Symbol:
Igf2bp1
Name:
insulin-like growth factor 2 mRNA binding protein 1
RGD ID:
708580
Description:
Enables mRNA 3'-UTR binding activity. Involved in RNA localization and dendrite arborization. Located in axon; dendritic spine; and neuronal cell body. Orthologous to human IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bis(2-ethylhexyl) phthalate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
B-actin zipcode-binding protein 1; IGF-II mRNA-binding protein 1; IGF2 mRNA-binding protein 1; IMP-1; Imp1; insulin-like growth factor 2 binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; insulin-like growth factor 2, binding protein 1; rZBP-1; VICKZ family member 1; ZBP1; zipcode-binding protein-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Igf2bp1 (insulin-like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Igf2bp1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Igf2bp1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Igf2bp1 (insulin like growth factor 2 mRNA binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IGF2BP3 (insulin like growth factor 2 mRNA binding protein 3) HGNC
OrthoDB
Homo sapiens (human):
LRRC58 (leucine rich repeat containing 58) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
IGF2BP1 (insulin like growth factor 2 mRNA binding protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Igf2bp1 (insulin-like growth factor 2 mRNA binding protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
igf2bp1 (insulin-like growth factor 2 mRNA binding protein 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Imp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
imph-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 81,405,021 - 81,447,814 (-) NCBI GRCr8 mRatBN7.2 10 80,908,300 - 80,951,097 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,908,076 - 80,951,129 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,857,301 - 85,899,408 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 85,355,335 - 85,397,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,747,478 - 80,789,863 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,774,178 - 83,823,323 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,780,203 - 83,822,996 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,579,028 - 83,628,914 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,671,084 - 84,714,648 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,685,453 - 84,729,018 (-) NCBI Celera 10 79,676,729 - 79,719,122 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Igf2bp1 Rat 1,4-benzoquinone decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 quinone results in decreased expression of IGF2BP1 mRNA CTD PMID:38367942 Igf2bp1 Rat 1,4-benzoquinone decreases expression ISO Igf2bp1 (Mus musculus) 6480464 quinone results in decreased expression of IGF2BP1 mRNA CTD PMID:36306860 Igf2bp1 Rat 1,4-benzoquinone multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 IGF2BP1 inhibits the reaction [quinone results in decreased expression of RPL36 mRNA] and quinone promotes the reaction [IGF2BP1 protein binds to RPL36 mRNA] CTD PMID:38367942 Igf2bp1 Rat 17beta-estradiol multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of IGF2BP1 mRNA CTD PMID:30165855 Igf2bp1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Igf2bp1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Igf2bp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Igf2bp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IGF2BP1 mRNA CTD PMID:21570461 Igf2bp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IGF2BP1 mRNA CTD PMID:33387578 Igf2bp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of IGF2BP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of IGF2BP1 mRNA CTD PMID:28628672 Igf2bp1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Igf2bp1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of IGF2BP1 mRNA CTD PMID:18648102 Igf2bp1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of IGF2BP1 mRNA CTD PMID:28628672 Igf2bp1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Igf2bp1 (Mus musculus) 6480464 bisphenol S affects the methylation of IGF2BP1 gene CTD PMID:31683443 Igf2bp1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Igf2bp1 (Mus musculus) 6480464 bisphenol S results in increased methylation of IGF2BP1 promoter CTD PMID:33297965 Igf2bp1 Rat aflatoxin B1 decreases methylation ISO IGF2BP1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of IGF2BP1 gene CTD PMID:27153756 Igf2bp1 Rat Aflatoxin B2 alpha decreases methylation ISO IGF2BP1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of IGF2BP1 promoter CTD PMID:30157460 Igf2bp1 Rat aldehydo-D-glucose multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of IGF2BP1 mRNA CTD PMID:37567420 Igf2bp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IGF2BP1 mRNA CTD PMID:16483693 Igf2bp1 Rat arsane affects methylation ISO IGF2BP1 (Homo sapiens) 6480464 Arsenic affects the methylation of IGF2BP1 gene CTD PMID:25304211 Igf2bp1 Rat arsenic atom affects methylation ISO IGF2BP1 (Homo sapiens) 6480464 Arsenic affects the methylation of IGF2BP1 gene CTD PMID:25304211 Igf2bp1 Rat arsenite(3-) multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to IGF2BP1 mRNA] CTD PMID:32406909 Igf2bp1 Rat benzene multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 IGF2BP1 inhibits the reaction [Benzene results in decreased expression of PCNA mRNA] more ... CTD PMID:38367942 and PMID:38866309 Igf2bp1 Rat benzene decreases expression ISO Igf2bp1 (Mus musculus) 6480464 Benzene results in decreased expression of IGF2BP1 mRNA CTD PMID:38866309 Igf2bp1 Rat benzene decreases response to substance ISO Igf2bp1 (Mus musculus) 6480464 IGF2BP1 results in decreased susceptibility to Benzene CTD PMID:38367942 Igf2bp1 Rat benzene decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Benzene results in decreased expression of IGF2BP1 protein CTD PMID:38367942 Igf2bp1 Rat benzo[a]pyrene increases methylation ISO IGF2BP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of IGF2BP1 exon and Benzo(a)pyrene results in increased methylation of IGF2BP1 promoter CTD PMID:27901495 Igf2bp1 Rat benzo[a]pyrene decreases methylation ISO Igf2bp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of IGF2BP1 intron CTD PMID:27901495 Igf2bp1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of IGF2BP1 promoter CTD PMID:23359474 Igf2bp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Igf2bp1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of IGF2BP1 mRNA CTD PMID:36423848 Igf2bp1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of IGF2BP1 promoter CTD PMID:23359474 Igf2bp1 Rat bisphenol A decreases expression ISO Igf2bp1 (Mus musculus) 6480464 bisphenol A results in decreased expression of IGF2BP1 mRNA CTD PMID:38074096 Igf2bp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IGF2BP1 mRNA CTD PMID:25181051 more ... Igf2bp1 Rat bisphenol AF increases expression ISO IGF2BP1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of IGF2BP1 protein CTD PMID:34186270 Igf2bp1 Rat bisphenol F multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of IGF2BP1 mRNA CTD PMID:28628672 Igf2bp1 Rat bisphenol F increases expression ISO IGF2BP1 (Homo sapiens) 6480464 bisphenol F results in increased expression of IGF2BP1 protein CTD PMID:34186270 Igf2bp1 Rat buta-1,3-diene increases expression ISO Igf2bp1 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of IGF2BP1 mRNA CTD PMID:29038090 Igf2bp1 Rat butanal decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of IGF2BP1 mRNA CTD PMID:26079696 Igf2bp1 Rat caffeine affects phosphorylation ISO IGF2BP1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of IGF2BP1 protein CTD PMID:35688186 Igf2bp1 Rat cantharidin increases expression ISO Igf2bp1 (Mus musculus) 6480464 Cantharidin results in increased expression of IGF2BP1 mRNA CTD PMID:36907384 Igf2bp1 Rat carbon monoxide multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Carbon Monoxide] which affects the methylation of IGF2BP1 gene CTD PMID:35999615 Igf2bp1 Rat cisplatin decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of IGF2BP1 mRNA CTD PMID:27392435 and PMID:27594783 Igf2bp1 Rat cisplatin multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of IGF2BP1 mRNA CTD PMID:27392435 Igf2bp1 Rat cobalt dichloride decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of IGF2BP1 mRNA CTD PMID:19320972 Igf2bp1 Rat copper(II) sulfate increases expression ISO IGF2BP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of IGF2BP1 mRNA CTD PMID:19549813 Igf2bp1 Rat D-glucose multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of IGF2BP1 mRNA CTD PMID:37567420 Igf2bp1 Rat dexamethasone multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of IGF2BP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of IGF2BP1 mRNA CTD PMID:28628672 Igf2bp1 Rat diazinon increases methylation ISO IGF2BP1 (Homo sapiens) 6480464 Diazinon results in increased methylation of IGF2BP1 gene CTD PMID:22964155 Igf2bp1 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of IGF2BP1 promoter CTD PMID:23359474 Igf2bp1 Rat dicrotophos increases expression ISO IGF2BP1 (Homo sapiens) 6480464 dicrotophos results in increased expression of IGF2BP1 mRNA CTD PMID:28302478 Igf2bp1 Rat dorsomorphin multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2BP1 mRNA CTD PMID:27188386 Igf2bp1 Rat doxorubicin increases expression ISO IGF2BP1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of IGF2BP1 mRNA and Doxorubicin results in increased expression of IGF2BP1 protein CTD PMID:34648132 Igf2bp1 Rat doxorubicin multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Doxorubicin results in increased expression of IGF2BP1 protein] which binds to and results in increased stability of KCNQ1OT1 mRNA CTD PMID:34648132 Igf2bp1 Rat emetine multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 IGF2BP1 protein affects the reaction [Emetine results in increased degradation of MYCN protein] CTD PMID:37246217 Igf2bp1 Rat entinostat multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2BP1 mRNA CTD PMID:27188386 Igf2bp1 Rat entinostat increases expression ISO IGF2BP1 (Homo sapiens) 6480464 entinostat results in increased expression of IGF2BP1 mRNA CTD PMID:26272509 Igf2bp1 Rat enzyme inhibitor multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of IGF2BP1 protein CTD PMID:23301498 Igf2bp1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of IGF2BP1 mRNA CTD PMID:30307764 Igf2bp1 Rat fructose multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of IGF2BP1 mRNA CTD PMID:37567420 Igf2bp1 Rat fulvestrant increases methylation ISO IGF2BP1 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of IGF2BP1 gene CTD PMID:31601247 Igf2bp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of IGF2BP1 mRNA CTD PMID:33387578 Igf2bp1 Rat glucose multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of IGF2BP1 mRNA CTD PMID:37567420 Igf2bp1 Rat indometacin multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of IGF2BP1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of IGF2BP1 mRNA CTD PMID:28628672 Igf2bp1 Rat ivermectin decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of IGF2BP1 protein CTD PMID:32959892 Igf2bp1 Rat lead(0) affects expression ISO IGF2BP1 (Homo sapiens) 6480464 Lead affects the expression of IGF2BP1 mRNA CTD PMID:28903495 Igf2bp1 Rat lipopolysaccharide increases expression ISO Igf2bp1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of IGF2BP1 mRNA CTD PMID:26582142 Igf2bp1 Rat methylmercury chloride increases expression ISO IGF2BP1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of IGF2BP1 mRNA CTD PMID:28001369 Igf2bp1 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Igf2bp1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of IGF2BP1 mRNA CTD PMID:22401849 Igf2bp1 Rat nickel sulfate decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of IGF2BP1 mRNA CTD PMID:22714537 Igf2bp1 Rat ozone multiple interactions ISO Igf2bp1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of IGF2BP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IGF2BP1 mRNA CTD PMID:34911549 Igf2bp1 Rat paracetamol decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of IGF2BP1 mRNA CTD PMID:26690555 Igf2bp1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of IGF2BP1 mRNA CTD PMID:33387578 Igf2bp1 Rat paraquat increases expression ISO IGF2BP1 (Homo sapiens) 6480464 Paraquat results in increased expression of IGF2BP1 protein CTD PMID:34064677 Igf2bp1 Rat potassium chromate increases expression ISO IGF2BP1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of IGF2BP1 mRNA CTD PMID:22714537 Igf2bp1 Rat SB 431542 increases expression ISO IGF2BP1 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of IGF2BP1 protein CTD PMID:25670856 Igf2bp1 Rat SB 431542 multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IGF2BP1 mRNA CTD PMID:27188386 Igf2bp1 Rat sodium arsenite decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of IGF2BP1 mRNA CTD PMID:22714537 Igf2bp1 Rat sodium arsenite decreases expression ISO Igf2bp1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of IGF2BP1 mRNA CTD PMID:36209798 Igf2bp1 Rat sodium arsenite increases expression ISO IGF2BP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of IGF2BP1 mRNA CTD PMID:29301061 Igf2bp1 Rat succimer multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of IGF2BP1 mRNA CTD PMID:26378955 Igf2bp1 Rat sulfur dioxide multiple interactions ISO IGF2BP1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Sulfur Dioxide] which affects the methylation of IGF2BP1 gene CTD PMID:35999615 Igf2bp1 Rat tert-butyl hydroperoxide increases expression ISO Igf2bp1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of IGF2BP1 mRNA CTD PMID:14729362 Igf2bp1 Rat titanium dioxide increases methylation ISO Igf2bp1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of IGF2BP1 gene CTD PMID:35295148 Igf2bp1 Rat titanium dioxide decreases methylation ISO Igf2bp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IGF2BP1 gene and titanium dioxide results in decreased methylation of IGF2BP1 promoter CTD PMID:35295148 Igf2bp1 Rat trovafloxacin increases expression ISO Igf2bp1 (Mus musculus) 6480464 trovafloxacin results in increased expression of IGF2BP1 mRNA CTD PMID:35537566 Igf2bp1 Rat urethane decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Urethane results in decreased expression of IGF2BP1 mRNA CTD PMID:28818685 Igf2bp1 Rat valproic acid decreases expression ISO Igf2bp1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of IGF2BP1 mRNA CTD PMID:21427059 Igf2bp1 Rat valproic acid decreases expression ISO IGF2BP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of IGF2BP1 mRNA CTD PMID:28001369 Igf2bp1 Rat valproic acid affects expression ISO IGF2BP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of IGF2BP1 mRNA CTD PMID:25979313 Igf2bp1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of IMP1 mRNA CTD PMID:18042343
1,4-benzoquinone (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) caffeine (ISO) cantharidin (ISO) carbon monoxide (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) D-glucose (ISO) dexamethasone (ISO) diazinon (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) emetine (ISO) entinostat (ISO) enzyme inhibitor (ISO) fenvalerate (EXP) fructose (ISO) fulvestrant (ISO) gentamycin (EXP) glucose (ISO) indometacin (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel sulfate (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) potassium chromate (ISO) SB 431542 (ISO) sodium arsenite (ISO) succimer (ISO) sulfur dioxide (ISO) tert-butyl hydroperoxide (ISO) titanium dioxide (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
CRD-mediated mRNA stabilization (IBA,IEA,ISO,ISS) dendrite arborization (IMP) mRNA transport (IEA) negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (IEA,ISO) negative regulation of translation (IEA,ISO) nervous system development (IBA) neuronal stem cell population maintenance (IEA,ISO) pallium cell proliferation in forebrain (IEA,ISO) positive regulation of cytoplasmic translation (IEA,ISO) regulation of mRNA stability involved in response to stress (IEA,ISO,ISS) regulation of translation (IEA) RNA localization (IMP)
Cellular Component
axon (IDA,IEA) cell projection (IEA) CRD-mediated mRNA stability complex (IEA,ISO,ISS) cytoplasm (IBA,IEA,ISO) cytoplasmic stress granule (IEA,ISO,ISS) cytosol (IBA,IEA,ISO) dendrite (IDA,IEA) dendritic spine (IDA,IEA) filopodium (IEA) growth cone (IEA) lamellipodium (IEA) neuronal cell body (IDA) nucleoplasm (IEA,ISO) nucleus (IBA,IEA) P-body (IEA,ISO,ISS) perinuclear region of cytoplasm (IEA) ribonucleoprotein complex (IEA,ISO,ISS) synapse (IEA)
Molecular Function
mRNA 3'-UTR binding (IBA,IDA,IEA,ISO,ISS) mRNA 5'-UTR binding (IEA,ISO) mRNA binding (IEA,ISO,ISS) N6-methyladenosine-containing RNA reader activity (IEA,ISO,ISS) nucleic acid binding (IEA) protein binding (ISO) RNA binding (IEA) translation regulator activity (IEA,ISO)
1.
Localization of a beta-actin messenger ribonucleoprotein complex with zipcode-binding protein modulates the density of dendritic filopodia and filopodial synapses.
Eom T, etal., J Neurosci 2003 Nov 12;23(32):10433-44.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Species-independent contribution of ZBP1/DAI/DLM-1-triggered necroptosis in host defense against HSV1.
Guo H, etal., Cell Death Dis. 2018 Jul 26;9(8):816. doi: 10.1038/s41419-018-0868-3.
4.
Loss of Stromal IMP1 Promotes a Tumorigenic Microenvironment in the Colon.
Hamilton KE, etal., Mol Cancer Res. 2015 Nov;13(11):1478-86. doi: 10.1158/1541-7786.MCR-15-0224. Epub 2015 Jul 20.
5.
Zipcode binding protein 1 regulates the development of dendritic arbors in hippocampal neurons.
Perycz M, etal., J Neurosci. 2011 Apr 6;31(14):5271-85. doi: 10.1523/JNEUROSCI.2387-10.2011.
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Activity-dependent trafficking and dynamic localization of zipcode binding protein 1 and beta-actin mRNA in dendrites and spines of hippocampal neurons.
Tiruchinapalli DM, etal., J Neurosci. 2003 Apr 15;23(8):3251-61.
Igf2bp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 81,405,021 - 81,447,814 (-) NCBI GRCr8 mRatBN7.2 10 80,908,300 - 80,951,097 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 80,908,076 - 80,951,129 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 85,857,301 - 85,899,408 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 85,355,335 - 85,397,441 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 80,747,478 - 80,789,863 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 83,774,178 - 83,823,323 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 83,780,203 - 83,822,996 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 83,579,028 - 83,628,914 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 84,671,084 - 84,714,648 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 84,685,453 - 84,729,018 (-) NCBI Celera 10 79,676,729 - 79,719,122 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
IGF2BP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 48,996,558 - 49,056,145 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 48,997,385 - 49,056,145 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 47,074,747 - 47,133,507 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 44,429,773 - 44,488,506 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 43,529,020 - 43,588,502 (+) NCBI Celera Cytogenetic Map 17 q21.32 NCBI HuRef 17 42,441,949 - 42,500,581 (+) NCBI HuRef CHM1_1 17 47,140,077 - 47,198,718 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 49,859,908 - 49,919,501 (+) NCBI T2T-CHM13v2.0
Igf2bp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 95,847,989 - 95,896,770 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 95,847,989 - 95,896,766 (-) Ensembl GRCm39 Ensembl GRCm38 11 95,957,163 - 96,005,944 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 95,957,163 - 96,005,940 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 95,818,477 - 95,867,258 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 95,778,822 - 95,822,002 (-) NCBI MGSCv36 mm8 Celera 11 105,607,858 - 105,656,580 (-) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 59.08 NCBI
Igf2bp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 12,312,715 - 12,348,663 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 12,312,715 - 12,348,663 (-) NCBI ChiLan1.0 ChiLan1.0
IGF2BP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 16,042,863 - 16,101,303 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 18,008,913 - 18,067,542 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 8,479,806 - 8,538,336 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 8,461,552 - 8,519,550 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 8,468,240 - 8,519,552 (-) Ensembl panpan1.1 panPan2
IGF2BP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 25,199,287 - 25,240,693 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 25,198,805 - 25,240,578 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 24,660,181 - 24,703,349 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 25,994,308 - 26,036,588 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 25,993,861 - 26,034,618 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 24,762,182 - 24,805,339 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 25,020,613 - 25,063,780 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 25,149,583 - 25,192,753 (+) NCBI UU_Cfam_GSD_1.0
Igf2bp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 24,605,834 - 24,645,145 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 12,430,008 - 12,469,083 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 12,430,343 - 12,468,794 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IGF2BP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 25,197,058 - 25,243,272 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 25,196,955 - 25,244,660 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 25,162,754 - 25,209,240 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IGF2BP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 69,405,923 - 69,461,613 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 69,406,549 - 69,459,175 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 40,510,372 - 40,569,936 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igf2bp1
.
Predicted Target Of
Count of predictions: 219 Count of miRNA genes: 153 Interacting mature miRNAs: 164 Transcripts: ENSRNOT00000008139 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 634354 Rends3 Renal damage susceptibility QTL 3 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 10 79813789 85160854 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
BI276370
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 80,908,117 - 80,908,207 (+) MAPPER mRatBN7.2 Rnor_6.0 10 83,780,021 - 83,780,110 NCBI Rnor6.0 Rnor_5.0 10 83,584,871 - 83,584,960 UniSTS Rnor5.0 RGSC_v3.4 10 84,670,902 - 84,670,991 UniSTS RGSC3.4 Celera 10 79,676,547 - 79,676,636 UniSTS RH 3.4 Map 10 743.8 UniSTS Cytogenetic Map 10 q31 UniSTS
UniSTS:498743
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 80,912,390 - 80,913,180 (+) MAPPER mRatBN7.2 Rnor_6.0 10 83,784,293 - 83,785,082 NCBI Rnor6.0 Rnor_5.0 10 83,589,142 - 83,589,931 UniSTS Rnor5.0 RGSC_v3.4 10 84,675,175 - 84,675,964 UniSTS RGSC3.4 Celera 10 79,680,819 - 79,681,608 UniSTS Cytogenetic Map 10 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
4
30
82
56
64
45
8
45
4
140
44
72
45
54
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008139 ⟹ ENSRNOP00000008139
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,908,076 - 80,951,129 (-) Ensembl Rnor_6.0 Ensembl 10 83,780,203 - 83,822,996 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119485 ⟹ ENSRNOP00000095130
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 80,908,076 - 80,951,129 (-) Ensembl
RefSeq Acc Id:
NM_175594 ⟹ NP_783184
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 81,405,021 - 81,447,814 (-) NCBI mRatBN7.2 10 80,908,300 - 80,951,097 (-) NCBI Rnor_6.0 10 83,780,203 - 83,822,996 (-) NCBI Rnor_5.0 10 83,579,028 - 83,628,914 (-) NCBI RGSC_v3.4 10 84,671,084 - 84,714,648 (-) RGD Celera 10 79,676,729 - 79,719,122 (-) RGD
Sequence:
GGCGGGCACTTCTCCCGGGCTAACCCGAATTCTCCCGTGACCTCCGCGTGCCCTCAGGCCACCCACCGGCCCGGATCTCCGACCAACTTCAGGGGTGGGGTGCGTAGAAAGTTTGCGGCTCCCGCCGC
hide sequence
RefSeq Acc Id:
NP_783184 ⟸ NM_175594
- UniProtKB:
B1WBP3 (UniProtKB/Swiss-Prot), Q8CGX0 (UniProtKB/Swiss-Prot), A0A8I6AN86 (UniProtKB/TrEMBL)
- Sequence:
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSN
hide sequence
Ensembl Acc Id:
ENSRNOP00000008139 ⟸ ENSRNOT00000008139
Ensembl Acc Id:
ENSRNOP00000095130 ⟸ ENSRNOT00000119485
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Igf2bp1
insulin-like growth factor 2 mRNA binding protein 1
Igf2bp1
insulin-like growth factor 2, binding protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Igf2bp1
insulin-like growth factor 2, binding protein 1
Imp1
Symbol updated
1299863 APPROVED
2004-02-11
Ppil3
insulin-like growth factor 2, binding protein 1
Imp1
IGF-II mRNA-binding protein 1
Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
