Advanced Search (OLGA)

Gene: Eif3h (eukaryotic translation initiation factor 3, subunit H) Rattus norvegicus

Analyze

Symbol:

Eif3h

Name:

eukaryotic translation initiation factor 3, subunit H

RGD ID:

735178

Description:

Predicted to enable metal-dependent deubiquitinase activity. Predicted to contribute to translation initiation factor activity. Predicted to be involved in negative regulation of proteasomal ubiquitin-dependent protein catabolic process and translational initiation. Predicted to be located in cytoplasm. Predicted to be part of eukaryotic 43S preinitiation complex and eukaryotic translation initiation factor 3 complex, eIF3m. Human ortholog(s) of this gene implicated in breast cancer; prostate cancer; and prostate carcinoma. Orthologous to human EIF3H (eukaryotic translation initiation factor 3 subunit H); PARTICIPATES IN translation initiation pathway; measles pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; benzo[a]pyrene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

eIF-3 gamma; eIF-3-gamma; eIF3 p40 subunit; Eif3s3; eukaryotic translation initiation factor 3 subunit 3; eukaryotic translation initiation factor 3 subunit H; eukaryotic translation initiation factor 3, subunit 3 gamma; eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa; LOC108348062; MGC72941

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	84,980,891 - 85,064,284 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	84,980,891 - 85,071,546 (-)	Ensembl				GRCr8
mRatBN7.2	7	83,091,037 - 83,174,451 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,091,039 - 83,174,451 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	84,986,868 - 85,070,126 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,188,085 - 87,271,343 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,015,192 - 87,098,341 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	10,151,732 - 10,236,677 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	108,745,895 - 108,756,130 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	6	10,151,729 - 10,236,695 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	6	10,151,729 - 10,236,695 (+)	NCBI			rn6	Rnor6.0
Rnor_5.0	6	116,806,338 - 116,856,511 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	6	116,798,908 - 116,803,475 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	88,069,668 - 88,154,285 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	79,969,394 - 80,052,871 (-)	NCBI		Celera
RGSC_v3.1	7	88,090,397 - 88,175,015 (-)	NCBI
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

breast cancer (ISO)

Colorectal Neoplasms (ISO)

hepatocellular carcinoma (ISO)

prostate cancer (ISO)

prostate carcinoma (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-fluorouracil (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzatropine (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Butylbenzyl phthalate (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

clofibric acid (EXP)

cyclosporin A (ISO)

D-glucitol (ISO)

dibutyl phthalate (EXP)

disodium selenite (ISO)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

ivermectin (ISO)

Mesaconitine (EXP)

methylmercury chloride (ISO)

methylparaben (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nickel subsulfide (EXP)

nitrates (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

rotenone (EXP)

SB 431542 (ISO)

serpentine asbestos (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cytoplasmic translational initiation (IEA)

formation of cytoplasmic translation initiation complex (IEA)

negative regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO)

translation (IEA)

translational initiation (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA)

eukaryotic 43S preinitiation complex (IBA,IEA)

eukaryotic 48S preinitiation complex (IEA)

eukaryotic translation initiation factor 3 complex (IBA,IEA,ISO,ISS)

eukaryotic translation initiation factor 3 complex, eIF3m (IEA,ISO)

Molecular Function

metal-dependent deubiquitinase activity (IEA,ISO)

metallopeptidase activity (IBA,IEA)

peptidase activity (IEA)

protein binding (ISO)

translation initiation factor activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

measles pathway (IEA)

RNA transport pathway (IEA)

translation initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structure of initiation factor eIF-3 from rat liver. Hydrodynamic and electron microscopic investigations.	Behlke J, etal., Eur J Biochem. 1986 Jun 16;157(3):523-30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	The scanning mechanism of eukaryotic translation initiation.	Hinnebusch AG Annu Rev Biochem. 2014;83:779-812. doi: 10.1146/annurev-biochem-060713-035802. Epub 2014 Jan 29.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Amplification and overexpression of p40 subunit of eukaryotic translation initiation factor 3 in breast and prostate cancer.	Nupponen NN, etal., Am J Pathol. 1999 Jun;154(6):1777-83.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Information Derived from GenBank Report	RGD, Sept. 2003
12.	Amplification of EIF3S3 gene is associated with advanced stage in prostate cancer.	Saramaki O, etal., Am J Pathol. 2001 Dec;159(6):2089-94.
13.	Expression and copy number analysis of TRPS1, EIF3S3 and MYC genes in breast and prostate cancer.	Savinainen KJ, etal., Br J Cancer. 2004 Mar 8;90(5):1041-6.
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:17322308	PMID:17581632	PMID:18599441	PMID:19056867	PMID:19946888	PMID:22658674	PMID:24003236	PMID:25849773

Genomics

Comparative Map Data

Eif3h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	84,980,891 - 85,064,284 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	84,980,891 - 85,071,546 (-)	Ensembl				GRCr8
mRatBN7.2	7	83,091,037 - 83,174,451 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,091,039 - 83,174,451 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	84,986,868 - 85,070,126 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,188,085 - 87,271,343 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,015,192 - 87,098,341 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	10,151,732 - 10,236,677 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	108,745,895 - 108,756,130 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	6	10,151,729 - 10,236,695 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	6	10,151,729 - 10,236,695 (+)	NCBI			rn6	Rnor6.0
Rnor_5.0	6	116,806,338 - 116,856,511 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	6	116,798,908 - 116,803,475 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	88,069,668 - 88,154,285 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	79,969,394 - 80,052,871 (-)	NCBI		Celera
RGSC_v3.1	7	88,090,397 - 88,175,015 (-)	NCBI
Cytogenetic Map	7	q31	NCBI

EIF3H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	116,642,130 - 116,766,374 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	116,642,130 - 116,766,925 (-)	Ensembl			hg38	GRCh38
GRCh37	8	117,654,369 - 117,768,062 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	117,726,236 - 117,837,243 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	117,726,266 - 117,837,222	NCBI
Celera	8	113,843,130 - 113,956,776 (-)	NCBI		Celera
Cytogenetic Map	8	q23.3-q24.11	NCBI
HuRef	8	112,983,503 - 113,094,395 (-)	NCBI		HuRef
CHM1_1	8	117,697,603 - 117,808,219 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	117,769,451 - 117,883,944 (-)	NCBI		T2T-CHM13v2.0

Eif3h
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	51,649,956 - 51,728,901 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	51,649,954 - 51,728,919 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	51,786,563 - 51,865,461 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	51,786,558 - 51,865,523 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	51,618,109 - 51,697,007 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	51,616,637 - 51,695,535 (-)	NCBI		MGSCv36	mm8
Celera	15	53,359,320 - 53,438,134 (-)	NCBI		Celera
Cytogenetic Map	15	C	NCBI
cM Map	15	19.42	NCBI

Eif3h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	22,754,395 - 22,846,618 (-)	Ensembl
ChiLan1.0	NW_004955417	22,757,781 - 22,846,349 (-)	NCBI	ChiLan1.0	ChiLan1.0

EIF3H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	134,048,331 - 134,158,684 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	109,567,521 - 109,677,808 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	113,320,059 - 113,440,769 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	115,863,493 - 115,984,107 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	115,863,490 - 115,973,872 (-)	Ensembl			panPan2	panpan1.1

EIF3H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	16,105,960 - 16,201,902 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	16,105,990 - 16,341,153 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	16,107,272 - 16,203,193 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	16,393,919 - 16,489,878 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	16,393,949 - 16,490,038 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	16,139,289 - 16,233,993 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	16,238,566 - 16,334,288 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	16,479,179 - 16,575,072 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eif3h
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	22,083,049 - 22,180,007 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	29,509,151 - 29,606,124 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	29,509,154 - 29,606,124 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF3H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	21,954,874 - 22,058,699 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	21,955,026 - 22,053,683 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	23,327,980 - 23,448,893 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF3H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	111,283,184 - 111,390,835 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666039	28,934,660 - 29,042,760 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif3h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	14,935,271 - 15,027,010 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	14,938,624 - 15,027,001 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eif3h
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	226,436,509 - 226,519,401 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Eif3h
312 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	95
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000005786
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	82111245	96700643	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	82111245	95485241	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

D7Rat86

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	85,043,242 - 85,043,362 (+)	Marker Load Pipeline
mRatBN7.2	7	83,153,392 - 83,153,512 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	10,173,862 - 10,173,981	NCBI	Rnor6.0
Rnor_6.0	6	108,696,796 - 108,696,915	NCBI	Rnor6.0
Rnor_5.0	6	116,858,276 - 116,858,395	UniSTS	Rnor5.0
Rnor_5.0	6	20,168,871 - 20,168,990	UniSTS	Rnor5.0
RGSC_v3.4	7	88,132,195 - 88,132,315	RGD	RGSC3.4
RGSC_v3.4	7	88,132,196 - 88,132,315	UniSTS	RGSC3.4
Celera	7	80,031,740 - 80,031,859	UniSTS
RGSC_v3.1	7	88,152,926 - 88,153,045	RGD
RH 3.4 Map	7	545.2	RGD
RH 3.4 Map	7	545.2	UniSTS
RH 2.0 Map	7	472.9	RGD
SHRSP x BN Map	7	50.08	RGD
FHH x ACI Map	7	40.04	RGD
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213876	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220633	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005786 ⟹ ENSRNOP00000005786

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	84,980,891 - 85,041,997 (-)	Ensembl
mRatBN7.2 Ensembl	7	83,091,039 - 83,152,147 (-)	Ensembl
Rnor_6.0 Ensembl	6	10,151,729 - 10,236,695 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000061786 ⟹ ENSRNOP00000058501

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	84,980,891 - 85,071,546 (-)	Ensembl
mRatBN7.2 Ensembl	7	83,091,039 - 83,105,508 (-)	Ensembl
Rnor_6.0 Ensembl	6	108,745,895 - 108,756,130 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094377 ⟹ ENSRNOP00000080205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	84,980,891 - 85,067,882 (-)	Ensembl
mRatBN7.2 Ensembl	7	83,092,893 - 83,174,451 (-)	Ensembl

RefSeq Acc Id:

NM_198751 ⟹ NP_942046

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	84,980,891 - 85,064,284 (-)	NCBI
mRatBN7.2	7	83,091,037 - 83,174,451 (-)	NCBI
Rnor_6.0	6	10,151,732 - 10,236,677 (+)	NCBI
Rnor_5.0	6	116,806,338 - 116,856,511 (-)	NCBI
Rnor_5.0	6	116,798,908 - 116,803,475 (-)	NCBI
RGSC_v3.4	7	88,069,668 - 88,154,285 (-)	RGD
Celera	7	79,969,394 - 80,052,871 (-)	RGD

Sequence:

show sequence

GGGGTCTTTCTTCCTGTCTGGCTGGAAACATGGCGTCGCGCAAGGAAGGCACCGGTTCCACCGC
CACCTCTTCCAGCTCTACTGGCGGCGCGGTGGGGAAGGGAAAAGGGAAAGGCGGCTCTGGAGAT
TCGGCCGTGAAGCAGGTGCAGATTGACGGCCTGGTAGTATTAAAGATAATCAAACATTATCAAG
AAGAAGGACAAGGAACTGAGGTCGTTCAGGGAGTGCTCCTGGGCCTGGTTGTAGAAGACCGACT
GGAGATTACCAACTGTTTCCCATTCCCCCAGCACACAGAGGACGATGCTGACTTTGATGAAGTG
CAGTATCAGATGGAGATGATGCGCAGCCTTCGCCACGTGAACATCGACCACCTCCACGTGGGCT
GGTACCAGTCCACGTATTATGGCTCCTTCGTTACCCGGGCGCTTCTGGATTCTCAGTTCAGCTA
CCAGCACGCCATTGAAGAATCTGTCGTTCTCATTTATGATCCCATAAAAACTGCCCAAGGATCT
CTCTCACTGAAGGCATACAGACTGACTCCTAAACTGATGGAAGTTTGTAAAGAGAAGGACTTTT
CCCCGGAAGCATTGAAAAAGGCAAACATCACCTTTGAACACATGTTTGAAGAAGTGCCGATTGT
AATTAAAAACTCACATTTGATCAATGTCCTGATGTGGGAGCTTGAGAAGAAGTCCGCTGTGGCT
GATAAGCATGAATTGCTCAGTCTTGCTAGCAGCAATCACTTGGGGAAGAATCTGCAGTTGCTGA
TGGACCGGGTGGATGAAATGAGTCAGGACATAATCAAATACAACACATACATGAGGAACAGCAG
TAAGCAGCAACAGCAGAAACACCAGTATCAGCAGCGTCGCCAGCAGGAGAATATGCAGCGGCAG
AGTCGAGGCGAGCCCCCGCTCCCTGAGGAGGACCTCTCCAAACTCTTCAAGCCCCACCAAGCCC
CTGCCAGGATGGACTCGCTGCTCATTGCAGGCCAGATTAACACTTACTGCCAGAACATCAAGGA
GTTCACTGCCCAAAACTTAGGCAAACTCTTCATGGCTCAGGCTCTTCAAGAATACAGTAACTAA
GAAAAGGAAGCTTCCTGCAAAGAAGACAGACTGTTGAGACTCCACCAGAGTGACTCTTGGAAAA
TGTGTTTCTGTACTGCAAAGTGGAGAGGCGCACTGTGCTCTTAGTGCTGTAATGGCTTTATAAC
CAATAATAAAAAGTTACTTGGTTGTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_942046	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60586	(Get FASTA)	NCBI Sequence Viewer
	EDM16281	(Get FASTA)	NCBI Sequence Viewer
	EDM16282	(Get FASTA)	NCBI Sequence Viewer
	EDM16283	(Get FASTA)	NCBI Sequence Viewer
	EDM16284	(Get FASTA)	NCBI Sequence Viewer
	EDM16285	(Get FASTA)	NCBI Sequence Viewer
	EDM16286	(Get FASTA)	NCBI Sequence Viewer
	EDM16287	(Get FASTA)	NCBI Sequence Viewer
	EDM16288	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000058501
GenBank Protein	Q6P9U8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_942046 ⟸ NM_198751

- UniProtKB:

Q6P9U8 (UniProtKB/Swiss-Prot), A0A8I5ZP79 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASRKEGTGSTATSSSSTGGAVGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQ
GVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSF
VTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANI
TFEHMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQD
IIKYNTYMRNSSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQAPARMDSLLIA
GQINTYCQNIKEFTAQNLGKLFMAQALQEYSN

hide sequence

Ensembl Acc Id:

ENSRNOP00000005786 ⟸ ENSRNOT00000005786

Ensembl Acc Id:

ENSRNOP00000058501 ⟸ ENSRNOT00000061786

Ensembl Acc Id:

ENSRNOP00000080205 ⟸ ENSRNOT00000094377

Protein Domains

MPN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZL77-F1-model_v2	AlphaFold	D3ZL77	1-256	view protein structure
AF-Q6P9U8-F1-model_v2	AlphaFold	Q6P9U8	1-352	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694394

Promoter ID:

EPDNEW_R4909

Type:

multiple initiation site

Name:

LOC108348062_1

Description:

eukaryotic translation initiation factor 3 subunit H

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	10,151,731 - 10,151,791	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735178	AgrOrtholog
BioCyc Gene	G2FUF-33430	BioCyc
Ensembl Genes	ENSRNOG00000004252	Ensembl, ENTREZGENE
	ENSRNOG00000040153	Ensembl
Ensembl Transcript	ENSRNOT00000061786	ENTREZGENE
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6918037	IMAGE-MGC_LOAD
InterPro	eIF3h	UniProtKB/Swiss-Prot
	eIF3h_C	UniProtKB/Swiss-Prot
	JAMM/MPN+_dom	UniProtKB/Swiss-Prot
	JAMM_MPN+_peptidase_M67A	UniProtKB/Swiss-Prot
	MPN	UniProtKB/Swiss-Prot
KEGG Report	rno:299899	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72941	IMAGE-MGC_LOAD
NCBI Gene	299899	ENTREZGENE
PANTHER	EUKARYOTIC TRANSLATION INITIATION FACTOR 3 -RELATED	UniProtKB/Swiss-Prot
Pfam	eIF3h_C	UniProtKB/Swiss-Prot
	JAB	UniProtKB/Swiss-Prot
PhenoGen	Eif3h	PhenoGen
PROSITE	MPN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004252	RatGTEx
	ENSRNOG00000040153	RatGTEx
SMART	JAB_MPN	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZP79	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UHR1_RAT	UniProtKB/TrEMBL
	D3ZL77_RAT	UniProtKB/TrEMBL
	EIF3H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Eif3h	eukaryotic translation initiation factor 3, subunit H	LOC108348062	eukaryotic translation initiation factor 3 subunit H	Data merged from RGD:11498408	737654	PROVISIONAL
2016-08-02	LOC108348062	eukaryotic translation initiation factor 3 subunit H			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-04			Eif3h	eukaryotic translation initiation factor 3, subunit H	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Eif3h	eukaryotic translation initiation factor 3, subunit H	Eif3s3	eukaryotic translation initiation factor 3, subunit 3 gamma	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-07-08	Eif3s3	eukaryotic translation initiation factor 3, subunit 3 (gamma)		eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa	Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)