Symbol:
Disc1
Name:
DISC1 scaffold protein
RGD ID:
631359
Description:
Enables kinesin binding activity. Involved in several processes, including positive regulation of cell projection organization; protein localization to centrosome; and pyramidal neuron migration to cerebral cortex. Acts upstream of or within regulation of glutamatergic synaptic transmission. Located in several cellular components, including central region of growth cone; microtubule cytoskeleton; and perinuclear region of cytoplasm. Part of dynein complex and kinesin complex. Human ortholog(s) of this gene implicated in autism spectrum disorder (multiple); bipolar disorder; chronic fatigue syndrome; major depressive disorder; and psychotic disorder (multiple). Orthologous to human DISC1 (DISC1 scaffold protein); INTERACTS WITH 17alpha-ethynylestradiol; acetamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
disrupted in schizophrenia 1; disrupted in schizophrenia 1 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DISC1 (DISC1 scaffold protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Disc1 (disrupted in schizophrenia 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Disc1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DISC1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DISC1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Disc1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DISC1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DISC1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Disc1 (DISC1 scaffold protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DISC1 (DISC1 scaffold protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Disc1 (disrupted in schizophrenia 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
disc1 (DISC1 scaffold protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
Disc1em1Rst
Genetic Models:
SD-Disc1em1Rst
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 69,911,548 - 70,120,970 (+) NCBI GRCr8 mRatBN7.2 19 53,014,201 - 53,223,617 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 53,014,616 - 53,219,778 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 59,798,589 - 60,006,037 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 60,649,615 - 60,856,157 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 62,725,049 - 62,932,128 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 57,818,838 - 58,069,992 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 57,820,260 - 58,066,152 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 68,529,791 - 68,641,620 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 19 68,711,386 - 68,769,050 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 55,265,116 - 55,449,375 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 55,270,004 - 55,427,798 (+) NCBI Celera 19 52,376,528 - 52,580,211 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Disc1 Rat (S)-amphetamine increases response to substance ISO DISC1 (Homo sapiens) 6480464 DISC1 protein modified form results in increased susceptibility to Dextroamphetamine CTD PMID:26754951 Disc1 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Disc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Disc1 Rat 1,2-dichloroethane increases expression ISO Disc1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of DISC1 mRNA CTD PMID:28960355 Disc1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DISC1 mRNA CTD PMID:29097150 Disc1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Disc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Disc1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Disc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Disc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DISC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DISC1 mRNA CTD PMID:22903824 Disc1 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Disc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Disc1 Rat 2-hydroxypropanoic acid multiple interactions ISO Disc1 (Mus musculus) 6480464 DISC1 gene mutant form results in decreased chemical synthesis of and results in decreased secretion of Lactic Acid CTD PMID:29643356 Disc1 Rat 3',5'-cyclic AMP multiple interactions ISO DISC1 (Homo sapiens) 6480464 Cyclic AMP inhibits the reaction [DISC1 protein binds to PDE4B protein] CTD PMID:16293762 Disc1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO DISC1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of DISC1 gene CTD PMID:31601247 Disc1 Rat 4,4'-sulfonyldiphenol decreases expression ISO DISC1 (Homo sapiens) 6480464 bisphenol S results in decreased expression of DISC1 mRNA CTD PMID:34979203 Disc1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO DISC1 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of DISC1 mRNA] CTD PMID:21095227 Disc1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DISC1 mRNA CTD PMID:31881176 Disc1 Rat aflatoxin B1 increases methylation ISO DISC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DISC1 intron CTD PMID:30157460 Disc1 Rat aflatoxin B1 decreases expression ISO DISC1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of DISC1 mRNA CTD PMID:32234424 Disc1 Rat Aflatoxin B2 alpha increases methylation ISO DISC1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of DISC1 intron CTD PMID:30157460 Disc1 Rat aldehydo-D-glucose multiple interactions ISO Disc1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Disc1 Rat all-trans-retinoic acid increases expression ISO DISC1 (Homo sapiens) 6480464 Tretinoin results in increased expression of DISC1 mRNA CTD PMID:23724009 Disc1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DISC1 mRNA CTD PMID:16483693 Disc1 Rat aristolochic acid A decreases expression ISO DISC1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DISC1 mRNA CTD PMID:33212167 Disc1 Rat benzo[a]pyrene decreases expression ISO DISC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DISC1 mRNA CTD PMID:20064835 more ... Disc1 Rat benzo[a]pyrene affects methylation ISO DISC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DISC1 intron CTD PMID:30157460 Disc1 Rat benzo[a]pyrene decreases methylation ISO Disc1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of DISC1 intron CTD PMID:27901495 Disc1 Rat benzo[a]pyrene increases methylation ISO DISC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DISC1 3' UTR CTD PMID:27901495 Disc1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DISC1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Disc1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DISC1 gene CTD PMID:28505145 Disc1 Rat bisphenol A multiple interactions ISO DISC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DISC1 gene CTD PMID:31601247 Disc1 Rat bisphenol A affects methylation ISO DISC1 (Homo sapiens) 6480464 bisphenol A affects the methylation of DISC1 gene CTD PMID:31601247 Disc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DISC1 mRNA CTD PMID:30816183 more ... Disc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DISC1 mRNA CTD PMID:29097150 Disc1 Rat cadmium dichloride affects expression ISO Disc1 (Mus musculus) 6480464 Cadmium Chloride affects the expression of DISC1 mRNA CTD PMID:29408670 Disc1 Rat cadmium dichloride decreases expression ISO DISC1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DISC1 mRNA CTD PMID:38382870 Disc1 Rat chlorpyrifos decreases expression ISO Disc1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DISC1 mRNA CTD PMID:37019170 Disc1 Rat clozapine decreases response to substance ISO DISC1 (Homo sapiens) 6480464 DISC1 gene mutant form results in decreased susceptibility to Clozapine CTD PMID:20531374 Disc1 Rat clozapine affects response to substance ISO DISC1 (Homo sapiens) 6480464 DISC1 protein affects the susceptibility to Clozapine CTD PMID:20531374 Disc1 Rat copper(II) sulfate affects expression ISO DISC1 (Homo sapiens) 6480464 Copper Sulfate affects the expression of DISC1 mRNA CTD PMID:19549813 Disc1 Rat D-glucose multiple interactions ISO Disc1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Disc1 Rat dopamine multiple interactions ISO DISC1 (Homo sapiens) 6480464 DISC1 protein modified form results in increased uptake of and affects the metabolism of Dopamine CTD PMID:26754951 Disc1 Rat doxorubicin decreases expression ISO DISC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DISC1 mRNA CTD PMID:29803840 Disc1 Rat ethylbenzene multiple interactions ISO DISC1 (Homo sapiens) 6480464 [Toluene co-treated with Xylenes co-treated with ethylbenzene] results in decreased expression of DISC1 mRNA CTD PMID:33438815 Disc1 Rat FR900359 decreases phosphorylation ISO DISC1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of DISC1 protein CTD PMID:37730182 Disc1 Rat fructose multiple interactions ISO Disc1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Disc1 Rat fulvestrant multiple interactions ISO DISC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of DISC1 gene and [bisphenol S co-treated with Fulvestrant] results in increased methylation of DISC1 gene CTD PMID:31601247 Disc1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of DISC1 gene CTD PMID:22079235 Disc1 Rat genistein decreases expression ISO Disc1 (Mus musculus) 6480464 Genistein results in decreased expression of DISC1 mRNA CTD PMID:32186404 Disc1 Rat glucose multiple interactions ISO Disc1 (Mus musculus) 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Disc1 Rat herbicide multiple interactions ISO Disc1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DISC1 mRNA CTD PMID:37567420 Disc1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of DISC1 mRNA CTD PMID:11578147 Disc1 Rat leflunomide increases expression ISO DISC1 (Homo sapiens) 6480464 leflunomide results in increased expression of DISC1 mRNA CTD PMID:28988120 Disc1 Rat lipopolysaccharide multiple interactions ISO DISC1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Disc1 Rat lipopolysaccharide decreases expression ISO DISC1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of DISC1 mRNA CTD PMID:35811015 Disc1 Rat malathion increases expression ISO DISC1 (Homo sapiens) 6480464 Malathion results in increased expression of DISC1 mRNA CTD PMID:37047231 Disc1 Rat maneb multiple interactions ISO Disc1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of DISC1 mRNA CTD PMID:36117858 Disc1 Rat melatonin multiple interactions ISO DISC1 (Homo sapiens) 6480464 [Melatonin co-treated with ortho-topolin riboside] results in decreased expression of DISC1 mRNA CTD PMID:38325522 Disc1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DISC1 gene CTD PMID:33148267 Disc1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of DISC1 mRNA CTD PMID:20360939 Disc1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of DISC1 mRNA] CTD PMID:20360939 Disc1 Rat O-methyleugenol decreases expression ISO DISC1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of DISC1 mRNA CTD PMID:32234424 Disc1 Rat okadaic acid decreases expression ISO DISC1 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of DISC1 mRNA CTD PMID:38832940 Disc1 Rat Ortho-topolin riboside multiple interactions ISO DISC1 (Homo sapiens) 6480464 [Melatonin co-treated with ortho-topolin riboside] results in decreased expression of DISC1 mRNA CTD PMID:38325522 Disc1 Rat paraquat multiple interactions ISO Disc1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of DISC1 mRNA CTD PMID:36117858 Disc1 Rat PCB138 multiple interactions ISO Disc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Disc1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DISC1 gene CTD PMID:33148267 Disc1 Rat permethrin increases expression ISO DISC1 (Homo sapiens) 6480464 Permethrin results in increased expression of DISC1 mRNA CTD PMID:37047231 Disc1 Rat phenethyl caffeate multiple interactions EXP 6480464 caffeic acid phenethyl ester inhibits the reaction [Diethylnitrosamine results in increased expression of DISC1 mRNA] CTD PMID:20360939 Disc1 Rat phenylmercury acetate increases expression ISO DISC1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DISC1 mRNA CTD PMID:26272509 Disc1 Rat potassium dichromate decreases expression ISO Disc1 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of DISC1 mRNA CTD PMID:23608068 Disc1 Rat propanal increases expression ISO DISC1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of DISC1 mRNA CTD PMID:26079696 Disc1 Rat rac-lactic acid multiple interactions ISO Disc1 (Mus musculus) 6480464 DISC1 gene mutant form results in decreased chemical synthesis of and results in decreased secretion of Lactic Acid CTD PMID:29643356 Disc1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO DISC1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Disc1 Rat sodium arsenite decreases expression ISO Disc1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of DISC1 mRNA CTD PMID:37682722 Disc1 Rat T-2 toxin multiple interactions EXP 6480464 T-2 Toxin promotes the reaction [GABPA protein binds to DISC1] CTD PMID:36863559 Disc1 Rat titanium dioxide increases methylation ISO Disc1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of DISC1 gene CTD PMID:35295148 Disc1 Rat titanium dioxide decreases methylation ISO Disc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DISC1 gene CTD PMID:35295148 Disc1 Rat toluene multiple interactions ISO DISC1 (Homo sapiens) 6480464 [Toluene co-treated with Xylenes co-treated with ethylbenzene] results in decreased expression of DISC1 mRNA and [Toluene co-treated with Xylenes] results in decreased expression of DISC1 mRNA CTD PMID:33438815 Disc1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DISC1 mRNA CTD PMID:33387578 Disc1 Rat trichostatin A increases expression ISO DISC1 (Homo sapiens) 6480464 trichostatin A results in increased expression of DISC1 mRNA CTD PMID:24935251 Disc1 Rat valproic acid increases expression ISO DISC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DISC1 mRNA CTD PMID:24935251 and PMID:26272509 Disc1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of DISC1 gene CTD PMID:31079544 Disc1 Rat vorinostat increases expression ISO DISC1 (Homo sapiens) 6480464 vorinostat results in increased expression of DISC1 mRNA CTD PMID:26272509
(S)-amphetamine (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic AMP (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) clozapine (ISO) copper(II) sulfate (ISO) D-glucose (ISO) dopamine (ISO) doxorubicin (ISO) ethylbenzene (ISO) FR900359 (ISO) fructose (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) glucose (ISO) herbicide (ISO) lead diacetate (EXP) leflunomide (ISO) lipopolysaccharide (ISO) malathion (ISO) maneb (ISO) melatonin (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodiethylamine (EXP) O-methyleugenol (ISO) okadaic acid (ISO) Ortho-topolin riboside (ISO) paraquat (ISO) PCB138 (ISO) permethrin (EXP,ISO) phenethyl caffeate (EXP) phenylmercury acetate (ISO) potassium dichromate (ISO) propanal (ISO) rac-lactic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) T-2 toxin (EXP) titanium dioxide (ISO) toluene (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
canonical Wnt signaling pathway (IEA,ISO) cell proliferation in forebrain (IEA,ISO) cerebral cortex radially oriented cell migration (IEA,ISO) cilium assembly (IBA,IMP) detection of temperature stimulus involved in sensory perception of pain (IEA,ISO) microtubule cytoskeleton organization (IEA,ISO) mitochondrial calcium ion homeostasis (IEA,ISO) nervous system development (IEA,IMP) neuron cellular homeostasis (IEA,ISO) neuron migration (IBA,IEA,ISO) non-motile cilium assembly (IEA,ISO) positive regulation of axon extension (IMP) positive regulation of cell-matrix adhesion (IMP) positive regulation of neuroblast proliferation (IEA,ISO) positive regulation of neuron projection development (IMP) positive regulation of ubiquitin-dependent protein catabolic process (IEA,ISO) positive regulation of Wnt signaling pathway (IEA,ISO) protein localization (IEA,ISO) protein localization to centrosome (IGI,IMP) pyramidal neuron migration to cerebral cortex (IMP) regulation of dendritic spine development (IMP) regulation of neuron projection development (IEA,IMP,ISO) regulation of postsynapse organization (IEA,ISO) regulation of synapse maturation (IEA,ISO) regulation of synaptic transmission, glutamatergic (IMP) response to electrical stimulus (IEP) TOR signaling (IEA,ISO) ubiquitin-dependent protein catabolic process (IEA,ISO) Wnt signaling pathway (IEA)
Cellular Component
axon (IDA) cell body (IDA) central region of growth cone (IDA) centrosome (IDA,IEA,ISO) ciliary basal body (IEA,ISO) ciliary base (IEA,ISO) cytoplasm (IEA) cytoskeleton (IEA) cytosol (IEA,ISO) dynein complex (IDA) GABA-ergic synapse (IEA,ISO) glutamatergic synapse (IEA,ISO) intermediate filament cytoskeleton (IBA,IEA,ISO) kinesin complex (IDA) microtubule (IBA,IDA,IEA) microtubule organizing center (IBA) mitochondrion (IEA,ISO) perinuclear region of cytoplasm (IDA) postsynaptic density (IEA,ISO) presynapse (IEA,ISO) synapse (IEA) synaptic vesicle (IEA,ISO)
1.
The effect of amygdala kindling on hippocampal neurogenesis coincides with decreased reelin and DISC1 expression in the adult dentate gyrus.
Fournier NM, etal., Hippocampus. 2009 Jun 4.
2.
A functional polymorphism in the disrupted-in schizophrenia 1 gene is associated with chronic fatigue syndrome.
Fukuda S, etal., Life Sci. 2010 May 8;86(19-20):722-5. Epub 2010 Mar 20.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Impact of the DISC1 Ser704Cys polymorphism on risk for major depression, brain morphology and ERK signaling.
Hashimoto R, etal., Hum Mol Genet. 2006 Oct 15;15(20):3024-33. Epub 2006 Sep 7.
6.
A novel DISC1-interacting partner DISC1-Binding Zinc-finger protein: implication in the modulation of DISC1-dependent neurite outgrowth.
Hattori T, etal., Mol Psychiatry. 2007 Apr;12(4):398-407. Epub 2007 Jan 23.
7.
DISC1 regulates cell-cell adhesion, cell-matrix adhesion and neurite outgrowth.
Hattori T, etal., Mol Psychiatry. 2010 Aug;15(8):778, 798-809. Epub 2010 May 18.
8.
Disrupted-in-Schizophrenia 1 (DISC1) regulates spines of the glutamate synapse via Rac1.
Hayashi-Takagi A, etal., Nat Neurosci. 2010 Mar;13(3):327-32. Epub 2010 Feb 7.
9.
PAKs inhibitors ameliorate schizophrenia-associated dendritic spine deterioration in vitro and in vivo during late adolescence.
Hayashi-Takagi A, etal., Proc Natl Acad Sci U S A. 2014 Apr 29;111(17):6461-6. doi: 10.1073/pnas.1321109111. Epub 2014 Apr 3.
10.
DISC1 association, heterogeneity and interplay in schizophrenia and bipolar disorder.
Hennah W, etal., Mol Psychiatry. 2009 Sep;14(9):865-73. Epub 2008 Mar 4.
11.
Disrupted in schizophrenia 1 (DISC1): association with schizophrenia, schizoaffective disorder, and bipolar disorder.
Hodgkinson CA, etal., Am J Hum Genet. 2004 Nov;75(5):862-72. Epub 2004 Sep 22.
12.
Recruitment of PCM1 to the centrosome by the cooperative action of DISC1 and BBS4: a candidate for psychiatric illnesses.
Kamiya A, etal., Arch Gen Psychiatry. 2008 Sep;65(9):996-1006. doi: 10.1001/archpsyc.65.9.996.
13.
DISC1-NDEL1/NUDEL protein interaction, an essential component for neurite outgrowth, is modulated by genetic variations of DISC1.
Kamiya A, etal., Hum Mol Genet. 2006 Nov 15;15(22):3313-23. Epub 2006 Oct 11.
14.
A schizophrenia-associated mutation of DISC1 perturbs cerebral cortex development.
Kamiya A, etal., Nat Cell Biol. 2005 Dec;7(12):1167-78. Epub 2005 Nov 20.
15.
Association of DISC1 gene with schizophrenia in families from two distinct French and Algerian populations.
Lepagnol-Bestel AM, etal., Psychiatr Genet. 2010 Dec;20(6):298-303.
16.
DISC1 regulates primary cilia that display specific dopamine receptors.
Marley A and von Zastrow M, PLoS One. 2010 May 28;5(5):e10902.
17.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
18.
Disruption of two novel genes by a translocation co-segregating with schizophrenia.
Millar JK, etal., Hum Mol Genet. 2000 May 22;9(9):1415-23.
19.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
20.
Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth.
Ozeki Y, etal., Proc Natl Acad Sci U S A 2003 Jan 7;100(1):289-94.
21.
PC12 cell model of inducible expression of mutant DISC1: new evidence for a dominant-negative mechanism of abnormal neuronal differentiation.
Pletnikov MV, etal., Neurosci Res. 2007 Jul;58(3):234-44. Epub 2007 Mar 16.
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
A form of DISC1 enriched in nucleus: altered subcellular distribution in orbitofrontal cortex in psychosis and substance/alcohol abuse.
Sawamura N, etal., Proc Natl Acad Sci U S A. 2005 Jan 25;102(4):1187-92. Epub 2005 Jan 18.
25.
DISC1 regulates neurotrophin-induced axon elongation via interaction with Grb2.
Shinoda T, etal., J Neurosci. 2007 Jan 3;27(1):4-14.
26.
DISC1 regulates the transport of the NUDEL/LIS1/14-3-3epsilon complex through kinesin-1.
Taya S, etal., J Neurosci. 2007 Jan 3;27(1):15-26.
27.
Limited association between Disrupted in Schizophrenia 1 (DISC1) gene and bipolar disorder in the Chinese population.
Xiao Y, etal., Psychiatr Genet. 2011 Feb;21(1):42-6.
28.
Evidence for association between Disrupted-in-Schizophrenia 1 (DISC1) gene polymorphisms and autism in Chinese Han population: a family-based association study.
Zheng F, etal., Behav Brain Funct. 2011 May 15;7:14.
Disc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 69,911,548 - 70,120,970 (+) NCBI GRCr8 mRatBN7.2 19 53,014,201 - 53,223,617 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 53,014,616 - 53,219,778 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 59,798,589 - 60,006,037 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 60,649,615 - 60,856,157 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 62,725,049 - 62,932,128 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 57,818,838 - 58,069,992 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 57,820,260 - 58,066,152 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 68,529,791 - 68,641,620 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 19 68,711,386 - 68,769,050 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 55,265,116 - 55,449,375 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 55,270,004 - 55,427,798 (+) NCBI Celera 19 52,376,528 - 52,580,211 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
DISC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 231,626,790 - 232,041,272 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 231,626,790 - 232,041,272 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 231,762,536 - 232,177,018 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 229,829,184 - 230,243,641 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 228,069,295 - 228,483,607 NCBI Celera 1 205,027,310 - 205,445,842 (+) NCBI Celera Cytogenetic Map 1 q42.2 NCBI HuRef 1 202,246,109 - 202,664,353 (+) NCBI HuRef CHM1_1 1 233,036,406 - 233,450,761 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 231,009,996 - 231,426,811 (+) NCBI T2T-CHM13v2.0
Disc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 125,773,928 - 125,991,882 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 125,780,934 - 125,988,597 (+) Ensembl GRCm39 Ensembl GRCm38 8 125,048,767 - 125,265,143 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 125,054,195 - 125,261,858 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 127,578,095 - 127,785,051 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 127,940,285 - 128,148,274 (+) NCBI MGSCv36 mm8 Celera 8 129,364,004 - 129,569,546 (+) NCBI Celera Cytogenetic Map 8 E2 NCBI cM Map 8 73.26 NCBI
Disc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955492 6,953,389 - 7,239,328 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955492 6,946,528 - 7,239,328 (-) NCBI ChiLan1.0 ChiLan1.0
DISC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 17,161,052 - 17,575,242 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 17,356,795 - 17,771,144 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 207,180,513 - 207,594,684 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 212,320,582 - 212,616,406 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 212,265,520 - 212,612,079 (+) Ensembl panpan1.1 panPan2
DISC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 7,524,336 - 7,825,143 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 7,524,397 - 7,822,558 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 7,518,316 - 7,865,131 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 7,547,601 - 7,896,939 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 7,547,642 - 7,897,205 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 7,555,426 - 7,902,062 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 7,676,276 - 8,023,319 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 7,902,898 - 8,249,898 (-) NCBI UU_Cfam_GSD_1.0
Disc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 42,878,559 - 43,045,852 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 19,047,215 - 19,237,306 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 19,151,752 - 19,237,435 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DISC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 58,606,464 - 58,963,563 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 58,606,441 - 58,963,954 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 63,056,095 - 63,124,157 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DISC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 68,886,451 - 69,274,774 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 68,946,430 - 69,263,198 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 70,799,188 - 71,196,506 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Disc1
.
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
19
57901298
57901299
C
A
snv
WKY/N (2020) , WKY/NCrl (2019), WKY/NHsd (RGD), WKY/Gcrc (RGD), WKY/N (MCW) View more Information
19
57993563
57993564
G
C
snv
SBH/Ygl (MCW) , CDS, CDR View more Information
19
57993804
57993805
T
G
snv
SBN/Ygl (MCW) , COP/CrCrl (MCW & UW), European Variation Archive Release 6, European Variation Archive Release 4, European Variation Archive Release 3, SS/JrHsdMcwi (MCW) View more Information
19
57993825
57993826
T
G
snv
FHH/EurMcwi (MCW) , SBH/Ygl (MCW), GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW), European Variation Archive Release 6, SBN/Ygl (MCW), European Variation Archive Release 4, FHL/EurMcwi (MCW), SS/JrHsdMcwi (MCW), European Variation Archive Release 3, SR/JrHsd (MCW), ACI/EurMcwi (MCW) View more Information
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 54 Interacting mature miRNAs: 59 Transcripts: ENSRNOT00000057945 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313395 Anxrr26 Anxiety related response QTL 26 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 19 49976481 53225766 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 5135224 Leukc1 Leukocyte quantity QTL 1 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 19 44340214 55283277 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 1358200 Insglur2 Insulin/glucose ratio QTL 2 4.1 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 19 33838214 55283146 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat
D19Rat60
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 70,114,813 - 70,115,007 (+) Marker Load Pipeline mRatBN7.2 19 53,217,458 - 53,217,652 (+) MAPPER mRatBN7.2 Rnor_6.0 19 58,063,836 - 58,064,029 NCBI Rnor6.0 Rnor_5.0 19 68,766,731 - 68,766,924 UniSTS Rnor5.0 RGSC_v3.4 19 55,447,056 - 55,447,249 UniSTS RGSC3.4 RGSC_v3.4 19 55,447,055 - 55,447,249 RGD RGSC3.4 RGSC_v3.1 19 55,451,937 - 55,452,130 RGD Celera 19 52,577,892 - 52,578,085 UniSTS RH 3.4 Map 19 719.2 RGD RH 3.4 Map 19 719.2 UniSTS SHRSP x BN Map 19 43.6299 UniSTS SHRSP x BN Map 19 43.6299 RGD Cytogenetic Map 19 q12 UniSTS
BI296374
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 53,185,564 - 53,185,784 (+) MAPPER mRatBN7.2 Rnor_6.0 19 58,033,016 - 58,033,235 NCBI Rnor6.0 Rnor_5.0 19 68,736,026 - 68,736,245 UniSTS Rnor5.0 RGSC_v3.4 19 55,415,475 - 55,415,694 UniSTS RGSC3.4 Celera 19 52,546,340 - 52,546,559 UniSTS RH 3.4 Map 19 721.2 UniSTS Cytogenetic Map 19 q12 UniSTS
BF415610
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 53,131,507 - 53,131,642 (+) MAPPER mRatBN7.2 Rnor_6.0 19 57,944,392 - 57,944,526 NCBI Rnor6.0 Rnor_5.0 19 68,652,854 - 68,652,988 UniSTS Rnor5.0 RGSC_v3.4 19 55,347,455 - 55,347,589 UniSTS RGSC3.4 Celera 19 52,491,163 - 52,491,297 UniSTS RH 3.4 Map 19 718.4 UniSTS Cytogenetic Map 19 q12 UniSTS
fi45a03.x1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 53,074,621 - 53,076,085 (+) MAPPER mRatBN7.2 Rnor_6.0 19 57,887,854 - 57,889,317 NCBI Rnor6.0 Rnor_5.0 19 68,597,827 - 68,599,290 UniSTS Rnor5.0 RGSC_v3.4 19 55,290,605 - 55,292,068 UniSTS RGSC3.4 Celera 19 52,434,546 - 52,436,005 UniSTS Cytogenetic Map 19 q12 UniSTS
This gene Disc1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057945 ⟹ ENSRNOP00000054753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 53,034,869 - 53,219,778 (+) Ensembl Rnor_6.0 Ensembl 19 57,820,260 - 58,066,152 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119995 ⟹ ENSRNOP00000095161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 53,014,616 - 53,219,778 (+) Ensembl
RefSeq Acc Id:
NM_175596 ⟹ NP_783186
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,976 - 70,120,970 (+) NCBI mRatBN7.2 19 53,014,620 - 53,223,615 (+) NCBI Rnor_6.0 19 57,820,260 - 58,066,155 (+) NCBI Rnor_5.0 19 68,529,791 - 68,641,620 (+) NCBI Rnor_5.0 19 68,711,386 - 68,769,050 (+) NCBI RGSC_v3.4 19 55,265,116 - 55,449,375 (+) RGD Celera 19 52,376,528 - 52,580,211 (+) RGD
Sequence:
ATGCAGGGCGCGGGTTCCCGGGGCGCTTGGATCCACAGTCCGAGCCACTGCCCAGGCAATGGGCATGGCTCGCCGCCTGCAGTAGCCCCTCAGAGGCGGCGGCTGACACGGAGACCAGGCTACATGAG
hide sequence
RefSeq Acc Id:
XM_039097792 ⟹ XP_038953720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,552 - 70,108,171 (+) NCBI mRatBN7.2 19 53,014,202 - 53,210,810 (+) NCBI
RefSeq Acc Id:
XM_039097793 ⟹ XP_038953721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,551 - 70,090,316 (+) NCBI mRatBN7.2 19 53,014,202 - 53,192,968 (+) NCBI
RefSeq Acc Id:
XM_039097794 ⟹ XP_038953722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,552 - 70,023,107 (+) NCBI mRatBN7.2 19 53,014,202 - 53,125,894 (+) NCBI
RefSeq Acc Id:
XM_063278075 ⟹ XP_063134145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,551 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XM_063278076 ⟹ XP_063134146
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,550 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XM_063278077 ⟹ XP_063134147
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,552 - 70,108,236 (+) NCBI
RefSeq Acc Id:
XM_063278078 ⟹ XP_063134148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,552 - 70,108,236 (+) NCBI
RefSeq Acc Id:
XR_010060004
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,549 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XR_010060005
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,549 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XR_010060006
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,548 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XR_010060007
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,548 - 70,120,970 (+) NCBI
RefSeq Acc Id:
XR_010060008
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 69,911,552 - 70,117,132 (+) NCBI
RefSeq Acc Id:
NP_783186 ⟸ NM_175596
- UniProtKB:
A6KJ31 (UniProtKB/TrEMBL)
- Sequence:
MQGAGSRGAWIHSPSHCPGNGHGSPPAVAPQRRRLTRRPGYMRSTASPGIGFLSPAVGMPRPISAGLTGQEFYPSQSKARQCSLDLRSHCQDSLVGNPFLKGSLGPAVTSVGHLHPAQGSMRERMVHS
hide sequence
Ensembl Acc Id:
ENSRNOP00000054753 ⟸ ENSRNOT00000057945
RefSeq Acc Id:
XP_038953720 ⟸ XM_039097792
- Peptide Label:
isoform X3
- UniProtKB:
A6KJ31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953721 ⟸ XM_039097793
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038953722 ⟸ XM_039097794
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000095161 ⟸ ENSRNOT00000119995
RefSeq Acc Id:
XP_063134146 ⟸ XM_063278076
- Peptide Label:
isoform X2
- UniProtKB:
A6KJ31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134145 ⟸ XM_063278075
- Peptide Label:
isoform X1
- UniProtKB:
A6KJ31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134147 ⟸ XM_063278077
- Peptide Label:
isoform X6
- UniProtKB:
A6KJ31 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134148 ⟸ XM_063278078
- Peptide Label:
isoform X7
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-03-16
Disc1
DISC1 scaffold protein
Disc1
disrupted in schizophrenia 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-11
Disc1
disrupted in schizophrenia 1
Symbol and Name status set to approved
625702 APPROVED
Note Type
Note
Reference
gene_mutations_overexpression
expression of mutant form reduces neurite extension in PC12 cells
629536
gene_physical_interaction
interacts with NudE-like (NUDEL)
629536
