Bco1 (beta-carotene oxygenase 1) - Rat Genome Database

Name: Bco1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Bco1 (beta-carotene oxygenase 1) Rattus norvegicus

Analyze

Symbol:

Bco1

Name:

beta-carotene oxygenase 1

RGD ID:

70981

Description:

Enables beta-carotene 15,15'-dioxygenase activity. Involved in retinoid metabolic process. Predicted to be located in cytosol. Orthologous to human BCO1 (beta-carotene oxygenase 1); PARTICIPATES IN retinol metabolic pathway; vitamin A deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bcdo; Bcmo1; beta,beta-carotene 15,15'-dioxygenase; beta,beta-carotene 15,15'-monooxygenase; beta-carotene 15 15'-dioxygenase; beta-carotene 15 15-dioxygenase; beta-carotene 15, 15'-dioxygenase; beta-carotene 15, 15-dioxygenase; beta-carotene 15,15'-monooxygenase; beta-carotene 15,15'-monooxygenase 1; beta-carotene dioxygenase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BCO1 (beta-carotene oxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Bco1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BCO1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bco1l (beta-carotene oxygenase 1, like)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	bco1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bcmo-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ninaB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bcmo-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bco1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,058,061 - 62,094,923 (+)	NCBI		GRCr8
mRatBN7.2	19	45,149,250 - 45,186,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	51,959,095 - 51,995,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	52,612,116 - 52,648,960 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	54,856,354 - 54,893,189 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	47,207,835 - 47,244,106 (+)	NCBI
Celera	19	44,421,345 - 44,457,802 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

giant axonal neuropathy 1 (ISO)

Hypercarotenemia and Vitamin A Deficiency, Autosomal Dominant (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

9-cis-retinoic acid (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (EXP,ISO)

Allylamine (EXP)

amiodarone (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-carotene (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

D-glucose (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

flavonoids (EXP)

fructose (ISO)

furan (EXP,ISO)

gentamycin (EXP)

glucose (ISO)

herbicide (ISO)

inulin (ISO)

L-ascorbic acid (EXP)

lycopene (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

Ro 41-5253 (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

troglitazone (ISO)

valproic acid (ISO)

vitamin E (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

beta-carotene metabolic process (IEA,ISO)

carotene catabolic process (IBA,IEA,ISO,ISS)

retinal metabolic process (IBA,IEA,ISO,ISS)

retinoid metabolic process (IDA,ISO)

retinol metabolic process (IEA)

Cellular Component

cytosol (ISS)

Molecular Function

beta-carotene 15,15'-dioxygenase activity (IBA,IDA,IEA,ISO)

carotenoid dioxygenase activity (IBA)

metal ion binding (IEA)

oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

retinol metabolic pathway (IEA,ISO,TAS)

vitamin A deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Feedback regulation of beta,beta-carotene 15,15'-monooxygenase by retinoic acid in rats and chickens.	Bachmann H, etal., J Nutr 2002 Dec;132(12):3616-22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.	Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
4.	Mammalian carotenoid-oxygenases: key players for carotenoid function and homeostasis.	Lobo GP, etal., Biochim Biophys Acta. 2012 Jan;1821(1):78-87. Epub 2011 May 4.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11092891	PMID:11401432	PMID:11960992	PMID:19276538	PMID:19509464	PMID:20702748	PMID:21512299	PMID:23327966	PMID:25575786	PMID:25701869

Genomics

Comparative Map Data

Bco1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,058,061 - 62,094,923 (+)	NCBI		GRCr8
mRatBN7.2	19	45,149,250 - 45,186,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	51,959,095 - 51,995,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	52,612,116 - 52,648,960 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	54,856,354 - 54,893,189 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	47,207,835 - 47,244,106 (+)	NCBI
Celera	19	44,421,345 - 44,457,802 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

BCO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	81,238,689 - 81,291,142 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	81,238,689 - 81,291,142 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	81,272,294 - 81,324,747 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	79,829,797 - 79,882,248 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	79,829,796 - 79,882,248	NCBI
Celera	16	65,569,740 - 65,622,032 (+)	NCBI		Celera
Cytogenetic Map	16	q23.2	NCBI
HuRef	16	67,027,575 - 67,079,925 (+)	NCBI		HuRef
CHM1_1	16	82,683,655 - 82,736,052 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	87,299,473 - 87,351,905 (+)	NCBI		T2T-CHM13v2.0

Bco1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	117,822,590 - 117,860,459 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	117,822,593 - 117,860,459 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	117,095,851 - 117,133,720 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	117,095,854 - 117,133,720 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	119,619,765 - 119,657,620 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	119,981,842 - 120,019,458 (+)	NCBI		MGSCv36	mm8
Celera	8	121,315,369 - 121,353,295 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	63.61	NCBI

Bco1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955522	3,985,266 - 4,018,886 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955522	3,985,515 - 4,018,116 (+)	NCBI	ChiLan1.0	ChiLan1.0

BCO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	90,987,587 - 91,047,027 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	96,908,478 - 96,962,121 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	61,843,567 - 61,897,012 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	81,270,957 - 81,323,088 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	81,270,577 - 81,323,088 (+)	Ensembl	panpan1.1		panPan2

BCO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	70,598,743 - 70,637,273 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	70,599,284 - 70,637,017 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	70,547,948 - 70,586,427 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	70,903,713 - 70,942,206 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	70,903,715 - 70,942,392 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	70,846,152 - 70,884,642 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	70,681,343 - 70,719,822 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	71,159,198 - 71,197,682 (-)	NCBI		UU_Cfam_GSD_1.0

Bco1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	30,698,707 - 30,729,976 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	28,859,318 - 28,889,934 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	28,859,222 - 28,890,407 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	7,012,332 - 7,055,305 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	7,008,330 - 7,054,089 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

BCO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	66,681,756 - 66,730,832 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	66,681,513 - 66,733,604 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	9,105,596 - 9,155,354 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bco1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	6,143,892 - 6,180,408 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	6,146,338 - 6,181,020 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bco1
293 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000016880
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	19	33838214	55283146	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat

Markers in Region

D19Got51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	45,156,357 - 45,156,608 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	49,644,103 - 49,644,353	NCBI	Rnor6.0
Rnor_5.0	19	60,431,383 - 60,431,633	UniSTS	Rnor5.0
RGSC_v3.4	19	47,209,981 - 47,210,231	UniSTS	RGSC3.4
RGSC_v3.1	19	47,214,862 - 47,215,112	RGD
Celera	19	44,428,387 - 44,428,637	UniSTS
RH 3.4 Map	19	601.9	UniSTS
RH 3.4 Map	19	601.9	RGD
RH 2.0 Map	19	621.7	RGD
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		30	30		30					1
Low	1	10	22	11	17	11			12	24	20	10
Below cutoff		28	5		2		8	10	60	11	20	1	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016880 ⟹ ENSRNOP00000016880

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112976 ⟹ ENSRNOP00000089555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	45,150,666 - 45,186,101 (+)	Ensembl

RefSeq Acc Id:

NM_053648 ⟹ NP_446100

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,058,140 - 62,094,679 (+)	NCBI
mRatBN7.2	19	45,149,316 - 45,185,863 (+)	NCBI
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	RGD
Celera	19	44,421,345 - 44,457,802 (+)	RGD

Sequence:

show sequence

GGGACAGATGGAGGCATCAAGGAGCAGAGGGCAGGAAGACAGGACGCTTTGAGCACACGGGGCT
TTGTGTCTATTCCACTGACAACCTCCTCACTGCCACCCACCGGTTCCATGGAGATAATATTTGG
CCGGAATAAGAAAGAACAGCTGGAGCCATTACGGGCCACAGTGACAGGCAGCATTCCAGCATGG
CTGCAGGGGACCCTGCTCCGAAACGGGCCTGGGATGCACACAGTGGGAGACAGCAAGTACAACC
ATTGGTTTGATGGCCTGGCCCTTCTCCACAGTTTCTCCATCAGAGATGGGGAGGTCTTCTACAG
GAGCAAATACCTGCAGAGCGACACCTACAACGCCAACATCGAGGCCAATAGAATCGTGGTGTCT
GAGTTCGGAACAATGGCCTACCCAGACCCCTGCAAAAACATCTTTTCCAAAGCTTTCTCCTACT
TGTCCCACACCATCCCCGACTTCACAGACAACTGCCTGATTAACATCATGAAATGTGGAGAAGA
CTTCTATGCCACCACAGAGACCAACTACATCAGGAAAATCGACCCCCAGACTCTAGAGACCTTG
GAGAAGGTTGATTACCGGAAGTATGTGGCTGTAAACCTGGCTACCTCACACCCTCATTACGACG
AGGCTGGAAATGTCCTTAACATGGGTACCTCCATCGCGGACAAAGGAAGGACAAAATACGTGAT
GTTTAAGATCCCCGCCACAGCACCAGGCAGCAAGAAGAAAGGGAAGAACCCCTTGAAGCACTCA
GAAGTTTTCTGCTCCATCCCGTCCCGCTCGCTGCTCTCCCCCAGTTACTACCACAGCTTTGGAG
TCACGGAGAACTATGTGGTGTTTCTGGAGCAGCCTTTTAAGCTGGATATCCTCAAGATGGCCAC
CGCATACATGAGGGGTGTGAGCTGGGCTTCCTGTATGACATTCTGCAAGGAGGACAAGACTTAC
ATTCATATCATCGACCAGAAGACCAGAAAGCCTGTGCCAACCAAATTCTACACAGACCCCATGG
TGGTCTTCCACCATGTTAATGCCTATGAGGAGGACGGCTGTGTGCTGTTTGATGTCATCGCCTA
TGAGGACAACAGTCTCTATCAGCTCTTCTACCTGGCCAACCTGAACAAGGACTTCGAGGAGAAG
TCCAGGCTGACCTCAGTGCCTACCCTCAGGAGGTTTGCTGTGCCCCTCCACGTGGACAAGGATG
CAGAAGTGGGCTCGAATTTAGTCAAGGTGTCATCTACAACAGCAACTGCCCTGAAGGAGAAGGA
CGACCATGTCTACTGCCAGCCTGAGGTCCTCTACGAAGGCCTAGAGCTCCCTCGGATAAATTAT
GCTCACAACGGGAAGCCATATCGCTACATCTTTGCTGCTGAAGTACAATGGAGTCCAGTCCCAA
CCAAGATACTAAAATATGACGTTCTCACCAAGTCCTCCTTAAAGTGGTCCGAGGAGAGCTGCTG
GCCTGCAGAGCCTCTGTTTGTCCCCACACCGGGTGCGAAGGATGAGGATGATGGAGTCATCTTA
TCAGCCATCATCTCTACAGATCCCCAAAAGCTGCCCTTTTTACTTATTCTGGATGCGAAAAGTT
TTACGGAATTGGCTCGCGCCTCTGTTGATGTGGACATGCACCTGGACCTGCATGGTTTATTTAT
TCCGGATGCAGGCTGGAATGCAGTGAAGCAGACTCCAGCCAAAACGCAAGAGGATGAAAATTCA
GATCATCCCACAGGTCTGACAGCACCAGGATTGGGCCATGGTGAAAATGACTTCACGGCAGGTC
ATGGCGGCAAGAGCCTTTAATCCTAGCACTCGAGGCAGAGGCAAGCAGATCTCTGAGTTCAAGG
CCAGCCTGGTCTACAACACAAGTTCCAGGACAGCCAGGGATACACAGAGAAATCCTATCTTGAA
AACAAAGCAAA

hide sequence

RefSeq Acc Id:

XM_039097426 ⟹ XP_038953354

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,070,863 - 62,094,923 (+)	NCBI
mRatBN7.2	19	45,162,116 - 45,186,102 (+)	NCBI

RefSeq Acc Id:

XM_039097427 ⟹ XP_038953355

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,058,061 - 62,075,479 (+)	NCBI
mRatBN7.2	19	45,149,250 - 45,166,649 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446100	(Get FASTA)	NCBI Sequence Viewer
	XP_038953354	(Get FASTA)	NCBI Sequence Viewer
	XP_038953355	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92648	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016880
	ENSRNOP00000016880.3
	ENSRNOP00000089555.1
GenBank Protein	Q91XT5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446100 ⟸ NM_053648

- UniProtKB:

Q91XT5 (UniProtKB/Swiss-Prot), G3V7N1 (UniProtKB/TrEMBL), A6IZH0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEIIFGRNKKEQLEPLRATVTGSIPAWLQGTLLRNGPGMHTVGDSKYNHWFDGLALLHSFSIRD
GEVFYRSKYLQSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINI
MKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIADKG
RTKYVMFKIPATAPGSKKKGKNPLKHSEVFCSIPSRSLLSPSYYHSFGVTENYVVFLEQPFKLD
ILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFYTDPMVVFHHVNAYEEDGCVL
FDVIAYEDNSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTAT
ALKEKDDHVYCQPEVLYEGLELPRINYAHNGKPYRYIFAAEVQWSPVPTKILKYDVLTKSSLKW
SEESCWPAEPLFVPTPGAKDEDDGVILSAIISTDPQKLPFLLILDAKSFTELARASVDVDMHLD
LHGLFIPDAGWNAVKQTPAKTQEDENSDHPTGLTAPGLGHGENDFTAGHGGKSL

hide sequence

RefSeq Acc Id:

ENSRNOP00000016880 ⟸ ENSRNOT00000016880

RefSeq Acc Id:	XP_038953355 ⟸ XM_039097427
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953354 ⟸ XM_039097426
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000089555 ⟸ ENSRNOT00000112976

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91XT5-F1-model_v2	AlphaFold	Q91XT5	1-566	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701170

Promoter ID:

EPDNEW_R11693

Type:

initiation region

Name:

Bco1_1

Description:

beta-carotene oxygenase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	49,637,007 - 49,637,067	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70981	AgrOrtholog
BioCyc Gene	G2FUF-5556	BioCyc
BioCyc Pathway	PWY-6857 [retinol biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6857	BioCyc
Ensembl Genes	ENSRNOG00000012027	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016880	ENTREZGENE
	ENSRNOT00000016880.6	UniProtKB/TrEMBL
	ENSRNOT00000112976.1	UniProtKB/TrEMBL
InterPro	Carotenoid_Oase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114106	UniProtKB/TrEMBL
NCBI Gene	114106	ENTREZGENE
PANTHER	BETA,BETA-CAROTENE 15,15'-DIOXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10543	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RPE65	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bco1	PhenoGen
RatGTEx	ENSRNOG00000012027	RatGTEx
UniProt	A0A8I6AAK4_RAT	UniProtKB/TrEMBL
	A6IZH0	ENTREZGENE, UniProtKB/TrEMBL
	BCDO1_RAT	UniProtKB/Swiss-Prot
	G3V7N1	ENTREZGENE, UniProtKB/TrEMBL
	Q91XT5	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-23	Bco1	beta-carotene oxygenase 1	Bcmo1	beta-carotene 15,15'-monooxygenase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bcmo1	beta-carotene 15,15'-monooxygenase 1	Bcmo1	beta-carotene 15,15'-monooxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Bcmo1	beta-carotene 15,15'-monooxygenase			Symbol and Name updated	1299863	APPROVED
2002-07-09	Bcdo	beta-carotene 15, 15-dioxygenase			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	induced by retinoids and carotenoids	634627

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways