Symbol:
Akap13
Name:
A-kinase anchoring protein 13
RGD ID:
727893
Description:
Enables MAP-kinase scaffold activity. Involved in several processes, including adrenergic receptor signaling pathway; cell growth involved in cardiac muscle cell development; and positive regulation of intracellular signal transduction. Located in perinuclear region of cytoplasm. Orthologous to human AKAP13 (A-kinase anchoring protein 13); PARTICIPATES IN protein kinase A (PKA) signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A kinase (PRKA) anchor protein 13; A-kinase anchor protein 13; AKAP-13; AKAP-Lbc; LOC293024; protein kinase A anchoring protein Rt31
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 138,722,445 - 139,029,401 (+) NCBI GRCr8 mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 137,232,876 - 137,538,333 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 144,403,105 - 144,708,592 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 137,289,702 - 137,597,080 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 137,089,558 - 137,315,272 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 137,014,272 - 137,315,272 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 138,007,112 - 138,312,524 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 131,052,674 - 131,360,512 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 131,302,912 - 131,380,987 (+) NCBI Celera 1 121,422,303 - 121,727,463 (+) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Akap13 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of AKAP13 mRNA CTD PMID:22079256 Akap13 Rat (-)-epigallocatechin 3-gallate increases expression ISO AKAP13 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of AKAP13 mRNA CTD PMID:22079256 Akap13 Rat (1->4)-beta-D-glucan multiple interactions ISO Akap13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AKAP13 mRNA CTD PMID:36331819 Akap13 Rat 1,2-dichloroethane decreases expression ISO Akap13 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of AKAP13 mRNA CTD PMID:28189721 and PMID:28960355 Akap13 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO AKAP13 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to AKAP13 protein CTD PMID:32991956 Akap13 Rat 17beta-estradiol multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of AKAP13 mRNA and EGF protein inhibits the reaction [Estradiol results in decreased expression of AKAP13 mRNA] CTD PMID:20660070 and PMID:24758408 Akap13 Rat 17beta-estradiol decreases expression ISO AKAP13 (Homo sapiens) 6480464 Estradiol results in decreased expression of AKAP13 mRNA CTD PMID:19167446 and PMID:24758408 Akap13 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO AKAP13 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Akap13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO AKAP13 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKAP13 mRNA CTD PMID:21296121 Akap13 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AKAP13 mRNA CTD PMID:33387578 Akap13 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of AKAP13 mRNA CTD PMID:34747641 Akap13 Rat 2,4,6-tribromophenol decreases expression ISO AKAP13 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Akap13 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of AKAP13 mRNA CTD PMID:21346803 Akap13 Rat 2-hydroxypropanoic acid increases expression ISO AKAP13 (Homo sapiens) 6480464 Lactic Acid results in increased expression of AKAP13 mRNA CTD PMID:30851411 Akap13 Rat 2-methylcholine affects expression ISO AKAP13 (Homo sapiens) 6480464 beta-methylcholine affects the expression of AKAP13 mRNA CTD PMID:21179406 Akap13 Rat 3,3',4,4'-tetrachlorobiphenyl affects expression ISO AKAP13 (Homo sapiens) 6480464 3 more ... CTD PMID:20638727 Akap13 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO AKAP13 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of AKAP13 protein CTD PMID:31675489 Akap13 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Akap13 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of AKAP13 mRNA CTD PMID:26251327 Akap13 Rat 3-methylcholanthrene decreases expression ISO Akap13 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of AKAP13 mRNA CTD PMID:20713471 Akap13 Rat 3-methylcholanthrene multiple interactions ISO AKAP13 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to AKAP13 promoter] CTD PMID:20348232 Akap13 Rat 4,4'-sulfonyldiphenol affects expression ISO Akap13 (Mus musculus) 6480464 bisphenol S affects the expression of AKAP13 mRNA CTD PMID:39298647 Akap13 Rat 4,4'-sulfonyldiphenol decreases methylation ISO AKAP13 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of AKAP13 gene CTD PMID:31601247 Akap13 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of AKAP13 mRNA CTD PMID:24780913 Akap13 Rat acrolein multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AKAP13 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of AKAP13 mRNA CTD PMID:32699268 Akap13 Rat alpha-pinene multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AKAP13 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of AKAP13 mRNA CTD PMID:32699268 Akap13 Rat antirheumatic drug increases expression ISO AKAP13 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of AKAP13 mRNA CTD PMID:24449571 Akap13 Rat arsenous acid increases expression ISO AKAP13 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AKAP13 mRNA CTD PMID:20458559 Akap13 Rat benzo[a]pyrene affects methylation ISO AKAP13 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AKAP13 5' UTR CTD PMID:27901495 Akap13 Rat benzo[a]pyrene decreases methylation ISO AKAP13 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of AKAP13 promoter CTD PMID:27901495 Akap13 Rat benzo[a]pyrene diol epoxide I decreases expression ISO AKAP13 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Akap13 Rat beta-hexachlorocyclohexane increases expression ISO Akap13 (Mus musculus) 6480464 beta-hexachlorocyclohexane results in increased expression of AKAP13 mRNA CTD PMID:25270620 Akap13 Rat bis(2-ethylhexyl) phthalate increases expression ISO Akap13 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of AKAP13 mRNA CTD PMID:34319233 Akap13 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Akap13 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of AKAP13 mRNA CTD PMID:33754040 Akap13 Rat bisphenol A increases expression ISO Akap13 (Mus musculus) 6480464 bisphenol A results in increased expression of AKAP13 mRNA CTD PMID:26063408 Akap13 Rat bisphenol A decreases expression ISO AKAP13 (Homo sapiens) 6480464 bisphenol A results in decreased expression of AKAP13 protein CTD PMID:31675489 Akap13 Rat bisphenol A decreases methylation ISO AKAP13 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of AKAP13 gene CTD PMID:31601247 Akap13 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of AKAP13 gene CTD PMID:28505145 Akap13 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AKAP13 mRNA CTD PMID:25181051 Akap13 Rat bisphenol F multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of AKAP13 gene CTD PMID:31601247 Akap13 Rat cadmium dichloride increases expression ISO AKAP13 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of AKAP13 mRNA CTD PMID:38382870 Akap13 Rat cadmium dichloride decreases expression ISO AKAP13 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of AKAP13 mRNA CTD PMID:38568856 Akap13 Rat caffeine affects phosphorylation ISO AKAP13 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of AKAP13 protein CTD PMID:35688186 Akap13 Rat camptothecin decreases response to substance ISO AKAP13 (Homo sapiens) 6480464 AKAP13 mRNA results in decreased susceptibility to Camptothecin CTD PMID:25269479 Akap13 Rat carbon nanotube decreases expression ISO Akap13 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Akap13 Rat CGP 52608 multiple interactions ISO AKAP13 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to AKAP13 gene] CTD PMID:28238834 Akap13 Rat chromium(6+) decreases expression ISO AKAP13 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of AKAP13 mRNA CTD PMID:30690063 Akap13 Rat cisplatin decreases expression ISO AKAP13 (Homo sapiens) 6480464 Cisplatin results in decreased expression of AKAP13 mRNA CTD PMID:19561079 Akap13 Rat clobetasol decreases expression ISO Akap13 (Mus musculus) 6480464 Clobetasol results in decreased expression of AKAP13 mRNA CTD PMID:27462272 Akap13 Rat cobalt dichloride increases expression ISO Akap13 (Mus musculus) 6480464 cobaltous chloride results in increased expression of AKAP13 mRNA CTD PMID:21139344 Akap13 Rat colforsin daropate hydrochloride multiple interactions ISO AKAP13 (Homo sapiens) 6480464 AKAP13 protein modified form affects the reaction [Colforsin affects the localization of ADRA2C protein] more ... CTD PMID:24701590 Akap13 Rat copper(II) sulfate increases expression ISO AKAP13 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of AKAP13 mRNA CTD PMID:19549813 Akap13 Rat coumarin affects phosphorylation ISO AKAP13 (Homo sapiens) 6480464 coumarin affects the phosphorylation of AKAP13 protein CTD PMID:35688186 Akap13 Rat coumestrol decreases expression ISO AKAP13 (Homo sapiens) 6480464 Coumestrol results in decreased expression of AKAP13 mRNA CTD PMID:19167446 Akap13 Rat coumestrol multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of AKAP13 mRNA CTD PMID:19167446 Akap13 Rat crocidolite asbestos decreases expression ISO Akap13 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of AKAP13 mRNA CTD PMID:29279043 Akap13 Rat cyclosporin A increases expression ISO AKAP13 (Homo sapiens) 6480464 Cyclosporine results in increased expression of AKAP13 mRNA CTD PMID:25562108 Akap13 Rat cyproconazole decreases expression ISO Akap13 (Mus musculus) 6480464 cyproconazole results in decreased expression of AKAP13 mRNA CTD PMID:22334560 Akap13 Rat decabromodiphenyl ether increases expression ISO AKAP13 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of AKAP13 protein CTD PMID:31675489 Akap13 Rat diarsenic trioxide increases expression ISO AKAP13 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AKAP13 mRNA CTD PMID:20458559 Akap13 Rat dibenzo[a,l]pyrene increases expression ISO Akap13 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in increased expression of AKAP13 mRNA CTD PMID:25908611 Akap13 Rat Dibutyl phosphate affects expression ISO AKAP13 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AKAP13 mRNA CTD PMID:37042841 Akap13 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of AKAP13 mRNA CTD PMID:21266533 Akap13 Rat dibutyl phthalate increases expression ISO Akap13 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of AKAP13 mRNA CTD PMID:17361019 and PMID:21266533 Akap13 Rat dicrotophos increases expression ISO AKAP13 (Homo sapiens) 6480464 dicrotophos results in increased expression of AKAP13 mRNA CTD PMID:28302478 Akap13 Rat doxorubicin decreases expression ISO AKAP13 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of AKAP13 mRNA CTD PMID:29803840 Akap13 Rat elemental selenium multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of AKAP13 mRNA CTD PMID:19244175 Akap13 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of AKAP13 mRNA CTD PMID:29391264 Akap13 Rat Enterolactone multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of AKAP13 mRNA CTD PMID:19167446 Akap13 Rat enzyme inhibitor multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of AKAP13 protein CTD PMID:23301498 Akap13 Rat epoxiconazole decreases expression ISO Akap13 (Mus musculus) 6480464 epoxiconazole results in decreased expression of AKAP13 mRNA CTD PMID:22334560 and PMID:35436446 Akap13 Rat ethanol increases expression ISO Akap13 (Mus musculus) 6480464 Ethanol results in increased expression of AKAP13 mRNA CTD PMID:30319688 Akap13 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of AKAP13 mRNA CTD PMID:30307764 Akap13 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of AKAP13 mRNA CTD PMID:23962444 Akap13 Rat folic acid decreases expression ISO Akap13 (Mus musculus) 6480464 Folic Acid results in decreased expression of AKAP13 mRNA CTD PMID:25629700 Akap13 Rat FR900359 affects phosphorylation ISO AKAP13 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of AKAP13 protein CTD PMID:37730182 Akap13 Rat fulvestrant multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of AKAP13 gene CTD PMID:31601247 Akap13 Rat gallic acid increases expression ISO AKAP13 (Homo sapiens) 6480464 Gallic Acid results in increased expression of AKAP13 mRNA CTD PMID:34408198 Akap13 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AKAP13 mRNA CTD PMID:22061828 and PMID:33387578 Akap13 Rat gold atom multiple interactions ISO Akap13 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of AKAP13 mRNA CTD PMID:19695318 Akap13 Rat gold(0) multiple interactions ISO Akap13 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in increased expression of AKAP13 mRNA CTD PMID:19695318 Akap13 Rat hexadecanoic acid decreases phosphorylation ISO AKAP13 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of AKAP13 protein CTD PMID:28073184 Akap13 Rat inulin multiple interactions ISO Akap13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of AKAP13 mRNA CTD PMID:36331819 Akap13 Rat iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of AKAP13 mRNA CTD PMID:16629162 Akap13 Rat iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of AKAP13 mRNA CTD PMID:16629162 Akap13 Rat isoprenaline increases expression ISO Akap13 (Mus musculus) 6480464 Isoproterenol results in increased expression of AKAP13 mRNA CTD PMID:20003209 Akap13 Rat methamphetamine increases expression ISO Akap13 (Mus musculus) 6480464 Methamphetamine results in increased expression of AKAP13 mRNA CTD PMID:26307267 Akap13 Rat methidathion increases expression ISO Akap13 (Mus musculus) 6480464 methidathion results in increased expression of AKAP13 mRNA CTD PMID:34813904 Akap13 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of AKAP13 gene CTD PMID:35440735 Akap13 Rat methylmercury chloride increases expression ISO AKAP13 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of AKAP13 mRNA CTD PMID:26272509 Akap13 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of AKAP13 mRNA CTD PMID:25729387 Akap13 Rat ozone multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of AKAP13 mRNA more ... CTD PMID:32699268 Akap13 Rat paracetamol affects expression ISO Akap13 (Mus musculus) 6480464 Acetaminophen affects the expression of AKAP13 mRNA CTD PMID:17562736 Akap13 Rat paracetamol affects expression ISO AKAP13 (Homo sapiens) 6480464 Acetaminophen affects the expression of AKAP13 mRNA CTD PMID:25458485 Akap13 Rat perfluorohexanesulfonic acid decreases expression ISO Akap13 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of AKAP13 mRNA CTD PMID:37995155 Akap13 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Akap13 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AKAP13 mRNA more ... CTD PMID:36331819 Akap13 Rat phenobarbital decreases expression ISO Akap13 (Mus musculus) 6480464 Phenobarbital results in decreased expression of AKAP13 mRNA CTD PMID:23091169 Akap13 Rat pirinixic acid multiple interactions ISO Akap13 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of AKAP13 mRNA CTD PMID:19710929 Akap13 Rat potassium chromate multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of AKAP13 mRNA CTD PMID:22079256 Akap13 Rat potassium chromate decreases expression ISO AKAP13 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of AKAP13 mRNA CTD PMID:22079256 and PMID:22714537 Akap13 Rat progesterone multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of AKAP13 mRNA CTD PMID:20660070 Akap13 Rat progesterone increases expression ISO AKAP13 (Homo sapiens) 6480464 Progesterone results in increased expression of AKAP13 mRNA CTD PMID:20864642 Akap13 Rat propiconazole decreases expression ISO Akap13 (Mus musculus) 6480464 propiconazole results in decreased expression of AKAP13 mRNA CTD PMID:22334560 Akap13 Rat rac-lactic acid increases expression ISO AKAP13 (Homo sapiens) 6480464 Lactic Acid results in increased expression of AKAP13 mRNA CTD PMID:30851411 Akap13 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of AKAP13 protein CTD PMID:35544339 Akap13 Rat selenium atom multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of AKAP13 mRNA CTD PMID:19244175 Akap13 Rat sodium arsenite decreases expression ISO AKAP13 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of AKAP13 mRNA CTD PMID:28595984 Akap13 Rat sodium arsenite increases expression ISO Akap13 (Mus musculus) 6480464 sodium arsenite results in increased expression of AKAP13 mRNA CTD PMID:32068019 Akap13 Rat sunitinib decreases expression ISO AKAP13 (Homo sapiens) 6480464 Sunitinib results in decreased expression of AKAP13 mRNA CTD PMID:31533062 Akap13 Rat testosterone enanthate affects expression ISO AKAP13 (Homo sapiens) 6480464 testosterone enanthate affects the expression of AKAP13 mRNA CTD PMID:17440010 Akap13 Rat tetraphene decreases expression ISO Akap13 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of AKAP13 mRNA CTD PMID:26377693 Akap13 Rat thiram increases expression ISO AKAP13 (Homo sapiens) 6480464 Thiram results in increased expression of AKAP13 mRNA CTD PMID:38568856 Akap13 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of AKAP13 mRNA CTD PMID:25729387 Akap13 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of AKAP13 mRNA CTD PMID:25729387 Akap13 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of AKAP13 mRNA CTD PMID:30589522 Akap13 Rat triphenyl phosphate affects expression ISO AKAP13 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of AKAP13 mRNA CTD PMID:37042841 Akap13 Rat triptonide decreases expression ISO Akap13 (Mus musculus) 6480464 triptonide results in decreased expression of AKAP13 mRNA CTD PMID:33045310 Akap13 Rat troglitazone decreases expression ISO Akap13 (Mus musculus) 6480464 troglitazone results in decreased expression of AKAP13 mRNA CTD PMID:28973697 Akap13 Rat tungsten decreases expression ISO Akap13 (Mus musculus) 6480464 Tungsten results in decreased expression of AKAP13 mRNA CTD PMID:30912803 Akap13 Rat valproic acid affects expression ISO AKAP13 (Homo sapiens) 6480464 Valproic Acid affects the expression of AKAP13 mRNA CTD PMID:25979313 Akap13 Rat valproic acid decreases methylation ISO AKAP13 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of AKAP13 gene CTD PMID:29154799 Akap13 Rat versicolorin A decreases expression ISO AKAP13 (Homo sapiens) 6480464 versicolorin A results in decreased expression of AKAP13 mRNA CTD PMID:32106047 Akap13 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of AKAP13 mRNA CTD PMID:19015723 Akap13 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of AKAP13 mRNA CTD PMID:23034163 Akap13 Rat vitamin E multiple interactions ISO AKAP13 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of AKAP13 mRNA CTD PMID:19244175 Akap13 Rat vitamin E decreases expression ISO AKAP13 (Homo sapiens) 6480464 Vitamin E results in decreased expression of AKAP13 mRNA CTD PMID:19244175 Akap13 Rat vorinostat decreases expression ISO AKAP13 (Homo sapiens) 6480464 vorinostat results in decreased expression of AKAP13 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) alpha-pinene (ISO) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-hexachlorocyclohexane (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (ISO) camptothecin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (ISO) clobetasol (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyproconazole (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) Enterolactone (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) fenvalerate (EXP) fipronil (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gallic acid (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) hexadecanoic acid (ISO) inulin (ISO) iron atom (EXP) iron(0) (EXP) isoprenaline (ISO) methamphetamine (ISO) methidathion (ISO) methoxychlor (EXP) methylmercury chloride (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) propiconazole (ISO) rac-lactic acid (ISO) rotenone (EXP) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone enanthate (ISO) tetraphene (ISO) thiram (ISO) topotecan (EXP) triphenyl phosphate (EXP,ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (ISO) versicolorin A (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Biological Process
adrenergic receptor signaling pathway (IBA,IEA,IMP,ISO,ISS) bone development (ISO,ISS) cardiac muscle cell differentiation (ISO,ISS) cell growth involved in cardiac muscle cell development (IMP) G protein-coupled receptor signaling pathway (IEA,IMP,ISO,ISS) heart development (ISO,ISS) MAPK cascade (IEA) nuclear export (IMP) positive regulation of canonical NF-kappaB signal transduction (IBA,IEA,IMP,ISO,ISS) positive regulation of MAP kinase activity (IMP) positive regulation of Rho protein signal transduction (IEA,ISO,ISS) regulation of nuclear receptor-mediated glucocorticoid signaling pathway (ISO) regulation of Rho protein signal transduction (IBA) regulation of sarcomere organization (ISO,ISS)
Molecular Function
guanyl-nucleotide exchange factor activity (IEA,ISO,ISS) MAP-kinase scaffold activity (IBA,IEA,IMP,ISO,ISS) metal ion binding (IEA) molecular adaptor activity (IEA,ISO,ISS) protein binding (ISO) protein kinase A binding (IEA,ISO) small GTPase binding (IEA,ISO) zinc ion binding (IEA)
1.
A-kinase anchoring proteins: from protein complexes to physiology and disease.
Carnegie GK, etal., IUBMB Life. 2009 Apr;61(4):394-406.
2.
AKAP-Lbc mobilizes a cardiac hypertrophy signaling pathway.
Carnegie GK, etal., Mol Cell. 2008 Oct 24;32(2):169-79.
3.
A-kinase-anchoring protein-Lbc anchors IkappaB kinase beta to support interleukin-6-mediated cardiomyocyte hypertrophy.
del Vescovo CD, etal., Mol Cell Biol. 2013 Jan;33(1):14-27. doi: 10.1128/MCB.00887-12. Epub 2012 Oct 22.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Ht31: the first protein kinase A anchoring protein to integrate protein kinase A and Rho signaling.
Klussmann E, etal., FEBS Lett 2001 Nov 2;507(3):264-8.
6.
The Rho guanine nucleotide exchange factor AKAP13 (BRX) is essential for cardiac development in mice.
Mayers CM, etal., J Biol Chem. 2010 Apr 16;285(16):12344-54. doi: 10.1074/jbc.M110.106856. Epub 2010 Feb 5.
7.
NCBI rat LocusLink and RefSeq merged data October 15, 2003
NCBI rat LocusLink and RefSeq merged data October 15, 2003
8.
A-kinase anchoring protein Lbc coordinates a p38 activating signaling complex controlling compensatory cardiac hypertrophy.
Perez Lopez I, etal., Mol Cell Biol. 2013 Aug;33(15):2903-17. doi: 10.1128/MCB.00031-13. Epub 2013 May 28.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Localized effects of cAMP mediated by distinct routes of protein kinase A.
Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.
Akap13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 138,722,445 - 139,029,401 (+) NCBI GRCr8 mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 137,232,876 - 137,538,333 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 144,403,105 - 144,708,592 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 137,289,702 - 137,597,080 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 137,089,558 - 137,315,272 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 137,014,272 - 137,315,272 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 138,007,112 - 138,312,524 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 131,052,674 - 131,360,512 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 131,302,912 - 131,380,987 (+) NCBI Celera 1 121,422,303 - 121,727,463 (+) NCBI Celera Cytogenetic Map 1 q31 NCBI
AKAP13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 85,380,603 - 85,749,358 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 85,380,571 - 85,749,358 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 85,923,834 - 86,292,589 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 83,724,875 - 84,093,590 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 84,021,271 - 84,093,590 NCBI Celera 15 62,323,846 - 62,692,414 (+) NCBI Celera Cytogenetic Map 15 q25.3 NCBI HuRef 15 61,986,401 - 62,354,887 (+) NCBI HuRef CHM1_1 15 85,765,298 - 86,134,016 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 83,132,647 - 83,501,376 (+) NCBI T2T-CHM13v2.0
Akap13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 75,105,271 - 75,404,357 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 75,105,282 - 75,404,357 (+) Ensembl GRCm39 Ensembl GRCm38 7 75,455,526 - 75,754,609 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 75,455,534 - 75,754,609 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 82,600,420 - 82,899,495 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 75,328,812 - 75,628,122 (+) NCBI MGSCv36 mm8 Celera 7 72,913,871 - 73,205,960 (+) NCBI Celera Cytogenetic Map 7 D1 NCBI cM Map 7 43.76 NCBI
Akap13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 19,009,485 - 19,247,626 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 19,006,206 - 19,327,523 (-) NCBI ChiLan1.0 ChiLan1.0
AKAP13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 74,930,726 - 75,292,650 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 78,635,626 - 78,997,324 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 64,076,422 - 64,438,109 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 83,289,867 - 83,651,362 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 83,387,667 - 83,651,362 (+) Ensembl panpan1.1 panPan2
AKAP13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 49,076,313 - 49,310,564 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 49,076,642 - 49,308,221 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 51,631,494 - 51,952,108 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 49,413,000 - 49,733,699 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 49,412,925 - 49,729,970 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 48,911,383 - 49,227,381 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 49,139,636 - 49,460,216 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 49,485,435 - 49,806,458 (+) NCBI UU_Cfam_GSD_1.0
Akap13
AKAP13
AKAP13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 4,009,921 - 4,364,226 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 4,106,732 - 4,359,516 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 42,653,071 - 43,006,115 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Akap13
.
Predicted Target Of
Count of predictions: 496 Count of miRNA genes: 250 Interacting mature miRNAs: 297 Transcripts: ENSRNOT00000014802 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
D1Rat183
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 138,793,931 - 138,794,173 (+) Marker Load Pipeline mRatBN7.2 1 129,384,185 - 129,384,427 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,083,889 - 137,084,126 NCBI Rnor6.0 Rnor_5.0 1 138,077,032 - 138,077,269 UniSTS Rnor5.0 RGSC_v3.4 1 131,123,181 - 131,123,541 RGD RGSC3.4 RGSC_v3.4 1 131,123,213 - 131,123,450 UniSTS RGSC3.4 RGSC_v3.1 1 131,201,556 - 131,201,793 RGD Celera 1 121,492,017 - 121,492,254 UniSTS RH 3.4 Map 1 1020.0 UniSTS RH 3.4 Map 1 1020.0 RGD RH 2.0 Map 1 667.4 RGD SHRSP x BN Map 1 65.46 RGD Cytogenetic Map 1 q31 UniSTS
BE120782
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 129,614,572 - 129,614,746 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,310,199 - 137,310,372 NCBI Rnor6.0 Rnor_5.0 1 138,307,450 - 138,307,623 UniSTS Rnor5.0 RGSC_v3.4 1 131,355,439 - 131,355,612 UniSTS RGSC3.4 Celera 1 121,722,390 - 121,722,563 UniSTS RH 3.4 Map 1 1012.3 UniSTS Cytogenetic Map 1 q31 UniSTS
BE118168
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 129,596,771 - 129,596,951 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,292,400 - 137,292,579 NCBI Rnor6.0 Rnor_5.0 1 138,289,651 - 138,289,830 UniSTS Rnor5.0 RGSC_v3.4 1 131,337,640 - 131,337,819 UniSTS RGSC3.4 Celera 1 121,704,595 - 121,704,774 UniSTS RH 3.4 Map 1 1011.4 UniSTS Cytogenetic Map 1 q31 UniSTS
AI406405
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 129,477,465 - 129,477,615 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,173,207 - 137,173,356 NCBI Rnor6.0 Rnor_5.0 1 138,170,458 - 138,170,607 UniSTS Rnor5.0 RGSC_v3.4 1 131,218,653 - 131,218,802 UniSTS RGSC3.4 Celera 1 121,585,318 - 121,585,467 UniSTS RH 3.4 Map 1 1021.5 UniSTS Cytogenetic Map 1 q31 UniSTS
AU048734
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 129,467,575 - 129,467,836 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,163,313 - 137,163,573 NCBI Rnor6.0 Rnor_5.0 1 138,160,564 - 138,160,824 UniSTS Rnor5.0 Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014802 ⟹ ENSRNOP00000014802
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl Rnor_6.0 Ensembl 1 137,014,272 - 137,315,272 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095963 ⟹ ENSRNOP00000078206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099409 ⟹ ENSRNOP00000077560
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,566,293 - 129,569,134 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101691 ⟹ ENSRNOP00000088819
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103755 ⟹ ENSRNOP00000086170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,417,750 - 129,619,646 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108771 ⟹ ENSRNOP00000076907
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,314,402 - 129,619,646 (+) Ensembl
RefSeq Acc Id:
NM_001106271 ⟹ NP_001099741
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,724,150 - 139,029,401 (+) NCBI mRatBN7.2 1 129,314,402 - 129,619,647 (+) NCBI Rnor_6.0 1 137,089,558 - 137,315,272 (+) NCBI Rnor_5.0 1 138,007,112 - 138,312,524 (+) NCBI RGSC_v3.4 1 131,052,674 - 131,360,512 (+) RGD Celera 1 121,422,303 - 121,727,463 (+) RGD
Sequence:
CCGTCACCGCCGCCGTCGAGGGAGCGGCGCCTATTGTCCTTCTCCGCCGCAAGGCGCGGAGCTGCTCCGGCTCGGCCGCGGGGAGCCCGGGAGCCGACGTGTCCTGGGTCATGAAACTTAGTCCACAA
hide sequence
RefSeq Acc Id:
XM_039105531 ⟹ XP_038961459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105541 ⟹ XP_038961469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105543 ⟹ XP_038961471
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105547 ⟹ XP_038961475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105548 ⟹ XP_038961476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105549 ⟹ XP_038961477
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105554 ⟹ XP_038961482
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,184 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105560 ⟹ XP_038961488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,184 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105567 ⟹ XP_038961495
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI mRatBN7.2 1 129,313,183 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105573 ⟹ XP_038961501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,724,318 - 139,029,401 (+) NCBI mRatBN7.2 1 129,314,559 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105578 ⟹ XP_038961506
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,870,661 - 139,029,401 (+) NCBI mRatBN7.2 1 129,464,038 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105585 ⟹ XP_038961513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,862,810 - 139,029,401 (+) NCBI mRatBN7.2 1 129,453,064 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105587 ⟹ XP_038961515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,890,485 - 139,029,401 (+) NCBI mRatBN7.2 1 129,480,729 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105588 ⟹ XP_038961516
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,555 - 139,029,401 (+) NCBI mRatBN7.2 1 129,511,777 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_039105591 ⟹ XP_038961519
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,555 - 139,029,401 (+) NCBI mRatBN7.2 1 129,511,776 - 129,619,647 (+) NCBI
RefSeq Acc Id:
XM_063284528 ⟹ XP_063140598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284529 ⟹ XP_063140599
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,722,445 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284552 ⟹ XP_063140622
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,489 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284555 ⟹ XP_063140625
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,447 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284557 ⟹ XP_063140627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,556 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284561 ⟹ XP_063140631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,921,554 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284569 ⟹ XP_063140639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,973,431 - 139,029,401 (+) NCBI
RefSeq Acc Id:
XM_063284572 ⟹ XP_063140642
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 138,973,431 - 139,029,401 (+) NCBI
RefSeq Acc Id:
NP_001099741 ⟸ NM_001106271
- UniProtKB:
Q8VHU6 (UniProtKB/Swiss-Prot), F1M3G7 (UniProtKB/TrEMBL), A0A8I6GDR4 (UniProtKB/TrEMBL)
- Sequence:
MKLSPQQAPLYGDCVVTVLLAEEDKVEDDAIFYLIFSGSTLYHCTSTRKVSSDTLETIAPGHDCCETVKVLLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDRSGPPSGD
hide sequence
Ensembl Acc Id:
ENSRNOP00000014802 ⟸ ENSRNOT00000014802
RefSeq Acc Id:
XP_038961459 ⟸ XM_039105531
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q7A1 (UniProtKB/TrEMBL), A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961471 ⟸ XM_039105543
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961469 ⟸ XM_039105541
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961476 ⟸ XM_039105548
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961475 ⟸ XM_039105547
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961477 ⟸ XM_039105549
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6AJL6 (UniProtKB/TrEMBL), A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961495 ⟸ XM_039105567
- Peptide Label:
isoform X11
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961482 ⟸ XM_039105554
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961488 ⟸ XM_039105560
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I5XVJ8 (UniProtKB/TrEMBL), A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961501 ⟸ XM_039105573
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q7A1 (UniProtKB/TrEMBL), A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961513 ⟸ XM_039105585
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961506 ⟸ XM_039105578
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961515 ⟸ XM_039105587
- Peptide Label:
isoform X14
RefSeq Acc Id:
XP_038961519 ⟸ XM_039105591
- Peptide Label:
isoform X19
RefSeq Acc Id:
XP_038961516 ⟸ XM_039105588
- Peptide Label:
isoform X15
Ensembl Acc Id:
ENSRNOP00000088819 ⟸ ENSRNOT00000101691
Ensembl Acc Id:
ENSRNOP00000086170 ⟸ ENSRNOT00000103755
Ensembl Acc Id:
ENSRNOP00000076907 ⟸ ENSRNOT00000108771
Ensembl Acc Id:
ENSRNOP00000078206 ⟸ ENSRNOT00000095963
Ensembl Acc Id:
ENSRNOP00000077560 ⟸ ENSRNOT00000099409
RefSeq Acc Id:
XP_063140598 ⟸ XM_063284528
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140599 ⟸ XM_063284529
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I5Y2J4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140625 ⟸ XM_063284555
- Peptide Label:
isoform X17
RefSeq Acc Id:
XP_063140622 ⟸ XM_063284552
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063140631 ⟸ XM_063284561
- Peptide Label:
isoform X20
RefSeq Acc Id:
XP_063140627 ⟸ XM_063284557
- Peptide Label:
isoform X18
RefSeq Acc Id:
XP_063140639 ⟸ XM_063284569
- Peptide Label:
isoform X21
RefSeq Acc Id:
XP_063140642 ⟸ XM_063284572
- Peptide Label:
isoform X22
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Akap13
A-kinase anchoring protein 13
Akap13
A kinase (PRKA) anchor protein 13
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-11
Akap13
A kinase (PRKA) anchor protein 13
LOC293024
protein kinase A anchoring protein Rt31
Symbol and Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
