 NCBI HuRef 22 25,035,346 - 25,050,319 (-) NCBI HuRef CHM1_1 22 42,029,949 - 42,044,925 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 42,152,913 - 42,169,470 (-) NCBI T2T-CHM13v2.0
Snu13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 81,925,546 - 81,931,799 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 81,924,726 - 81,931,799 (-) Ensembl GRCm39 Ensembl GRCm38 15 82,041,345 - 82,047,598 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 82,040,525 - 82,047,598 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 81,871,775 - 81,878,028 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 81,868,600 - 81,874,853 (-) NCBI MGSCv36 mm8 Celera 15 84,163,054 - 84,169,281 (-) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 38.38 NCBI
Snu13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 27,159,816 - 27,172,696 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 27,160,985 - 27,172,648 (-) NCBI ChiLan1.0 ChiLan1.0
SNU13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 51,503,689 - 51,518,666 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 54,203,002 - 54,217,985 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 22,567,285 - 22,582,257 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 40,653,338 - 40,668,216 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 40,653,338 - 40,669,706 (-) Ensembl panpan1.1 panPan2
SNU13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 23,622,897 - 23,631,526 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 23,618,293 - 23,631,004 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 23,556,457 - 23,564,953 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 24,367,888 - 24,376,525 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 24,363,290 - 24,376,531 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 24,084,805 - 24,093,434 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 24,405,729 - 24,414,316 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 24,580,074 - 24,588,705 (+) NCBI UU_Cfam_GSD_1.0
Snu13
SNU13 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 6,885,067 - 6,900,022 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 6,891,014 - 6,900,026 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 4,262,171 - 4,271,206 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SNU13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 24,209,356 - 24,223,431 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 24,206,653 - 24,216,686 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 101,189,312 - 101,204,220 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Snu13
.
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH127396
Rat Assembly Chr Position (strand) Source JBrowse Celera 1 131,588,987 - 131,589,177 UniSTS Celera 7 109,881,290 - 109,881,505 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
12
57
140
117
114
69
34
69
12
273
127
108
51
84
45
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009152 ⟹ ENSRNOP00000009152
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 113,565,295 - 113,570,872 (-) Ensembl Rnor_6.0 Ensembl 7 123,282,754 - 123,287,721 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000030108 ⟹ ENSRNOP00000051559
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 259,715,711 - 259,716,758 (+) Ensembl
RefSeq Acc Id:
NM_212515 ⟹ NP_997680
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 115,445,415 - 115,451,008 (-) NCBI mRatBN7.2 7 113,565,293 - 113,570,887 (-) NCBI Rnor_6.0 7 123,282,754 - 123,287,721 (-) NCBI Rnor_5.0 7 123,267,419 - 123,272,386 (-) NCBI RGSC_v3.4 7 120,425,064 - 120,430,031 (-) RGD Celera 7 109,881,746 - 109,886,713 (-) RGD
Sequence:
CTTCCGCTCCCGCCACTCCTGGAGTGGTTTCCGCTGCTTTTTCTGCGCGACGTTTCTGTCTGTCTGAGGTGGGCTGTTGTGAAGTCTCGGTGAGGCCTGCGCACCGCAGCCATGACGGAGGCTGATGT
hide sequence
RefSeq Acc Id:
NP_997680 ⟸ NM_212515
- UniProtKB:
Q6PDV0 (UniProtKB/Swiss-Prot), P55770 (UniProtKB/Swiss-Prot), A6HT44 (UniProtKB/TrEMBL), A6HT43 (UniProtKB/TrEMBL)
- Sequence:
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000009152 ⟸ ENSRNOT00000009152
Ensembl Acc Id:
ENSRNOP00000051559 ⟸ ENSRNOT00000030108
RGD ID: 13695526 Promoter ID: EPDNEW_R6050 Type: initiation region Name: Snu13_1 Description: small nuclear ribonucleoprotein 13 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 123,287,707 - 123,287,767 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-27
Snu13
small nuclear ribonucleoprotein 13
Snu13
SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-16
Snu13
SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
Nhp2l1
NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-23
Nhp2l1
NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
MGC72932
similar to NHP2-like protein 1 (High mobility group-like nuclear protein 2 homolog 1) ([U4/U6.U5] tri-snRNP 15.5 kDa protein) (OTK27)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-30
MGC72932
Symbol and Name status set to provisional
70820 PROVISIONAL
