Rpa1 (replication protein A1) - Rat Genome Database

Name: Rpa1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Rpa1 (replication protein A1) Rattus norvegicus

Analyze

Symbol:

Rpa1

Name:

replication protein A1

RGD ID:

1307376

Description:

Enables single-stranded DNA binding activity. Predicted to be involved in DNA metabolic process; meiotic cell cycle; and protein localization to site of double-strand break. Predicted to act upstream of or within several processes, including homeostasis of number of cells within a tissue; in utero embryonic development; and positive regulation of cell population proliferation. Part of DNA replication factor A complex. Orthologous to human RPA1 (replication protein A1); PARTICIPATES IN mismatch repair pathway; nucleotide excision repair pathway; DNA replication pathway; INTERACTS WITH (+)-schisandrin B; amphetamine; benzo[a]pyrene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Cb1-727; LOC287524; replication protein A 70 kDa DNA-binding subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPA1 (replication protein A1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpa1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpa1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPA1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPA1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpa1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPA1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPA1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpa1 (replication protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPA1 (replication protein A1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpa1 (replication protein A1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpa1 (replication protein A1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RFA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpA-70	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpa-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	R03H10.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	R03H10.7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rpa1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	60,647,185 - 60,698,279 (-)	NCBI		GRCr8
mRatBN7.2	10	60,148,869 - 60,199,970 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	60,148,793 - 60,199,949 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	64,795,256 - 64,846,359 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	64,300,846 - 64,351,950 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	59,763,249 - 59,814,350 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	62,140,419 - 62,191,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	62,140,419 - 62,191,512 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	61,854,541 - 61,904,617 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	62,613,169 - 62,656,565 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	62,626,791 - 62,670,188 (-)	NCBI
Celera	10	59,179,824 - 59,222,962 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chloracne (ISO)

Pulmonary Fibrosis and/or Bone Marrow Failure Syndrome, Telomere-Related, 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

5-aza-2'-deoxycytidine (ISO)

all-trans-retinoic acid (ISO)

AM-251 (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (EXP,ISO)

biphenyl-4-amine (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

butanal (ISO)

cannabidiol (ISO)

capecitabine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

cisplatin (ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

diuron (ISO)

doxifluridine (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

ethanol (ISO)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

furan (EXP)

gefitinib (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

Lasiocarpine (ISO)

lead(0) (ISO)

leflunomide (ISO)

levofloxacin (EXP)

menadione (ISO)

methylmercury chloride (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

N-nitrosodiethylamine (ISO)

nefazodone (EXP)

nimesulide (EXP)

ochratoxin A (EXP,ISO)

oxaliplatin (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phosphoramide mustard (EXP)

pirinixic acid (ISO)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

riddelliine (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

topotecan (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

trovafloxacin (EXP)

uranium atom (ISO)

valdecoxib (EXP)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

base-excision repair (ISO)

chromatin organization (IEA)

chromosome organization (ISO)

DNA damage response (ISO)

DNA repair (ISO)

DNA replication (IC,ISO)

double-strand break repair via homologous recombination (IBA,ISO)

hemopoiesis (ISO)

homeostasis of number of cells within a tissue (ISO)

in utero embryonic development (ISO)

meiotic cell cycle (IBA,ISO)

mismatch repair (ISO)

nucleotide-excision repair (IBA,ISO)

positive regulation of cell population proliferation (ISO)

protein localization to chromosome (ISO)

protein localization to site of double-strand break (ISO)

telomere maintenance (ISO)

telomere maintenance via telomerase (IBA)

Cellular Component

condensed chromosome (ISO)

condensed nuclear chromosome (ISO)

DNA replication factor A complex (IBA,IDA,ISO)

lateral element (ISO)

male germ cell nucleus (ISO)

nucleoplasm (ISO)

nucleus (ISO)

PML body (ISO)

site of DNA damage (ISO)

site of double-strand break (ISO)

Molecular Function

chromatin binding (ISO)

chromatin-protein adaptor activity (ISO)

damaged DNA binding (IBA,ISO)

G-rich strand telomeric DNA binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

single-stranded DNA binding (IDA,ISO)

single-stranded telomeric DNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

DNA replication pathway (IEA)

homologous recombination pathway of double-strand break repair (IEA)

mismatch repair pathway (IEA,ISO)

nucleotide excision repair pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Mechanisms and functions of DNA mismatch repair.	Li GM Cell Res. 2008 Jan;18(1):85-98.
4.	Calmodulin is involved in the induction of DNA polymerases alpha and delta activities in normal rat kidney cells activated to proliferate.	Lopez-Girona A, etal., Biochem Biophys Res Commun. 1995 Dec 14;217(2):566-74.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	The multi-replication protein A (RPA) system--a new perspective.	Sakaguchi K, etal., FEBS J. 2009 Feb;276(4):943-63. doi: 10.1111/j.1742-4658.2008.06841.x. Epub 2009 Jan 12.
11.	Replication protein A is the major single-stranded DNA binding protein detected in mammalian cell extracts by gel retardation assays and UV cross-linking of long and short single-stranded DNA molecules.	Seroussi E and Lavi S, J Biol Chem. 1993 Apr 5;268(10):7147-54.

Additional References at PubMed

PMID:7700386	PMID:8990123	PMID:9430682	PMID:9765279	PMID:11555636	PMID:11927569	PMID:12091911	PMID:15470499	PMID:15965476	PMID:16135809	PMID:16973897	PMID:17696610
PMID:17765923	PMID:17959650	PMID:18283110	PMID:18316482	PMID:18469000	PMID:19010961	PMID:19135898	PMID:20551173	PMID:21743440	PMID:22164254	PMID:22711701	PMID:24747047
PMID:26041456	PMID:27248496	PMID:27723717	PMID:27723720

Genomics

Comparative Map Data

Rpa1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	60,647,185 - 60,698,279 (-)	NCBI		GRCr8
mRatBN7.2	10	60,148,869 - 60,199,970 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	60,148,793 - 60,199,949 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	64,795,256 - 64,846,359 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	64,300,846 - 64,351,950 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	59,763,249 - 59,814,350 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	62,140,419 - 62,191,518 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	62,140,419 - 62,191,512 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	61,854,541 - 61,904,617 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	62,613,169 - 62,656,565 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	62,626,791 - 62,670,188 (-)	NCBI
Celera	10	59,179,824 - 59,222,962 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

RPA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	1,830,005 - 1,900,082 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	1,829,702 - 1,900,082 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	1,733,299 - 1,803,376 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	1,680,095 - 1,748,120 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	1,680,094 - 1,748,119	NCBI
Celera	17	1,749,843 - 1,819,455 (+)	NCBI		Celera
Cytogenetic Map	17	p13.3	NCBI
HuRef	17	1,629,684 - 1,699,337 (+)	NCBI		HuRef
CHM1_1	17	1,742,032 - 1,811,637 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	1,718,730 - 1,788,877 (+)	NCBI		T2T-CHM13v2.0

Rpa1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	75,191,085 - 75,239,478 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	75,188,992 - 75,239,150 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	75,300,259 - 75,348,454 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	75,298,166 - 75,348,324 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	75,113,761 - 75,161,885 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	75,116,543 - 75,164,498 (-)	NCBI		MGSCv36	mm8
Celera	11	82,808,378 - 82,856,486 (-)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	45.79	NCBI

Rpa1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955481	1,304,035 - 1,361,806 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	9,401,164 - 9,475,584 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	11,367,763 - 11,442,603 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	1,813,610 - 1,886,093 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	1,705,373 - 1,775,596 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	1,705,380 - 1,775,596 (+)	Ensembl	panpan1.1		panPan2

RPA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	45,958,566 - 46,034,850 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	45,958,619 - 46,034,328 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	45,109,298 - 45,184,734 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	46,786,119 - 46,864,304 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	46,786,117 - 46,864,301 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	45,555,674 - 45,631,679 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	45,850,448 - 45,928,573 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	45,904,608 - 45,980,898 (+)	NCBI		UU_Cfam_GSD_1.0

Rpa1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	45,063,116 - 45,117,773 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	7,946,403 - 7,994,864 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936538	7,941,074 - 7,997,062 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	48,009,719 - 48,048,741 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	48,009,652 - 48,048,744 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	49,862,650 - 49,901,712 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	1,470,375 - 1,537,603 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	1,470,474 - 1,539,246 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	20,435,051 - 20,500,960 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpa1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	4,547,962 - 4,604,290 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	4,547,889 - 4,604,605 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpa1
205 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	27
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000004229
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	55273696	60677262	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

RH141758

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	60,152,754 - 60,152,935 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	62,144,309 - 62,144,489	NCBI	Rnor6.0
Rnor_5.0	10	61,858,101 - 61,858,281	UniSTS	Rnor5.0
RGSC_v3.4	10	62,616,000 - 62,616,180	UniSTS	RGSC3.4
Celera	10	59,182,443 - 59,182,623	UniSTS
Cytogenetic Map	10	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001394069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY325234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004229 ⟹ ENSRNOP00000004229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,149,810 - 60,172,327 (-)	Ensembl
Rnor_6.0 Ensembl	10	62,141,360 - 62,184,874 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090262 ⟹ ENSRNOP00000075516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,148,887 - 60,199,924 (-)	Ensembl
Rnor_6.0 Ensembl	10	62,140,423 - 62,191,512 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	62,155,411 - 62,163,496 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	62,153,270 - 62,163,652 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092728

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,148,793 - 60,199,940 (-)	Ensembl
Rnor_6.0 Ensembl	10	62,140,419 - 62,191,487 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095732 ⟹ ENSRNOP00000086497

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,148,797 - 60,172,327 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116502 ⟹ ENSRNOP00000078632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	60,148,871 - 60,199,949 (-)	Ensembl

RefSeq Acc Id:

NM_001394069 ⟹ NP_001380998

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	60,647,185 - 60,698,279 (-)	NCBI
mRatBN7.2	10	60,148,869 - 60,199,970 (-)	NCBI

RefSeq Acc Id:

XM_008767961 ⟹ XP_008766183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	60,647,185 - 60,670,448 (-)	NCBI
mRatBN7.2	10	60,148,869 - 60,171,984 (-)	NCBI
Rnor_6.0	10	62,140,419 - 62,163,558 (-)	NCBI

Sequence:

show sequence

CAGAATGTGACAGAGTGCGTGTTTTTGCGGAAATGACCGCTGGGTTAACTGGGAATGCGCCTGT
GATCGGCAGACAGTTAGGACATGCGCAGCAGCAAGCAGTCTCTGCCCCAGCCTCTGCAGCGACA
CCACCAGCCAGCAAGCCCCAACCGCAGAATGGGAGCTTGGGAGTGGGTTCCACTGTAGCTAAGG
CATACGGGGCCTCAAAGCCGTTTGGAAAGCCTGCTGGAACTGGCCTGCTGCAGCCTACAAGTGG
GACACAGTCCAAAGTGGTACCCATCGCCAGCCTCACCCCTTACCAATCCAAGTGGACGATTTGT
GCCCGTGTCACCAACAAAAGTCAGATCCGTACCTGGAGCAATTCCCGTGGGGAAGGAAAGCTCT
TCTCTATAGAACTTGTGGATGAAAGTGGTGAAATCAGAGCTACGGCTTTCAATGAGCAGGTGGA
CAAGTTCTTTCCCCTTATTGAAGTGAACAAGGTGTATTACTTCTCCAAGGGCACTCTGAAAATC
GCTAACAAACAGTTCTCAGCTGTTAAAAATGACTATGAGATGACCTTCAATAATGAGACGTCTG
TCCTTCCCTGCGAAGATGGCCATCACTTACCCACAGTTCAGTTTGACTTCACAGGGATCGGTGA
CCTAGAGAGCAAGTCTAAAGACTCACTTGTAGACATAATTGGAATCTGCAAGAGCTATGAAGAT
GCGACTAAAATCACAGTGAAGTCTAACAACAGAGAAGTTGCTAAGAGAAATATCTGTTTGATGG
ACATGTCAGGGAAAGTGGTGACTGCGACGCTGTGGGGAGAAGACGCTGACAAGTTTGACGGTTC
TAGGCAGCCTGTGATGGCCATCAAAGGAGCCCGAGTGTCCGACTTTGGTGGGCGGAGCCTCTCT
GTCCTATCATCTAGCACTGTCCTTGTGAATCCTGACATCCCAGAGGCCTATAAGCTCCGTGGAT
GGTTTGACTCAGAAGGACAAGCCTTAGATGGAGTTTCCATCTCTGATCTCAGGAGTGGAGGGAC
CGGAGGGAGCAACACCAACTGGAAAACTTTGTATGAAGCTAAATCCGAGAACCTGGGCCAGGGC
GACAAGGCGGACTATTTCAGCACTGTGGCAACAGTGGTGTTTCTTCGCAAAGAGAACTGTATGT
ACCAGGCCTGCCCGACCCAGGACTGCAATAAGAAAGTGATTGACCAGCAGAATGGGTTGTACCG
CTGTGAGAAGTGCGACCGGGAATTTCCCAATTTCAAATACCGCATGATCTTATCGGTAAATATT
GCAGATTTTCAGGAGAATCAGTGGGTGACGTGTTTCCAGGAGTCCGCGGAGGCCATTCTTGGAC
AGAACACTGTGTACCTTGGGGAACTCAAAGAGAAGAACGAGCAGGCGTTTGAAGAGGTTTTCCA
GAATGCCAACTTCCGATCATTTACATTCAGAATCAGAGTCAAGCTGGAGACCTACAATGATGAA
TCTCGAATTAAGGCCACTGTGATAGACGTGAAGCCCGTGGACTACAGAGACTATAGCAAAAGGC
TGATCATGAACATCAGGAAGAACATTTGATGTGAGCAAGTACTGCTGGTGGATGGAGAGGAAAG
AACGGAAATAGAATGGCTTCCTTCCCACCCCCACCCTATATGACAGCCCCACAATGACAATGAA
GATCCTCAGGAGAGACTGGCAACCTGTCTGCACCCCTTTTGGGACTCCTTGATAGGCAAAAGGC
AGCGAGCTTAGAGGGCTGTGTCTAGACCTTCATGAAGTGCCAGCTCTCGGCTGGCAGGTAGCGT
AGCAGCAGTCCCTCCTGTCTCTAGCTTTGTCGGTCACGCAGGAATTATGTCACAGGTCACTGAC
CCCACTCTGGATAATGAGGTGAATTATATGACCTGAAGTTTGCTTTTCCAGTGGTGGCACCTTT
TTGTCTTGGGTTCCTCCTGGAGGCAGTAAGAGCGGGGAAGAACCCAGGTGTTTAGAGGGTGTGT
CTGCCTAGAATCAAAGGCTCCATTTTGCAGAGGTACCACATGCTTGTTAATGCTTGGAATGGCA
GAAGGGTGGAATTATTAATCAAAGGCCTATCATTAATATCTGAATATCCTTCAGGGTCTAATGG
GTTTAATAGACTGAGTCAGATGCATCTGATATTAATCAAAATTGTCTCTTCTGAGGATGGCTGA
TAAGCATTGACTTGCTGTCCCCTTGGGGAAAAGCAAACCCCAAATTGCATAATTTACCTCATTA
TCCACAGGGTGGGGTCGGTTACTGGTAATATAGTTCCTGTGTGAAGATAACAGGATCTTGGTAA
ATCCGGCAAAGCCAGAGACAGAGGAGGGACTGGGACATCCAGGCCACGGCAGAGCACTGCTGCG
GTTTCCTCAGTTAATGTTCGGTTTGGTTACCAGATGGCCCTGGACCTTTATTAGAGCTCTGTTA
AATAGAGAGAGTTTAAGAAAGACGCCCTTTGTTTCCCTTGCTTTATTTGAATAAACAGTGTATC
TGTGATCCTA

hide sequence

RefSeq Acc Id:

XM_063268676 ⟹ XP_063124746

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	60,647,185 - 60,670,239 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001380998	(Get FASTA)	NCBI Sequence Viewer
	XP_008766183	(Get FASTA)	NCBI Sequence Viewer
	XP_063124746	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP92635	(Get FASTA)	NCBI Sequence Viewer
	EDM05205	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004229.3
	ENSRNOP00000075516.2
	ENSRNOP00000078632.1
	ENSRNOP00000079958.1
	ENSRNOP00000086497.1

RefSeq Acc Id:	XP_008766183 ⟸ XM_008767961
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2KAT3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTAGLTGNAPVIGRQLGHAQQQAVSAPASAATPPASKPQPQNGSLGVGSTVAKAYGASKPFGKP AGTGLLQPTSGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSIELVDESGE IRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFSAVKNDYEMTFNNETSVLPCEDGHHLP TVQFDFTGIGDLESKSKDSLVDIIGICKSYEDATKITVKSNNREVAKRNICLMDMSGKVVTATL WGEDADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVLVNPDIPEAYKLRGWFDSEGQALDG VSISDLRSGGTGGSNTNWKTLYEAKSENLGQGDKADYFSTVATVVFLRKENCMYQACPTQDCNK KVIDQQNGLYRCEKCDREFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNTVYLGELKE KNEQAFEEVFQNANFRSFTFRIRVKLETYNDESRIKATVIDVKPVDYRDYSKRLIMNIRKNI hide sequence

Ensembl Acc Id:

ENSRNOP00000004229 ⟸ ENSRNOT00000004229

Ensembl Acc Id:

ENSRNOP00000075516 ⟸ ENSRNOT00000090262

Ensembl Acc Id:

ENSRNOP00000078632 ⟸ ENSRNOT00000116502

Ensembl Acc Id:

ENSRNOP00000086497 ⟸ ENSRNOT00000095732

RefSeq Acc Id:	NP_001380998 ⟸ NM_001394069
- UniProtKB:	A0A0G2KAT3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124746 ⟸ XM_063268676
- Peptide Label:	isoform X2

Protein Domains

OB Replication factor A C-terminal Replication factor-A protein 1 N-terminal Replication protein A OB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TP21-F1-model_v2	AlphaFold	Q7TP21	1-680	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697421

Promoter ID:

EPDNEW_R7946

Type:

initiation region

Name:

Rpa1_1

Description:

replication protein A1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	62,191,487 - 62,191,547	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307376	AgrOrtholog
BioCyc Gene	G2FUF-24217	BioCyc
Ensembl Genes	ENSRNOG00000003123	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004229.4	UniProtKB/TrEMBL
	ENSRNOT00000090262.2	UniProtKB/TrEMBL
	ENSRNOT00000092728.2	UniProtKB/TrEMBL
	ENSRNOT00000095732.1	UniProtKB/TrEMBL
	ENSRNOT00000116502.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/TrEMBL
InterPro	Euk_RPA1_DBD_C	UniProtKB/TrEMBL
	NA-bd_OB-fold	UniProtKB/TrEMBL
	NA_bd_OB_tRNA-helicase	UniProtKB/TrEMBL
	Rep-A_N	UniProtKB/TrEMBL
	Rep_factor-A_C	UniProtKB/TrEMBL
	REPA_OB_2	UniProtKB/TrEMBL
	Rpa1	UniProtKB/TrEMBL
NCBI Gene	287524	ENTREZGENE
PANTHER	PTHR23273	UniProtKB/TrEMBL
	REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT	UniProtKB/TrEMBL
Pfam	Rep-A_N	UniProtKB/TrEMBL
	Rep_fac-A_C	UniProtKB/TrEMBL
	REPA_OB_2	UniProtKB/TrEMBL
	tRNA_anti	UniProtKB/TrEMBL
PhenoGen	Rpa1	PhenoGen
RatGTEx	ENSRNOG00000003123	RatGTEx
Superfamily-SCOP	Nucleic_acid_OB	UniProtKB/TrEMBL
UniProt	A0A0G2KAT3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZL77_RAT	UniProtKB/TrEMBL
	A0A8I6A5Y4_RAT	UniProtKB/TrEMBL
	A6HGQ0_RAT	UniProtKB/TrEMBL
	F7FI87_RAT	UniProtKB/TrEMBL
	Q7TP21_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Rpa1	replication protein A1	Rpa1_predicted	replication protein A1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rpa1_predicted	replication protein A1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)