Symbol:
Kcnd3
Name:
potassium voltage-gated channel subfamily D member 3
RGD ID:
68394
Description:
Enables A-type (transient outward) potassium channel activity. Involved in cellular response to BMP stimulus; potassium ion export across plasma membrane; and potassium ion import across plasma membrane. Located in several cellular components, including caveola; neuronal cell body; and perinuclear endoplasmic reticulum. Part of voltage-gated potassium channel complex. Human ortholog(s) of this gene implicated in Brugada syndrome 9 and spinocerebellar ataxia type 19/22. Orthologous to human KCND3 (potassium voltage-gated channel subfamily D member 3); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A-type voltage-gated potassium channel KCND3; Kv4.3; LOC684161; potassium channel, voltage-gated Shal-related subfamily D, member 3; potassium voltage gated channel, Shal-related family, member 3; potassium voltage-gated channel, Shal-related subfamily, member 3; similar to Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3); voltage-gated potassium channel subunit Kv4.3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCND3 (potassium voltage-gated channel subfamily D member 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Kcnd3 (potassium voltage-gated channel, Shal-related family, member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcnd3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KCND3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCND3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcnd3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCND3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCND3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcnd3 (potassium voltage-gated channel subfamily D member 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
COMP (cartilage oligomeric matrix protein) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
KCND3 (potassium voltage-gated channel subfamily D member 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kcnd3 (potassium voltage-gated channel, Shal-related family, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kcnd3 (potassium voltage-gated channel, Shal-related subfamily, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
shl-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Shal
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kcnd3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 195,626,316 - 195,843,690 (+) NCBI GRCr8 mRatBN7.2 2 192,937,950 - 193,155,345 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 192,937,950 - 193,155,345 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 200,532,308 - 200,749,767 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 198,418,563 - 198,635,769 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 193,235,506 - 193,452,721 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 207,923,775 - 208,140,727 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 207,923,775 - 208,140,727 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 227,345,052 - 227,561,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 200,709,778 - 200,924,575 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 128,828,320 - 128,840,436 (+) NCBI Celera 2 185,602,165 - 185,617,489 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kcnd3 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of KCND3 mRNA CTD PMID:30723492 Kcnd3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of KCND3 mRNA CTD PMID:15834898 Kcnd3 Rat 17beta-estradiol decreases activity EXP 6480464 Estradiol results in decreased activity of KCND3 protein CTD PMID:25231973 Kcnd3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcnd3 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcnd3 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO KCND3 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Kcnd3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KCND3 mRNA CTD PMID:22298810 Kcnd3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Kcnd3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Kcnd3 Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile decreases activity ISO KCND3 (Homo sapiens) 6480464 Verapamil results in decreased activity of KCND3 protein CTD PMID:11181069 Kcnd3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Kcnd3 Rat 4-aminopyridine increases expression EXP 6480464 4-Aminopyridine results in increased expression of KCND3 mRNA CTD PMID:25917026 Kcnd3 Rat 4-aminopyridine multiple interactions EXP 6480464 KCNIP1 mRNA promotes the reaction [4-Aminopyridine results in increased expression of KCND3 mRNA] CTD PMID:25917026 Kcnd3 Rat 4-hydroxyphenyl retinamide increases expression ISO Kcnd3 (Mus musculus) 6480464 Fenretinide results in increased expression of KCND3 mRNA CTD PMID:28973697 Kcnd3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KCND3 mRNA CTD PMID:24780913 Kcnd3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of KCND3 mRNA CTD PMID:28959563 Kcnd3 Rat aflatoxin B1 decreases methylation ISO KCND3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of KCND3 gene CTD PMID:27153756 Kcnd3 Rat aflatoxin B1 decreases expression ISO KCND3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of KCND3 mRNA CTD PMID:32234424 Kcnd3 Rat aflatoxin B1 increases methylation ISO KCND3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KCND3 intron CTD PMID:30157460 Kcnd3 Rat Aflatoxin B2 alpha increases methylation ISO KCND3 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of KCND3 intron CTD PMID:30157460 Kcnd3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KCND3 mRNA CTD PMID:16483693 Kcnd3 Rat antirheumatic drug decreases expression ISO KCND3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KCND3 mRNA CTD PMID:24449571 Kcnd3 Rat aristolochic acid A decreases expression ISO KCND3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KCND3 mRNA CTD PMID:33212167 Kcnd3 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KCND3 mRNA CTD PMID:21839799 Kcnd3 Rat benzo[a]pyrene decreases expression ISO KCND3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of KCND3 mRNA CTD PMID:32234424 Kcnd3 Rat benzo[a]pyrene increases methylation ISO KCND3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KCND3 promoter CTD PMID:27901495 Kcnd3 Rat benzo[a]pyrene affects methylation ISO KCND3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KCND3 5' UTR CTD PMID:27901495 Kcnd3 Rat benzo[a]pyrene affects expression ISO KCND3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of KCND3 mRNA CTD PMID:22316170 Kcnd3 Rat benzo[e]pyrene increases methylation ISO KCND3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of KCND3 intron CTD PMID:30157460 Kcnd3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KCND3 mRNA CTD PMID:25181051 Kcnd3 Rat bisphenol A increases expression ISO Kcnd3 (Mus musculus) 6480464 bisphenol A results in increased expression of KCND3 mRNA CTD PMID:35598803 Kcnd3 Rat bisphenol A decreases methylation ISO KCND3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of KCND3 gene CTD PMID:31601247 Kcnd3 Rat bisphenol A decreases methylation ISO Kcnd3 (Mus musculus) 6480464 bisphenol A results in decreased methylation of KCND3 promoter CTD PMID:27312807 Kcnd3 Rat cadmium dichloride decreases activity ISO KCND3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased activity of KCND3 protein CTD PMID:11181069 Kcnd3 Rat calcitriol increases expression ISO KCND3 (Homo sapiens) 6480464 Calcitriol results in increased expression of KCND3 mRNA CTD PMID:21592394 Kcnd3 Rat calcitriol multiple interactions ISO KCND3 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KCND3 mRNA CTD PMID:21592394 Kcnd3 Rat carbon nanotube decreases expression ISO Kcnd3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kcnd3 Rat CGP 52608 multiple interactions ISO KCND3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KCND3 gene] CTD PMID:28238834 Kcnd3 Rat chelerythrine multiple interactions ISO KCND3 (Homo sapiens) 6480464 chelerythrine inhibits the reaction [Phenylephrine results in decreased activity of KCND3 protein alternative form] CTD PMID:11709419 Kcnd3 Rat clothianidin decreases expression ISO KCND3 (Homo sapiens) 6480464 clothianidin results in decreased expression of KCND3 mRNA CTD PMID:31626844 Kcnd3 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of KCND3 mRNA CTD PMID:17898221 Kcnd3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of KCND3 mRNA CTD PMID:30556269 Kcnd3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of KCND3 mRNA CTD PMID:30556269 Kcnd3 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of KCND3 mRNA CTD PMID:23914054 Kcnd3 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of KCND3 mRNA CTD PMID:23640034 Kcnd3 Rat diallyl trisulfide multiple interactions ISO KCND3 (Homo sapiens) 6480464 diallyl trisulfide binds to and results in decreased activity of KCND3 protein CTD PMID:23272117 Kcnd3 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of KCND3 mRNA CTD PMID:37567419 Kcnd3 Rat doxorubicin decreases expression ISO KCND3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KCND3 mRNA CTD PMID:29803840 Kcnd3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of KCND3 mRNA CTD PMID:29391264 Kcnd3 Rat ethanol affects splicing ISO Kcnd3 (Mus musculus) 6480464 Ethanol affects the splicing of KCND3 mRNA CTD PMID:30319688 Kcnd3 Rat ethanol multiple interactions ISO Kcnd3 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCND3 mRNA] CTD PMID:34864093 Kcnd3 Rat ethanol decreases expression ISO Kcnd3 (Mus musculus) 6480464 Ethanol results in decreased expression of KCND3 mRNA and Ethanol results in decreased expression of KCND3 protein CTD PMID:34864093 Kcnd3 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of KCND3 mRNA CTD PMID:30307764 Kcnd3 Rat ferrostatin-1 multiple interactions ISO Kcnd3 (Mus musculus) 6480464 ferrostatin-1 inhibits the reaction [Ethanol results in decreased expression of KCND3 mRNA] CTD PMID:34864093 Kcnd3 Rat fluoxetine decreases activity ISO KCND3 (Homo sapiens) 6480464 Fluoxetine results in decreased activity of KCND3 protein CTD PMID:35550413 Kcnd3 Rat fulvestrant multiple interactions EXP 6480464 Raloxifene Hydrochloride promotes the reaction [Fulvestrant results in decreased activity of KCND3 protein] CTD PMID:25231973 Kcnd3 Rat fulvestrant decreases activity EXP 6480464 Fulvestrant results in decreased activity of KCND3 protein CTD PMID:25231973 Kcnd3 Rat genistein increases expression ISO Kcnd3 (Mus musculus) 6480464 Genistein results in increased expression of KCND3 mRNA CTD PMID:32186404 Kcnd3 Rat glufosinate decreases expression ISO Kcnd3 (Mus musculus) 6480464 phosphinothricin results in decreased expression of KCND3 mRNA CTD PMID:34597628 Kcnd3 Rat lipopolysaccharide increases expression ISO KCND3 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of KCND3 mRNA CTD PMID:35811015 Kcnd3 Rat lipopolysaccharide multiple interactions ISO KCND3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of KCND3 mRNA] CTD PMID:35811015 Kcnd3 Rat maneb multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of KCND3 mRNA CTD PMID:36117858 Kcnd3 Rat methapyrilene increases methylation ISO KCND3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of KCND3 intron CTD PMID:30157460 Kcnd3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KCND3 gene CTD PMID:35440735 Kcnd3 Rat mono(2-ethylhexyl) phthalate decreases expression ISO KCND3 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of KCND3 mRNA CTD PMID:36695872 Kcnd3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of KCND3 mRNA CTD PMID:26720608 Kcnd3 Rat O-methyleugenol decreases expression ISO KCND3 (Homo sapiens) 6480464 methyleugenol results in decreased expression of KCND3 mRNA CTD PMID:32234424 Kcnd3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KCND3 mRNA CTD PMID:25729387 Kcnd3 Rat ozone multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KCND3 mRNA CTD PMID:34911549 Kcnd3 Rat paracetamol affects expression ISO Kcnd3 (Mus musculus) 6480464 Acetaminophen affects the expression of KCND3 mRNA CTD PMID:17562736 Kcnd3 Rat paracetamol decreases expression ISO KCND3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KCND3 mRNA CTD PMID:21420995 Kcnd3 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of KCND3 mRNA CTD PMID:32680482 Kcnd3 Rat paraquat multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of KCND3 mRNA CTD PMID:36117858 Kcnd3 Rat PCB138 multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcnd3 Rat phenylephrine multiple interactions ISO KCND3 (Homo sapiens) 6480464 [KCND3 protein co-treated with ADRA1A protein] affects the susceptibility to Phenylephrine more ... CTD PMID:11709419 Kcnd3 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of KCND3 mRNA and Phenylephrine results in decreased expression of KCND3 protein CTD PMID:11249870 more ... Kcnd3 Rat phorbol 13-acetate 12-myristate decreases activity ISO KCND3 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased activity of KCND3 protein alternative form CTD PMID:11709419 Kcnd3 Rat pioglitazone multiple interactions ISO Kcnd3 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of KCND3 mRNA CTD PMID:27935865 Kcnd3 Rat progesterone increases expression ISO Kcnd3 (Mus musculus) 6480464 Progesterone results in increased expression of KCND3 mRNA CTD PMID:22238285 Kcnd3 Rat raloxifene decreases activity EXP 6480464 Raloxifene Hydrochloride results in decreased activity of KCND3 protein CTD PMID:25231973 Kcnd3 Rat raloxifene multiple interactions EXP 6480464 Raloxifene Hydrochloride promotes the reaction [Fulvestrant results in decreased activity of KCND3 protein] CTD PMID:25231973 Kcnd3 Rat raloxifene decreases expression EXP 6480464 Raloxifene Hydrochloride results in decreased expression of KCND3 mRNA CTD PMID:25231973 Kcnd3 Rat raloxifene multiple interactions ISO KCND3 (Homo sapiens) 6480464 [KCNIP2 protein co-treated with Raloxifene Hydrochloride] results in decreased activity of KCND3 protein CTD PMID:25231973 Kcnd3 Rat reserpine decreases expression EXP 6480464 Reserpine results in decreased expression of KCND3 mRNA CTD PMID:12606256 Kcnd3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KCND3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of KCND3 mRNA] CTD PMID:35811015 Kcnd3 Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of KCND3 mRNA CTD PMID:16733813 Kcnd3 Rat sodium arsenate decreases expression ISO Kcnd3 (Mus musculus) 6480464 sodium arsenate results in decreased expression of KCND3 mRNA CTD PMID:21795629 Kcnd3 Rat sodium arsenite decreases expression ISO Kcnd3 (Mus musculus) 6480464 sodium arsenite results in decreased expression of KCND3 mRNA CTD PMID:37682722 Kcnd3 Rat tamoxifen decreases activity EXP 6480464 Tamoxifen results in decreased activity of KCND3 protein CTD PMID:25231973 Kcnd3 Rat testosterone multiple interactions ISO KCND3 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KCND3 mRNA CTD PMID:21592394 Kcnd3 Rat testosterone increases expression ISO KCND3 (Homo sapiens) 6480464 Testosterone results in increased expression of KCND3 mRNA CTD PMID:21592394 Kcnd3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KCND3 mRNA CTD PMID:34492290 Kcnd3 Rat titanium dioxide increases methylation ISO Kcnd3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of KCND3 gene and titanium dioxide results in increased methylation of KCND3 promoter CTD PMID:35295148 Kcnd3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KCND3 mRNA CTD PMID:25729387 Kcnd3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of KCND3 gene CTD PMID:27618143 Kcnd3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of KCND3 mRNA CTD PMID:33387578 Kcnd3 Rat triptonide increases expression ISO Kcnd3 (Mus musculus) 6480464 triptonide results in increased expression of KCND3 mRNA CTD PMID:33045310 Kcnd3 Rat valproic acid increases expression ISO KCND3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KCND3 mRNA CTD PMID:23179753 and PMID:27188386 Kcnd3 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of KCND3 mRNA CTD PMID:29427782 Kcnd3 Rat verapamil decreases activity ISO KCND3 (Homo sapiens) 6480464 Verapamil results in decreased activity of KCND3 protein CTD PMID:11181069 Kcnd3 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of KCND3 gene CTD PMID:31682807 Kcnd3 Rat vorinostat decreases expression ISO KCND3 (Homo sapiens) 6480464 vorinostat results in decreased expression of KCND3 mRNA CTD PMID:27188386
Imported Annotations - SMPDB
1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4-aminopyridine (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chelerythrine (ISO) clothianidin (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) decabromodiphenyl ether (EXP) diallyl trisulfide (ISO) dimethylarsinic acid (EXP) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) fenvalerate (EXP) ferrostatin-1 (ISO) fluoxetine (ISO) fulvestrant (EXP) genistein (ISO) glufosinate (ISO) lipopolysaccharide (ISO) maneb (ISO) methapyrilene (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) nitrofen (EXP) O-methyleugenol (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) PCB138 (ISO) phenylephrine (EXP,ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) progesterone (ISO) raloxifene (EXP,ISO) reserpine (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sarin (EXP) sodium arsenate (ISO) sodium arsenite (ISO) tamoxifen (EXP) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triptonide (ISO) valproic acid (EXP,ISO) verapamil (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
alpha1-adrenoceptors regulate only the caveolae-located subpopulation of cardiac K(V)4 channels.
Alday A, etal., Channels (Austin). 2010 May-Jun;4(3):168-78.
2.
Complex expression and localization of inactivating Kv channels in cultured hippocampal astrocytes.
Bekar LK, etal., J Neurophysiol. 2005 Mar;93(3):1699-709.
3.
Expression and high glucose-mediated regulation of K+ channel interacting protein 3 (KChIP3) and KV4 channels in retinal Muller glial cells.
Chavira-Suarez E, etal., Biochem Biophys Res Commun. 2011 Jan 14;404(2):678-83. doi: 10.1016/j.bbrc.2010.12.041. Epub 2010 Dec 11.
4.
Expression and distribution of Kv4 potassium channel subunits and potassium channel interacting proteins in subpopulations of interneurons in the basolateral amygdala.
Dabrowska J and Rainnie DG, Neuroscience. 2010 Dec 15;171(3):721-33. doi: 10.1016/j.neuroscience.2010.09.011. Epub 2010 Sep 16.
5.
Post-transcriptional gene silencing of KChIP2 and Navbeta1 in neonatal rat cardiac myocytes reveals a functional association between Na and Ito currents.
Deschenes I, etal., J Mol Cell Cardiol. 2008 Sep;45(3):336-46. Epub 2008 May 12.
6.
Role of the Kv4.3 K+ channel in ventricular muscle. A molecular correlate for the transient outward current.
Dixon JE, etal., Circ Res 1996 Oct;79(4):659-68.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Kv4 potassium channel subunits control action potential repolarization and frequency-dependent broadening in rat hippocampal CA1 pyramidal neurones.
Kim J, etal., J Physiol. 2005 Nov 15;569(Pt 1):41-57. Epub 2005 Sep 1.
9.
Contribution of KChIP2 to the developmental increase in transient outward current of rat cardiomyocytes.
Kobayashi T, etal., J Mol Cell Cardiol. 2003 Sep;35(9):1073-82.
10.
KChAP as a chaperone for specific K(+) channels.
Kuryshev YA, etal., Am J Physiol Cell Physiol. 2000 May;278(5):C931-41.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Molecular cloning and tissue distribution of an alternatively spliced variant of an A-type K+ channel alpha-subunit, Kv4.3 in the rat.
Ohya S, etal., FEBS Lett 1997 Dec 22;420(1):47-53.
14.
Regional expression of the splice variants of Kv4.3 in rat brain and effects of C-terminus deletion on expressed K+ currents.
Ohya S, etal., Life Sci 2001 Mar 2;68(15):1703-16.
15.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
16.
Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer.
Pioletti M, etal., Nat Struct Mol Biol. 2006 Nov;13(11):987-95. Epub 2006 Oct 22.
17.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
Scannevin RH, etal., Neuron. 2004 Feb 19;41(4):587-98. doi: 10.1016/s0896-6273(04)00049-2.
22.
Cloning of a novel component of A-type K+ channels operating at subthreshold potentials with unique expression in heart and brain.
Serodio P, etal., J Neurophysiol 1996 May;75(5):2174-9.
23.
Fly DPP10 acts as a channel ancillary subunit and possesses peptidase activity.
Shiina Y, etal., Sci Rep. 2016 May 20;6:26290. doi: 10.1038/srep26290.
24.
Remodeling of Kv4.3 potassium channel gene expression under the control of sex hormones.
Song M, etal., J Biol Chem 2001 Aug 24;276(34):31883-90.
25.
Bone morphogenetic protein-4 contributes to the down-regulation of Kv4.3 K+ channels in pathological cardiac hypertrophy.
Sun B, etal., Biochem Biophys Res Commun. 2013 Jul 12;436(4):591-4. doi: 10.1016/j.bbrc.2013.05.113. Epub 2013 Jun 6.
26.
Decreased expression of Kv4.2 and novel Kv4.3 K+ channel subunit mRNAs in ventricles of renovascular hypertensive rats.
Takimoto K, etal., Circ Res 1997 Oct;81(4):533-9.
27.
Cloning, expression and CNS distribution of Kv4.3, an A-type K+ channel alpha subunit.
Tsaur ML, etal., FEBS Lett. 1997 Jan 3;400(2):215-20. doi: 10.1016/s0014-5793(96)01388-9.
28.
Molecular structure of cardiac Ito channels: Kv4.2, Kv4.3, and other possibilities?
Tseng GN Cardiovasc Res 1999 Jan;41(1):16-8.
29.
Kinetic properties of Kv4.3 and their modulation by KChIP2b.
Wang S, etal., Biochem Biophys Res Commun. 2002 Jul 12;295(2):223-9.
30.
Regional contributions of Kv1.4, Kv4.2, and Kv4.3 to transient outward K+ current in rat ventricle.
Wickenden AD, etal., Am J Physiol 1999 May;276(5 Pt 2):H1599-607.
31.
Two novel Brugada syndrome-associated mutations increase KV4.3 membrane expression and function.
You T, etal., Int J Mol Med. 2015 Jul;36(1):309-15. doi: 10.3892/ijmm.2015.2223. Epub 2015 May 26.
Kcnd3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 195,626,316 - 195,843,690 (+) NCBI GRCr8 mRatBN7.2 2 192,937,950 - 193,155,345 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 192,937,950 - 193,155,345 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 200,532,308 - 200,749,767 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 198,418,563 - 198,635,769 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 193,235,506 - 193,452,721 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 207,923,775 - 208,140,727 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 207,923,775 - 208,140,727 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 227,345,052 - 227,561,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 200,709,778 - 200,924,575 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 128,828,320 - 128,840,436 (+) NCBI Celera 2 185,602,165 - 185,617,489 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
KCND3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 111,770,662 - 111,989,668 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 111,770,662 - 111,989,668 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 112,313,284 - 112,532,290 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 112,119,977 - 112,333,300 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 112,030,495 - 112,243,819 NCBI Celera 1 110,565,074 - 110,778,378 (-) NCBI Celera Cytogenetic Map 1 p13.2 NCBI HuRef 1 110,189,856 - 110,403,378 (-) NCBI HuRef CHM1_1 1 112,433,439 - 112,646,758 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 111,785,561 - 112,004,582 (-) NCBI T2T-CHM13v2.0
Kcnd3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 105,359,206 - 105,581,318 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 105,359,646 - 105,581,318 (+) Ensembl GRCm39 Ensembl GRCm38 3 105,451,890 - 105,674,002 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 105,452,330 - 105,674,002 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 105,255,248 - 105,476,920 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 105,580,386 - 105,802,058 (+) NCBI MGSCv36 mm8 Celera 3 107,640,899 - 107,862,899 (+) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 46.32 NCBI
Kcnd3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 15,227,615 - 15,431,190 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 15,227,386 - 15,431,136 (-) NCBI ChiLan1.0 ChiLan1.0
KCND3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 115,037,963 - 115,255,901 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 114,185,438 - 114,404,074 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 114,433,203 - 114,651,894 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 125,702,654 - 125,910,075 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 125,696,907 - 125,909,814 (+) Ensembl panpan1.1 panPan2
KCND3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 63,470,829 - 63,668,354 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 63,470,415 - 63,668,035 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 62,986,103 - 63,182,211 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 64,647,680 - 64,841,597 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 64,637,936 - 64,841,028 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 63,378,372 - 63,574,346 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 63,437,366 - 63,633,850 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 64,235,078 - 64,431,380 (+) NCBI UU_Cfam_GSD_1.0
Kcnd3
KCND3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 108,246,237 - 108,621,510 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 108,394,687 - 108,621,514 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 118,542,614 - 118,763,673 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCND3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 21,618,365 - 21,833,443 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 21,625,147 - 21,833,186 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 36,641,070 - 36,861,725 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcnd3
.
Predicted Target Of
Count of predictions: 293 Count of miRNA genes: 139 Interacting mature miRNAs: 153 Transcripts: ENSRNOT00000019997, ENSRNOT00000047827, ENSRNOT00000051835 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat52
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 195,783,205 - 195,783,351 (+) Marker Load Pipeline mRatBN7.2 2 193,094,852 - 193,094,998 (+) MAPPER mRatBN7.2 Rnor_6.0 2 208,081,050 - 208,081,195 NCBI Rnor6.0 Rnor_5.0 2 227,502,003 - 227,502,148 UniSTS Rnor5.0 RGSC_v3.4 2 200,866,667 - 200,866,813 RGD RGSC3.4 RGSC_v3.4 2 200,866,668 - 200,866,813 UniSTS RGSC3.4 RGSC_v3.1 2 200,829,422 - 200,829,567 RGD Celera 2 185,557,445 - 185,557,622 UniSTS RH 3.4 Map 2 1366.3 UniSTS RH 3.4 Map 2 1366.3 RGD RH 2.0 Map 2 1028.7 RGD SHRSP x BN Map 2 73.4398 RGD Cytogenetic Map 2 q34 UniSTS
D2Got136
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 193,054,714 - 193,054,910 (+) MAPPER mRatBN7.2 Rnor_6.0 2 208,040,915 - 208,041,110 NCBI Rnor6.0 Rnor_5.0 2 227,461,868 - 227,462,063 UniSTS Rnor5.0 RGSC_v3.4 2 200,826,441 - 200,826,748 RGD RGSC3.4 RGSC_v3.4 2 200,826,530 - 200,826,725 UniSTS RGSC3.4 RGSC_v3.1 2 200,789,284 - 200,789,479 RGD Celera 2 185,517,570 - 185,517,765 UniSTS RH 3.4 Map 2 1358.4 RGD RH 3.4 Map 2 1358.4 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Cebr1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 195,759,422 - 195,759,644 (+) Marker Load Pipeline mRatBN7.2 2 193,071,067 - 193,071,289 (+) MAPPER mRatBN7.2 Rnor_6.0 2 208,057,268 - 208,057,488 NCBI Rnor6.0 Rnor_5.0 2 227,478,221 - 227,478,441 UniSTS Rnor5.0 RGSC_v3.4 2 200,842,883 - 200,843,104 UniSTS RGSC3.4 Celera 2 185,533,858 - 185,534,077 UniSTS Cytogenetic Map 2 q34 UniSTS
RH140120
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 193,153,088 - 193,153,303 (+) MAPPER mRatBN7.2 Rnor_6.0 2 208,138,471 - 208,138,685 NCBI Rnor6.0 Rnor_5.0 2 227,559,424 - 227,559,638 UniSTS Rnor5.0 RGSC_v3.4 2 200,924,314 - 200,924,528 UniSTS RGSC3.4 Celera 2 185,615,233 - 185,615,447 UniSTS RH 3.4 Map 2 1366.3 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019997 ⟹ ENSRNOP00000019997
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 192,937,950 - 193,155,345 (+) Ensembl Rnor_6.0 Ensembl 2 207,923,775 - 208,140,727 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000047827 ⟹ ENSRNOP00000041746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 207,930,796 - 208,136,385 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000051835 ⟹ ENSRNOP00000049111
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 192,937,950 - 193,155,345 (+) Ensembl Rnor_6.0 Ensembl 2 207,923,775 - 208,140,727 (+) Ensembl
RefSeq Acc Id:
NM_001270962 ⟹ NP_001257891
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 195,626,316 - 195,843,690 (+) NCBI mRatBN7.2 2 192,937,950 - 193,155,345 (+) NCBI Rnor_6.0 2 207,923,775 - 208,140,727 (+) NCBI Rnor_5.0 2 227,345,052 - 227,561,680 (+) NCBI Celera 2 185,602,165 - 185,617,489 (+) NCBI
Sequence:
GGGCTGGCTTCGGCGAAGGGGTCACTGAACTAACTAACTCCAAGCTGGTGCGTAGTGTCTGAGCAGCTACCAGCCCAAAAGCTGGAGTCACCATGGCGGCAGGAGTTGCAGCCTGGCTGCCTTTTGCC
hide sequence
RefSeq Acc Id:
NM_001270963 ⟹ NP_001257892
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 195,626,316 - 195,843,690 (+) NCBI mRatBN7.2 2 192,937,950 - 193,155,345 (+) NCBI Rnor_6.0 2 207,923,775 - 208,140,727 (+) NCBI Rnor_5.0 2 227,345,052 - 227,561,680 (+) NCBI Celera 2 185,602,165 - 185,617,489 (+) NCBI
Sequence:
GGGCTGGCTTCGGCGAAGGGGTCACTGAACTAACTAACTCCAAGCTGGTGCGTAGTGTCTGAGC
hide sequence
RefSeq Acc Id:
NM_031739 ⟹ NP_113927
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 195,626,316 - 195,843,690 (+) NCBI mRatBN7.2 2 192,937,950 - 193,155,345 (+) NCBI Rnor_6.0 2 207,923,775 - 208,140,727 (+) NCBI Rnor_5.0 2 227,345,052 - 227,561,680 (+) NCBI RGSC_v3.4 2 200,709,778 - 200,924,575 (+) RGD Celera 2 185,602,165 - 185,617,489 (+) NCBI
Sequence:
GGGCTGGCTTCGGCGAAGGGGTCACTGAACTAACTAACTCCAAGCTGGTGCGTAGTGTCTGAGC
hide sequence
RefSeq Acc Id:
NP_113927 ⟸ NM_031739
- Peptide Label:
isoform 3
- UniProtKB:
Q99P42 (UniProtKB/Swiss-Prot), Q63286 (UniProtKB/Swiss-Prot), P70622 (UniProtKB/Swiss-Prot), O08723 (UniProtKB/Swiss-Prot), Q62897 (UniProtKB/Swiss-Prot)
- Sequence:
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEII
hide sequence
RefSeq Acc Id:
NP_001257891 ⟸ NM_001270962
- Peptide Label:
isoform 1
- UniProtKB:
Q99P42 (UniProtKB/Swiss-Prot), Q63286 (UniProtKB/Swiss-Prot), P70622 (UniProtKB/Swiss-Prot), O08723 (UniProtKB/Swiss-Prot), Q62897 (UniProtKB/Swiss-Prot), A0A0G2JSN5 (UniProtKB/TrEMBL)
- Sequence:
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEII
hide sequence
RefSeq Acc Id:
NP_001257892 ⟸ NM_001270963
- Peptide Label:
isoform 2
- UniProtKB:
Q99P42 (UniProtKB/Swiss-Prot), Q63286 (UniProtKB/Swiss-Prot), P70622 (UniProtKB/Swiss-Prot), O08723 (UniProtKB/Swiss-Prot), Q62897 (UniProtKB/Swiss-Prot), A0A0G2JSW5 (UniProtKB/TrEMBL)
- Sequence:
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDT
hide sequence
Ensembl Acc Id:
ENSRNOP00000041746 ⟸ ENSRNOT00000047827
Ensembl Acc Id:
ENSRNOP00000049111 ⟸ ENSRNOT00000051835
Ensembl Acc Id:
ENSRNOP00000019997 ⟸ ENSRNOT00000019997
RGD ID: 13691642 Promoter ID: EPDNEW_R2167 Type: single initiation site Name: Kcnd3_1 Description: potassium voltage-gated channel subfamily D member 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 207,923,696 - 207,923,756 EPDNEW
BioCyc Gene G2FUF-51729 BioCyc
Ensembl Genes ENSRNOG00000014686 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000019997.7 UniProtKB/TrEMBL
ENSRNOT00000051835.5 UniProtKB/TrEMBL
Gene3D-CATH 1.10.287.70 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
1.20.120.350 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Potassium Channel Kv1.1, Chain A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro BTB/POZ_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ion_trans_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
K_chnl_volt-dep_Kv UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
K_chnl_volt-dep_Kv4 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
K_chnl_volt-dep_Kv4.3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
K_chnl_volt-dep_Kv4_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Shal-type_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SKP1/BTB/POZ_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
T1-type_BTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
VG_K_chnl UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Volt_channel_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:65195 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 65195 ENTREZGENE
PANTHER POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY D MEMBER 3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR11537 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam BTB_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
DUF3399 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ion_trans UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Shal-type UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB KCND3 RGD
PhenoGen Kcnd3 PhenoGen
PRINTS KCHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KV43CHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KVCHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SHALCHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000014686 RatGTEx
SMART BTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF54695 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Voltage-gated potassium channels UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A0G2JSN5 ENTREZGENE, UniProtKB/TrEMBL
A0A0G2JSW5 ENTREZGENE, UniProtKB/TrEMBL
A6K3Q9_RAT UniProtKB/TrEMBL
A6K3R0_RAT UniProtKB/TrEMBL
A6K3R1_RAT UniProtKB/TrEMBL
KCND3_RAT UniProtKB/Swiss-Prot
O08723 ENTREZGENE
P70622 ENTREZGENE
Q62897 ENTREZGENE
Q63286 ENTREZGENE
Q99P42 ENTREZGENE
UniProt Secondary O08723 UniProtKB/Swiss-Prot
P70622 UniProtKB/Swiss-Prot
Q63286 UniProtKB/Swiss-Prot
Q99P42 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcnd3
potassium voltage-gated channel subfamily D member 3
Kcnd3
potassium channel, voltage-gated Shal-related subfamily D, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcnd3
potassium channel, voltage-gated Shal-related subfamily D, member 3
Kcnd3
potassium voltage-gated channel, Shal-related subfamily, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-04-17
Kcnd3
potassium voltage-gated channel, Shal-related subfamily, member 3
LOC684161
similar to Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3)
Data merged from RGD:1593894
737654 PROVISIONAL
2010-04-20
Kcnd3
potassium voltage-gated channel, Shal-related subfamily, member 3
Kcnd3
potassium voltage gated channel, Shal-related family, member 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC684161
similar to Potassium voltage-gated channel subfamily D member 3 (Voltage-gated potassium channel subunit Kv4.3)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Kcnd3
potassium voltage gated channel, Shal-related family, member 3
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in pyramidal cell layers of the hippocampus and the granule cell layer of the cerebellum
633155
gene_expression
mRNA expressed in the rat cardiac myocytes
628469
gene_expression
mRNA expressed in the rat cardiac myocytes
628470
gene_function
forms voltage-gated outward current during repolarization in cardiac myocytes
628469
gene_function
forms voltage-gated outward current during repolarization in cardiac myocytes
628470
gene_physical_interaction
forms heteromultimer channels with Kcnd2 which helps in increasing the rate of recovery from inactivation
628469
gene_physical_interaction
forms heteromultimer channels with Kcnd2 which helps in increasing the rate of recovery from inactivation
628470
gene_process
in the left ventricle the mRNA level displays transmural gradient of the voltage-gated transient outward current density which impacts on cardiac functions such as contractility and impulse conduction
628469
gene_process
in the left ventricle the mRNA level displays transmural gradient of the voltage-gated transient outward current density which impacts on cardiac functions such as contractility and impulse conduction
628470
gene_process
contributes to the calcium independent voltage-gated transient outward current density in the right wall and septum of the ventricle
628469
gene_process
contributes to the calcium independent voltage-gated transient outward current density in the right wall and septum of the ventricle
628470
