Aard (alanine and arginine rich domain containing protein)

Advanced Search (OLGA)

Gene: Aard (alanine and arginine rich domain containing protein) Rattus norvegicus

Analyze

Symbol:

Aard

Name:

alanine and arginine rich domain containing protein

RGD ID:

631378

Description:

Involved in lung development. Orthologous to human AARD (alanine and arginine rich domain containing protein); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

A5D3; alanine and arginine-rich domain-containing protein; rA5D3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,254,322 - 85,259,163 (+)	NCBI		GRCr8
mRatBN7.2	7	83,364,478 - 83,369,319 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,364,204 - 83,369,317 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	85,266,568 - 85,271,407 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,467,779 - 87,472,618 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,288,152 - 87,292,993 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,588,458 - 91,593,299 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,588,458 - 91,593,297 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	92,232,534 - 92,237,375 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	88,346,189 - 88,351,030 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	88,366,918 - 88,371,758 (+)	NCBI
Celera	7	80,241,346 - 80,246,187 (+)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hereditary multiple exostoses (ISO)

trichorhinophalangeal syndrome type I (ISO)

trichorhinophalangeal syndrome type III (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

calcidiol (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

choline (ISO)

DDE (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

endosulfan (EXP)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

genistein (ISO)

glycidol (EXP)

iron dichloride (ISO)

L-methionine (ISO)

methylarsonic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

progesterone (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

lung development (IEP)

response to testosterone (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and characterization of a novel gene upregulated early during postnatal rat lung development.	Blomberg LA, etal., Biochim Biophys Acta 2002 Apr 12;1574(3):391-8.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation

Genomics

Comparative Map Data

Aard
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,254,322 - 85,259,163 (+)	NCBI		GRCr8
mRatBN7.2	7	83,364,478 - 83,369,319 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,364,204 - 83,369,317 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	85,266,568 - 85,271,407 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,467,779 - 87,472,618 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,288,152 - 87,292,993 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,588,458 - 91,593,299 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,588,458 - 91,593,297 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	92,232,534 - 92,237,375 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	88,346,189 - 88,351,030 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	88,366,918 - 88,371,758 (+)	NCBI
Celera	7	80,241,346 - 80,246,187 (+)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

AARD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	116,938,207 - 116,944,487 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	116,938,207 - 116,944,487 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	117,950,446 - 117,956,726 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	118,019,664 - 118,024,403 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	114,139,154 - 114,144,929 (+)	NCBI		Celera
Cytogenetic Map	8	q24.11	NCBI
HuRef	8	113,276,873 - 113,282,648 (+)	NCBI		HuRef
CHM1_1	8	117,990,693 - 117,996,449 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	118,066,378 - 118,072,658 (+)	NCBI		T2T-CHM13v2.0

Aard
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	51,903,503 - 51,909,118 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	51,903,503 - 51,909,118 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	52,040,107 - 52,045,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	52,040,107 - 52,045,722 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	51,871,653 - 51,877,269 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	51,870,181 - 51,875,795 (+)	NCBI		MGSCv36	mm8
Celera	15	53,613,350 - 53,618,906 (+)	NCBI		Celera
Cytogenetic Map	15	C	NCBI
cM Map	15	19.55	NCBI

AARD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	134,342,121 - 134,351,815 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	109,857,519 - 109,867,201 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	113,610,223 - 113,619,903 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	116,155,559 - 116,160,040 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

Aard
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	21,786,039 - 21,952,526 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	29,321,105 - 29,325,192 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	29,320,937 - 29,325,193 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AARD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	21,715,819 - 21,720,764 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	21,715,688 - 21,720,760 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	22,984,620 - 22,989,689 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AARD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	111,574,689 - 111,580,903 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	111,575,266 - 111,580,871 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	28,745,848 - 28,751,287 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Aard
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	404
Count of miRNA genes:	242
Interacting mature miRNAs:	274
Transcripts:	ENSRNOT00000006257
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat

Markers in Region

AI229720

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,368,425 - 83,368,592 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,592,406 - 91,592,572	NCBI	Rnor6.0
Rnor_5.0	7	92,236,482 - 92,236,648	UniSTS	Rnor5.0
RGSC_v3.4	7	88,350,137 - 88,350,303	UniSTS	RGSC3.4
Celera	7	80,245,294 - 80,245,460	UniSTS
RH 3.4 Map	7	549.8	UniSTS
Cytogenetic Map	7	q31	UniSTS

AV328152

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,369,161 - 83,369,283 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,593,142 - 91,593,263	NCBI	Rnor6.0
Rnor_5.0	7	92,237,218 - 92,237,339	UniSTS	Rnor5.0
RGSC_v3.4	7	88,350,873 - 88,350,994	UniSTS	RGSC3.4
Celera	7	80,246,030 - 80,246,151	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	46	105	76	80	53	19	53	5	197	82	92	45	58	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY007690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006257 ⟹ ENSRNOP00000006257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	83,364,204 - 83,369,317 (+)	Ensembl
Rnor_6.0 Ensembl	7	91,588,458 - 91,593,297 (+)	Ensembl

RefSeq Acc Id:

NM_145093 ⟹ NP_659561

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	85,254,322 - 85,259,163 (+)	NCBI
mRatBN7.2	7	83,364,478 - 83,369,319 (+)	NCBI
Rnor_6.0	7	91,588,458 - 91,593,299 (+)	NCBI
Rnor_5.0	7	92,232,534 - 92,237,375 (+)	NCBI
RGSC_v3.4	7	88,346,189 - 88,351,030 (+)	RGD
Celera	7	80,241,346 - 80,246,187 (+)	RGD

Sequence:

show sequence

GGCACGAGCCACGATGGGTTTGGGTGACTACAGCCACTGCAGACAGAGAATGTCCCGGGGACTC
TACGGAGTCTCTGGAAGGGCTACGCTGTGGTCCCCAGCTTTCCACCCGGTGCACCGCATGCCTT
GCGGCACTTGGCGCATCGAGGCACCAGAGCATGTCCGGGCGTCCAGCCCGGTGCTGGAGCACCT
CCGGAGACAGCTGGAGCGCGCCTTCCAGCGGGCGGCGGCACGCGGGCGCGCCAGGCGCGCGCGG
GAGGCTGTGGCGGCAGTGGCGGCGGCCGCGGCGGCAGCACGGGAGGAGCGGAGCCGGGCGCGCA
TGGAGTGCGCCCTGGCCCGGCTGCGCGCGGAGCTGCTGGAACTGCGTTTCCAGAACCACCAGCT
GGCCCGAACTTTACTGGATTTAAACATGAAAATGCAGCAGCTGAAGAAGAGACAGGACCAGGAG
CGTGCTTCCAAACCCCAGAGCCCGCAAGACGAGGAGATGAATCCCGAGTGCGGAAACGCATAGT
GGAGAGTCTGAGCCCGCAACTCCGAAGCAATCCCAAGCCCTCACCATAACATAGGCCACTCTGA
AACCGTTCTAGCATTAACACTAGCGATGCTGTATGTGCGCTCTGAGGGACAGTTTGTCCAGTGA
AAATGTAAGTGTAAGGAGGATGTGTGAAAAAAATTAGTTAAGAAAGGGAGTGATACATTTTTAT
TTTGAAGTTTTAAAAATATTCATTCATTGGTTTGACTGGTTATTGTCTTAGTAGGCAGAAGGGA
AGAGGAATCAGGAAGGTAGAGGAGGAAGAAAACCAAAGCACTAAAGACTGCCTTAATGCTAGCT
TACGACGCTGCATGTTACCTTCCTGTAGGATTGTGTGAACTTGCAGAATCTGTGCTTATTTTTA
CTTTATTTTTGGTCCATTTAGTAGCCTATCCAGTACTCTTCTGACCTGTGAAATGGAGAATTAC
TTATGTCTGGATTCCAGCCATATCCTTGATGTGACCAGCATGAAGGGTGTCTCACATGTATGCC
AGGGCTTGCTGTTGAAATGTAAAATACTAACTATTCTCCTAACGTCTTTGCCTCAGTTGATTCA
AGTTTGGCTTTCAAGATGTACACCCCTAAATTCCTAACTAATATAGTTCTTTTGTTCAATCAAC
TTGGGAGTTTAAATGGTTCTTATTGAATTAAAAGATCTAATTGTGCCCCAAAAGTGCTTTACCA
TGCAAAAATAAAATTAATAAAAATAGTTGCAGACCTAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_659561	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG15560	(Get FASTA)	NCBI Sequence Viewer
	EDM16274	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006257.3
GenBank Protein	Q91ZF7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_659561 ⟸ NM_145093
- UniProtKB:	Q91ZF7 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGLGDYSHCRQRMSRGLYGVSGRATLWSPAFHPVHRMPCGTWRIEAPEHVRASSPVLEHLRRQL ERAFQRAAARGRARRAREAVAAVAAAAAAAREERSRARMECALARLRAELLELRFQNHQLARTL LDLNMKMQQLKKRQDQERASKPQSPQDEEMNPECGNA hide sequence

Ensembl Acc Id:

ENSRNOP00000006257 ⟸ ENSRNOT00000006257

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91ZF7-F1-model_v2	AlphaFold	Q91ZF7	1-165	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695324

Promoter ID:

EPDNEW_R5849

Type:

single initiation site

Name:

Aard_1

Description:

alanine and arginine rich domain containing protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	91,588,435 - 91,588,495	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631378	AgrOrtholog
BioCyc Gene	G2FUF-33424	BioCyc
Ensembl Genes	ENSRNOG00000004708	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006257.4	UniProtKB/TrEMBL
InterPro	FAM167_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:246323	UniProtKB/Swiss-Prot
NCBI Gene	246323	ENTREZGENE
PANTHER	ALANINE AND ARGININE-RICH DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN FAM167A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Aard	PhenoGen
RatGTEx	ENSRNOG00000004708	RatGTEx
UniProt	A0A8L2Q2N6_RAT	UniProtKB/TrEMBL
	A6HRE7_RAT	UniProtKB/TrEMBL
	AARD_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-08	Aard	alanine and arginine rich domain containing protein		A5D3 protein	Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains potential leucine zipper motifs and phosphorylation sites	632257
gene_protein	165 amino acids	632257

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar