Symbol:
Nts
Name:
neurotensin
RGD ID:
621612
Description:
Predicted to enable neuropeptide receptor binding activity and receptor ligand activity. Involved in several processes, including cellular response to lithium ion; response to antipsychotic drug; and response to glucocorticoid. Located in axon terminus and neuronal cell body. Used to study nicotine dependence. Biomarker of sciatic neuropathy. Human ortholog(s) of this gene implicated in depressive disorder. Orthologous to human NTS (neurotensin); INTERACTS WITH (S)-colchicine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC299757; neuromedin N; neurotensin/neuromedin N; neurotensin/neuromedin N gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NTS (neurotensin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nts (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nts (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NTS (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NTS (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nts (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NTS (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NTS (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nts (neurotensin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NTS (neurotensin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nts (neurotensin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nts (neurotensin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nts
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 39,451,484 - 39,460,888 (-) NCBI GRCr8 mRatBN7.2 7 37,564,944 - 37,574,350 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 37,564,533 - 37,574,423 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 39,491,733 - 39,501,228 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 41,694,804 - 41,704,299 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 41,469,771 - 41,479,266 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 44,111,594 - 44,120,998 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 44,111,151 - 44,121,130 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 44,140,647 - 44,150,051 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 40,474,654 - 40,484,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 40,494,497 - 40,495,295 (-) NCBI Celera 7 34,527,468 - 34,536,872 (-) NCBI Celera Cytogenetic Map 7 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nts Rat (S)-amphetamine increases expression ISO Nts (Mus musculus) 6480464 Dextroamphetamine results in increased expression of NTS mRNA CTD PMID:11120399 Nts Rat (S)-colchicine increases expression EXP 6480464 Colchicine results in increased expression of NTS mRNA CTD PMID:1850078 Nts Rat 1,2-dimethylhydrazine decreases expression ISO Nts (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NTS mRNA CTD PMID:22206623 Nts Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NTS mRNA CTD PMID:20068009 Nts Rat 17beta-estradiol increases expression ISO NTS (Homo sapiens) 6480464 Estradiol results in increased expression of NTS mRNA CTD PMID:21795739 Nts Rat 17beta-estradiol multiple interactions ISO NTS (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of NTS mRNA and Progesterone inhibits the reaction [Estradiol results in increased expression of NTS mRNA] CTD PMID:20823114 and PMID:21795739 Nts Rat 17beta-hydroxy-5alpha-androstan-3-one affects expression ISO NTS (Homo sapiens) 6480464 Dihydrotestosterone affects the expression of NTS mRNA CTD PMID:17094431 Nts Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NTS mRNA CTD PMID:15977195 Nts Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Nts (Mus musculus) 6480464 NTS protein promotes the reaction [Trinitrobenzenesulfonic Acid results in increased expression of VWF protein] CTD PMID:25307345 Nts Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of NTS mRNA CTD PMID:15661373 Nts Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO NTS (Homo sapiens) 6480464 bisindolylmaleimide I affects the reaction [NTS protein results in increased chemical synthesis of Inositol Phosphates] more ... CTD PMID:18313772 Nts Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione increases activity ISO NTS (Homo sapiens) 6480464 bisindolylmaleimide I results in increased activity of NTS protein CTD PMID:18313772 Nts Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione increases activity EXP 6480464 bisindolylmaleimide I results in increased activity of NTS protein CTD PMID:18313772 Nts Rat 5-azacytidine decreases expression ISO NTS (Homo sapiens) 6480464 Azacitidine results in decreased expression of NTS mRNA CTD PMID:20823114 Nts Rat 5-fluorouracil affects response to substance ISO NTS (Homo sapiens) 6480464 NTS protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Nts Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NTS mRNA CTD PMID:24780913 and PMID:25825206 Nts Rat 8-(3-chlorostyryl)caffeine multiple interactions EXP 6480464 8-(3-chlorostyryl)caffeine inhibits the reaction [Haloperidol results in increased expression of NTS mRNA] CTD PMID:10199625 Nts Rat acrylamide decreases expression ISO NTS (Homo sapiens) 6480464 Acrylamide results in decreased expression of NTS mRNA CTD PMID:32763439 Nts Rat aflatoxin B1 increases expression ISO Nts (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NTS mRNA CTD PMID:19770486 Nts Rat aflatoxin B1 increases expression ISO NTS (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of NTS mRNA CTD PMID:21641981 Nts Rat aldehydo-D-glucose increases transport EXP 6480464 NTS protein results in increased transport of Glucose CTD PMID:11208724 Nts Rat aldrin increases expression ISO Nts (Mus musculus) 6480464 Aldrin results in increased expression of NTS mRNA CTD PMID:18579281 Nts Rat all-trans-retinoic acid multiple interactions ISO Nts (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of NTS mRNA CTD PMID:36189433 Nts Rat alpha-hexylcinnamaldehyde affects expression ISO Nts (Mus musculus) 6480464 hexyl cinnamic aldehyde affects the expression of NTS mRNA CTD PMID:22302311 Nts Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NTS mRNA CTD PMID:16483693 Nts Rat amphetamine increases expression ISO Nts (Mus musculus) 6480464 Amphetamine results in increased expression of NTS mRNA CTD PMID:14698760 Nts Rat arsenite(3-) decreases expression ISO Nts (Mus musculus) 6480464 arsenite results in decreased expression of NTS mRNA CTD PMID:18929588 Nts Rat arsenite(3-) multiple interactions ISO Nts (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of NTS mRNA] CTD PMID:18929588 Nts Rat arsenous acid decreases expression ISO NTS (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NTS mRNA CTD PMID:26705709 Nts Rat Azoxymethane multiple interactions ISO Nts (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NTS mRNA CTD PMID:29950665 Nts Rat batimastat multiple interactions ISO NTS (Homo sapiens) 6480464 batimastat inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of MAPK1 protein] and batimastat inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of MAPK3 protein] CTD PMID:15247267 Nts Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NTS mRNA CTD PMID:21839799 Nts Rat benzo[a]pyrene decreases expression ISO NTS (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NTS mRNA CTD PMID:32234424 Nts Rat benzo[a]pyrene affects methylation ISO NTS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NTS promoter CTD PMID:27901495 Nts Rat benzo[a]pyrene increases expression ISO Nts (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NTS mRNA CTD PMID:19770486 and PMID:23735875 Nts Rat bicalutamide decreases response to substance ISO NTS (Homo sapiens) 6480464 NTS protein results in decreased susceptibility to bicalutamide CTD PMID:17044078 Nts Rat bis(2-ethylhexyl) phthalate increases expression ISO NTS (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of NTS mRNA CTD PMID:31163220 Nts Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NTS mRNA CTD PMID:25181051 and PMID:34947998 Nts Rat bisphenol A affects methylation ISO NTS (Homo sapiens) 6480464 bisphenol A affects the methylation of NTS gene CTD PMID:31601247 Nts Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NTS mRNA CTD PMID:30816183 Nts Rat bucladesine multiple interactions ISO NTS (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of NTS mRNA CTD PMID:20823114 Nts Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of NTS mRNA CTD PMID:33453195 Nts Rat CGP 52608 multiple interactions ISO NTS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NTS gene] CTD PMID:28238834 Nts Rat chelerythrine increases activity ISO NTS (Homo sapiens) 6480464 chelerythrine results in increased activity of NTS protein CTD PMID:18313772 Nts Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of NTS mRNA CTD PMID:20682304 Nts Rat chromium atom increases transport EXP 6480464 NTS protein results in increased transport of Chromium CTD PMID:11208724 Nts Rat clothianidin decreases expression ISO NTS (Homo sapiens) 6480464 clothianidin results in decreased expression of NTS mRNA CTD PMID:31626844 Nts Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of NTS mRNA CTD PMID:12887421 Nts Rat cocaine increases expression ISO Nts (Mus musculus) 6480464 Cocaine results in increased expression of NTS mRNA CTD PMID:11120399 Nts Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of NTS mRNA CTD PMID:27899881 Nts Rat cocaine multiple interactions EXP 6480464 NTS protein inhibits the reaction [Cocaine results in decreased secretion of gamma-Aminobutyric Acid] CTD PMID:18252810 Nts Rat cocaine multiple interactions ISO Nts (Mus musculus) 6480464 DRD3 protein affects the reaction [Cocaine results in increased expression of NTS mRNA] CTD PMID:11120399 Nts Rat copper atom multiple interactions ISO NTS (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NTS mRNA CTD PMID:20971185 Nts Rat copper(0) multiple interactions ISO NTS (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NTS mRNA CTD PMID:20971185 Nts Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NTS mRNA CTD PMID:26577399 Nts Rat cyclosporin A increases expression ISO NTS (Homo sapiens) 6480464 Cyclosporine results in increased expression of NTS mRNA CTD PMID:20106945 Nts Rat D-glucose increases transport EXP 6480464 NTS protein results in increased transport of Glucose CTD PMID:11208724 Nts Rat D-mannitol increases transport EXP 6480464 NTS protein results in increased transport of Mannitol CTD PMID:11208724 Nts Rat dehydroepiandrosterone affects expression ISO NTS (Homo sapiens) 6480464 Dehydroepiandrosterone affects the expression of NTS mRNA CTD PMID:17094431 Nts Rat dexloxiglumide multiple interactions ISO NTS (Homo sapiens) 6480464 dexloxiglumide inhibits the reaction [osteum results in increased secretion of NTS protein] CTD PMID:18303078 Nts Rat dextran sulfate multiple interactions ISO Nts (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NTS mRNA CTD PMID:29950665 Nts Rat diarsenic trioxide decreases expression ISO NTS (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NTS mRNA CTD PMID:26705709 Nts Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of NTS mRNA CTD PMID:20682304 Nts Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of NTS mRNA CTD PMID:29108742 Nts Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of NTS mRNA CTD PMID:20682304 Nts Rat dioxygen decreases expression ISO NTS (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of NTS mRNA CTD PMID:24236059 Nts Rat dorsomorphin multiple interactions ISO NTS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nts Rat emamectin benzoate affects activity ISO NTS (Homo sapiens) 6480464 emamectin benzoate affects the activity of NTS protein CTD PMID:23611293 Nts Rat ethanol increases response to substance EXP 6480464 NTS protein results in increased susceptibility to Ethanol CTD PMID:11602683 Nts Rat fentanyl decreases expression EXP 6480464 Fentanyl results in decreased expression of NTS mRNA CTD PMID:36032789 Nts Rat fragrance increases expression ISO NTS (Homo sapiens) 6480464 Perfume results in increased expression of NTS mRNA CTD PMID:24768652 Nts Rat gamma-aminobutyric acid multiple interactions EXP 6480464 NTS protein inhibits the reaction [Cocaine results in decreased secretion of gamma-Aminobutyric Acid] CTD PMID:18252810 Nts Rat gamma-aminobutyric acid increases secretion EXP 6480464 NTS protein results in increased secretion of gamma-Aminobutyric Acid CTD PMID:18252810 Nts Rat genistein increases expression ISO Nts (Mus musculus) 6480464 Genistein results in increased expression of NTS mRNA CTD PMID:32186404 Nts Rat glucose increases transport EXP 6480464 NTS protein results in increased transport of Glucose CTD PMID:11208724 Nts Rat Goe 6976 increases activity ISO NTS (Homo sapiens) 6480464 Go 6976 results in increased activity of NTS protein CTD PMID:18313772 Nts Rat Goe 6976 multiple interactions ISO NTS (Homo sapiens) 6480464 Go 6976 inhibits the reaction [Tetradecanoylphorbol Acetate results in decreased activity of NTS protein] more ... CTD PMID:18313772 Nts Rat haloperidol multiple interactions ISO Nts (Mus musculus) 6480464 SLC6A3 protein promotes the reaction [Haloperidol results in increased expression of NTS mRNA] CTD PMID:14698760 Nts Rat haloperidol increases expression ISO Nts (Mus musculus) 6480464 Haloperidol results in increased expression of NTS mRNA CTD PMID:11120399 more ... Nts Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of NTS mRNA and Haloperidol results in increased expression of NTS protein CTD PMID:10199625 more ... Nts Rat haloperidol multiple interactions EXP 6480464 8-(3-chlorostyryl)caffeine inhibits the reaction [Haloperidol results in increased expression of NTS mRNA] and Theophylline inhibits the reaction [Haloperidol results in increased expression of NTS mRNA] CTD PMID:10199625 Nts Rat Lasiocarpine decreases expression ISO NTS (Homo sapiens) 6480464 lasiocarpine results in decreased expression of NTS mRNA CTD PMID:32234424 Nts Rat LY294002 multiple interactions ISO NTS (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] more ... CTD PMID:15177934 Nts Rat medroxyprogesterone acetate multiple interactions ISO NTS (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of NTS mRNA CTD PMID:20823114 Nts Rat mercury dibromide increases expression ISO NTS (Homo sapiens) 6480464 mercuric bromide results in increased expression of NTS mRNA CTD PMID:26272509 Nts Rat mercury dibromide multiple interactions ISO NTS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NTS mRNA CTD PMID:27188386 Nts Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of NTS mRNA CTD PMID:19564919 Nts Rat methylmercury chloride increases expression ISO NTS (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NTS mRNA CTD PMID:28001369 Nts Rat methylmercury chloride affects expression ISO NTS (Homo sapiens) 6480464 methylmercuric chloride affects the expression of NTS mRNA CTD PMID:34089799 Nts Rat microcystin-LR multiple interactions EXP 6480464 [Dietary Fats co-treated with Cholesterol and Dietary co-treated with cyanoginosin LR] results in increased expression of NTS mRNA CTD PMID:34740672 Nts Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of NTS mRNA CTD PMID:34740672 Nts Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Nts (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of NTS mRNA CTD PMID:36189433 Nts Rat N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of NTS gene CTD PMID:16495775 Nts Rat nickel atom increases expression EXP 6480464 Nickel results in increased expression of NTS mRNA CTD PMID:20682304 Nts Rat O-methyleugenol decreases expression ISO NTS (Homo sapiens) 6480464 methyleugenol results in decreased expression of NTS mRNA CTD PMID:32234424 Nts Rat okadaic acid decreases activity ISO NTS (Homo sapiens) 6480464 Okadaic Acid results in decreased activity of NTS protein CTD PMID:18313772 Nts Rat okadaic acid multiple interactions ISO NTS (Homo sapiens) 6480464 Okadaic Acid promotes the reaction [Tetradecanoylphorbol Acetate results in decreased activity of NTS protein] CTD PMID:18313772 Nts Rat orlistat multiple interactions ISO NTS (Homo sapiens) 6480464 Orlistat inhibits the reaction [Fats results in increased secretion of NTS protein] and Orlistat inhibits the reaction [Olive Oil results in increased secretion of NTS protein] CTD PMID:18303078 Nts Rat paracetamol affects expression ISO Nts (Mus musculus) 6480464 Acetaminophen affects the expression of NTS mRNA CTD PMID:17562736 Nts Rat phenylephrine decreases response to substance EXP 6480464 NTS protein results in decreased susceptibility to Phenylephrine CTD PMID:2326505 Nts Rat phenylmercury acetate multiple interactions ISO NTS (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NTS mRNA CTD PMID:27188386 Nts Rat phorbol 13-acetate 12-myristate decreases activity ISO NTS (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased activity of NTS protein CTD PMID:18313772 Nts Rat phorbol 13-acetate 12-myristate multiple interactions ISO NTS (Homo sapiens) 6480464 2-(1-(3-dimethylaminopropyl)-5-methoxyindol-3-yl)-3-(1H-indol-3-yl)maleimide inhibits the reaction [Tetradecanoylphorbol Acetate results in decreased activity of NTS protein] more ... CTD PMID:18313772 Nts Rat phosphoramidon multiple interactions ISO NTS (Homo sapiens) 6480464 phosphoramidon inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] more ... CTD PMID:15177934 Nts Rat phthalaldehyde affects expression ISO Nts (Mus musculus) 6480464 o-Phthalaldehyde affects the expression of NTS mRNA CTD PMID:22302311 Nts Rat pirinixic acid multiple interactions ISO NTS (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NTS mRNA CTD PMID:19710929 Nts Rat progesterone multiple interactions ISO NTS (Homo sapiens) 6480464 Progesterone inhibits the reaction [Estradiol results in increased expression of NTS mRNA] CTD PMID:21795739 Nts Rat quercetin increases activity ISO NTS (Homo sapiens) 6480464 Quercetin results in increased activity of NTS protein CTD PMID:18313772 Nts Rat reserpine increases expression EXP 6480464 Reserpine results in increased expression of NTS mRNA CTD PMID:1850078 Nts Rat Ro 31-8220 increases activity ISO NTS (Homo sapiens) 6480464 Ro 31-8220 results in increased activity of NTS protein CTD PMID:18313772 Nts Rat Ro 31-8220 multiple interactions ISO NTS (Homo sapiens) 6480464 Ro 31-8220 affects the reaction [NTS protein results in increased chemical synthesis of Inositol Phosphates] and Tetradecanoylphorbol Acetate inhibits the reaction [Ro 31-8220 results in increased activity of NTS protein] CTD PMID:18313772 Nts Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of NTS mRNA CTD PMID:19013527 Nts Rat rottlerin multiple interactions ISO NTS (Homo sapiens) 6480464 rottlerin affects the reaction [NTS protein results in increased chemical synthesis of Inositol Phosphates] more ... CTD PMID:15177934 and PMID:18313772 Nts Rat rottlerin increases activity ISO NTS (Homo sapiens) 6480464 rottlerin results in increased activity of NTS protein CTD PMID:18313772 Nts Rat SB 431542 multiple interactions ISO NTS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nts Rat silicon dioxide decreases expression ISO NTS (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of NTS mRNA CTD PMID:25895662 Nts Rat silicon dioxide increases expression ISO Nts (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NTS mRNA CTD PMID:23221170 Nts Rat sodium arsenate increases expression ISO Nts (Mus musculus) 6480464 sodium arsenate results in increased expression of NTS mRNA CTD PMID:30953684 Nts Rat sodium arsenite decreases expression ISO NTS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NTS mRNA CTD PMID:29301061 Nts Rat sodium arsenite increases expression ISO NTS (Homo sapiens) 6480464 sodium arsenite results in increased expression of NTS mRNA CTD PMID:38568856 Nts Rat Sodium oleate multiple interactions ISO NTS (Homo sapiens) 6480464 dexloxiglumide inhibits the reaction [osteum results in increased secretion of NTS protein] CTD PMID:18303078 Nts Rat Sodium oleate increases secretion ISO NTS (Homo sapiens) 6480464 osteum results in increased secretion of NTS protein CTD PMID:18303078 Nts Rat staurosporine multiple interactions ISO NTS (Homo sapiens) 6480464 Staurosporine inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] more ... CTD PMID:15177934 and PMID:18313772 Nts Rat staurosporine increases activity ISO NTS (Homo sapiens) 6480464 Staurosporine results in increased activity of NTS protein CTD PMID:18313772 Nts Rat sucrose decreases activity ISO NTS (Homo sapiens) 6480464 Sucrose results in decreased activity of NTS protein CTD PMID:18313772 Nts Rat sucrose multiple interactions ISO NTS (Homo sapiens) 6480464 Sucrose promotes the reaction [bisindolylmaleimide I results in increased activity of NTS protein] and Sucrose promotes the reaction [Tetradecanoylphorbol Acetate results in decreased activity of NTS protein] CTD PMID:18313772 Nts Rat theophylline multiple interactions EXP 6480464 Theophylline inhibits the reaction [Haloperidol results in increased expression of NTS mRNA] CTD PMID:10199625 Nts Rat titanium dioxide multiple interactions ISO Nts (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of NTS mRNA CTD PMID:29950665 Nts Rat trichostatin A increases expression ISO NTS (Homo sapiens) 6480464 trichostatin A results in increased expression of NTS mRNA CTD PMID:24935251 Nts Rat trimellitic anhydride increases expression ISO Nts (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NTS mRNA CTD PMID:19042947 Nts Rat trimellitic anhydride affects expression ISO Nts (Mus musculus) 6480464 trimellitic anhydride affects the expression of NTS mRNA CTD PMID:22302311 Nts Rat triptonide increases expression ISO Nts (Mus musculus) 6480464 triptonide results in increased expression of NTS mRNA CTD PMID:33045310 Nts Rat tyrphostin AG 1478 multiple interactions ISO NTS (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [NTS protein results in increased expression of CXCL8 mRNA] more ... CTD PMID:15177934 and PMID:15247267 Nts Rat U-73122 multiple interactions ISO NTS (Homo sapiens) 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:15177934 Nts Rat valproic acid affects expression ISO Nts (Mus musculus) 6480464 Valproic Acid affects the expression of NTS mRNA CTD PMID:17292431 Nts Rat valproic acid multiple interactions ISO NTS (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NTS mRNA CTD PMID:27188386 Nts Rat valproic acid increases expression ISO NTS (Homo sapiens) 6480464 Valproic Acid results in increased expression of NTS mRNA CTD PMID:19101580 more ... Nts Rat wortmannin multiple interactions ISO NTS (Homo sapiens) 6480464 wortmannin inhibits the reaction [NTS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] more ... CTD PMID:15177934
(S)-amphetamine (ISO) (S)-colchicine (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP,ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-(3-chlorostyryl)caffeine (EXP) acrylamide (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP) aldrin (ISO) all-trans-retinoic acid (ISO) alpha-hexylcinnamaldehyde (ISO) ammonium chloride (EXP) amphetamine (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (ISO) batimastat (ISO) benzo[a]pyrene (EXP,ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bucladesine (ISO) cadmium dichloride (EXP) CGP 52608 (ISO) chelerythrine (ISO) chlorpyrifos (EXP) chromium atom (EXP) clothianidin (ISO) clozapine (EXP) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (EXP) D-mannitol (EXP) dehydroepiandrosterone (ISO) dexloxiglumide (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) dieldrin (EXP) dioxygen (ISO) dorsomorphin (ISO) emamectin benzoate (ISO) ethanol (EXP) fentanyl (EXP) fragrance (ISO) gamma-aminobutyric acid (EXP) genistein (ISO) glucose (EXP) Goe 6976 (ISO) haloperidol (EXP,ISO) Lasiocarpine (ISO) LY294002 (ISO) medroxyprogesterone acetate (ISO) mercury dibromide (ISO) methamphetamine (EXP) methylmercury chloride (ISO) microcystin-LR (EXP) mono(2-ethylhexyl) phthalate (ISO) N-ethyl-N-nitrosourea (EXP) nickel atom (EXP) O-methyleugenol (ISO) okadaic acid (ISO) orlistat (ISO) paracetamol (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) phosphoramidon (ISO) phthalaldehyde (ISO) pirinixic acid (ISO) progesterone (ISO) quercetin (ISO) reserpine (EXP) Ro 31-8220 (ISO) rotenone (EXP) rottlerin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Sodium oleate (ISO) staurosporine (ISO) sucrose (ISO) theophylline (EXP) titanium dioxide (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triptonide (ISO) tyrphostin AG 1478 (ISO) U-73122 (ISO) valproic acid (ISO) wortmannin (ISO)
1.
Differential effects of cocaine and methamphetamine on neurotensin/neuromedin N and preprotachykinin messenger RNA expression in unique regions of the striatum.
Adams DH, etal., Neuroscience. 2001;102(4):843-51.
2.
Estrogen-inducible neurotensin immunoreactivity in the preoptic area of the female rat.
Alexander MJ and Leeman SE, J Comp Neurol. 1994 Jul 22;345(4):496-509.
3.
Cellular distribution of neurotensin receptors in rat brain: immunohistochemical study using an antipeptide antibody against the cloned high affinity receptor.
Boudin H, etal., J Comp Neurol. 1996 Sep 9;373(1):76-89.
4.
Synergistic induction of neurotensin gene transcription in PC12 cells parallels changes in AP-1 activity.
Bullock BP, etal., Brain Res Mol Brain Res. 1994 Dec;27(2):232-42.
5.
Biosynthesis and posttranslational processing of the neurotensin/neuromedin N precursor in the rat medullary thyroid carcinoma 6-23 cell line. Effect of dexamethasone.
de Nadai F, etal., Endocrinology. 1993 Apr;132(4):1614-20.
6.
Kinetics of neurotensin gene expression in the developing gut.
Evers BM and Wang XF, Surgery. 1996 Feb;119(2):186-90.
7.
Developmental expression of the neurotensin gene in the rat liver.
Evers BM, etal., Ann Surg. 1993 Aug;218(2):183-8.
8.
Distribution of the neurotensin receptor NTS1 in the rat CNS studied using an amino-terminal directed antibody.
Fassio A, etal., Neuropharmacology. 2000 Jun 8;39(8):1430-42.
9.
Neurotensin receptor antagonist administered during cocaine withdrawal decreases locomotor sensitization and conditioned place preference.
Felszeghy K, etal., Neuropsychopharmacology. 2007 Dec;32(12):2601-10. doi: 10.1038/sj.npp.1301382. Epub 2007 Mar 14.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
The rat gene encoding neurotensin and neuromedin N. Structure, tissue-specific expression, and evolution of exon sequences.
Kislauskis E, etal., J Biol Chem 1988 Apr 5;263(10):4963-8.
12.
Characterization of neurotensin receptors.
Kitabgi P and Pelaprat D, Curr Protoc Pharmacol. 2004 May;Chapter 1:Unit 1.29. doi: 10.1002/0471141755.ph0129s24.
13.
Effects of neurotensin in amygdaloid spatial learning mechanisms.
Laszlo K, etal., Behav Brain Res. 2010 Jul 11;210(2):280-3. doi: 10.1016/j.bbr.2010.02.038. Epub 2010 Feb 26.
14.
Effect of a novel neurotensin analog, NT69L, on nicotine-induced alterations in monoamine levels in rat brain.
Liang Y, etal., Brain Res. 2008 Sep 22;1231:6-15. doi: 10.1016/j.brainres.2008.07.037. Epub 2008 Jul 19.
15.
Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.
Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
16.
Coexpression of neurotensin and c-fos mRNAs in rat neostriatal neurons following acute haloperidol.
Merchant KM and Miller MA, Brain Res Mol Brain Res. 1994 May;23(3):271-7.
17.
Pro-Neurotensin as a Potential Novel Diagnostic Biomarker for Detection of Nonalcoholic Fatty Liver Disease.
Mohamed AA, etal., Diabetes Metab Syndr Obes. 2022 Jun 22;15:1935-1943. doi: 10.2147/DMSO.S365147. eCollection 2022.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
Acute, but not repeated, administration of the neurotensin NTS1 receptor agonist PD149163 decreases conditioned footshock-induced ultrasonic vocalizations in rats.
Prus AJ, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2014 Mar 3;49:78-84. doi: 10.1016/j.pnpbp.2013.11.011. Epub 2013 Nov 23.
20.
Neurotensin antagonist acutely and robustly attenuates locomotion that accompanies stimulation of a neurotensin-containing pathway from rostrobasal forebrain to the ventral tegmental area.
Reynolds SM, etal., Eur J Neurosci. 2006 Jul;24(1):188-96. doi: 10.1111/j.1460-9568.2006.04791.x.
21.
GOA pipeline
RGD automated data pipeline
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
Immunohistochemical evidence for the implication of PC1 in the processing of proneurotensin in rat brain.
Villeneuve P, etal., Neuroreport. 2000 Nov 9;11(16):3443-7.
25.
Physiological regulation of peptide messenger RNA colocalization in rat hypothalamic paraventricular medial parvicellular neurons.
Watts AG and Sanchez-Watts G, J Comp Neurol. 1995 Feb 20;352(4):501-14.
26.
Region-specific regulation of neuropeptide mRNAs in rat limbic forebrain neurones by aldosterone and corticosterone.
Watts AG and Sanchez-Watts G, J Physiol. 1995 May 1;484 ( Pt 3):721-36.
27.
Neuropeptides and thirst: the temporal response of corticotropin-releasing hormone and neurotensin/neuromedin N gene expression in rat limbic forebrain neurons to drinking hypertonic saline.
Watts AG, etal., Behav Neurosci. 1995 Dec;109(6):1146-57.
28.
Chronic pain increases brainstem proneurotensin/neuromedin-N mRNA expression: a hybridization-histochemical and immunohistochemical study using three different rat models for chronic nociception.
Williams FG and Beitz AJ, Brain Res. 1993 May 14;611(1):87-102.
29.
Post-translational processing of the neurotensin/neuromedin N precursor in the central nervous system of the rat--II. Immunohistochemical localization of maturation products.
Woulfe J, etal., Neuroscience. 1994 May;60(1):167-81.
30.
Heterogeneity of melanized neurons expressing neurotensin receptor messenger RNA in the substantia nigra and the nucleus paranigralis of control and Parkinson's disease brain.
Yamada M, etal., Neuroscience. 1995 Jan;64(2):405-17.
31.
Distinct and interactive effects of d-amphetamine and haloperidol on levels of neurotensin and its mRNA in subterritories in the dorsal and ventral striatum of the rat.
Zahm DS, etal., J Comp Neurol. 1998 Nov 2;400(4):487-503.
32.
Peripheral axotomy induces increased expression of neurotensin in large neurons in rat lumbar dorsal root ganglia.
Zhang X, etal., Neurosci Res. 1996 Aug;25(4):359-69.
Nts Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 39,451,484 - 39,460,888 (-) NCBI GRCr8 mRatBN7.2 7 37,564,944 - 37,574,350 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 37,564,533 - 37,574,423 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 39,491,733 - 39,501,228 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 41,694,804 - 41,704,299 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 41,469,771 - 41,479,266 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 44,111,594 - 44,120,998 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 44,111,151 - 44,121,130 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 44,140,647 - 44,150,051 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 40,474,654 - 40,484,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 40,494,497 - 40,495,295 (-) NCBI Celera 7 34,527,468 - 34,536,872 (-) NCBI Celera Cytogenetic Map 7 q21 NCBI
NTS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 85,874,295 - 85,882,992 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 85,874,295 - 85,882,992 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 86,268,073 - 86,276,770 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 84,792,206 - 84,800,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 84,770,542 - 84,779,231 NCBI Celera 12 85,930,823 - 85,939,559 (+) NCBI Celera Cytogenetic Map 12 q21.31 NCBI HuRef 12 83,324,584 - 83,333,603 (+) NCBI HuRef CHM1_1 12 86,233,027 - 86,241,361 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 85,854,932 - 85,863,806 (+) NCBI T2T-CHM13v2.0
Nts Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 102,317,617 - 102,326,294 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 102,317,617 - 102,326,347 (-) Ensembl GRCm39 Ensembl GRCm38 10 102,481,756 - 102,490,418 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 102,481,756 - 102,490,486 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 101,944,390 - 101,953,052 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 101,911,444 - 101,920,106 (-) NCBI MGSCv36 mm8 Celera 10 104,415,989 - 104,424,662 (-) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 53.56 NCBI
Nts Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 23,748,280 - 23,758,529 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 23,696,258 - 23,758,487 (+) NCBI ChiLan1.0 ChiLan1.0
NTS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 93,932,967 - 93,940,591 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 93,929,364 - 93,936,989 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 83,402,313 - 83,410,356 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 86,640,722 - 86,648,708 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 86,640,720 - 86,648,745 (+) Ensembl panpan1.1 panPan2
NTS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 27,361,002 - 27,372,232 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 27,361,002 - 27,372,232 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 27,806,896 - 27,818,114 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 27,977,054 - 27,988,287 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 27,977,054 - 27,988,287 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 27,329,416 - 27,340,646 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 27,370,112 - 27,381,344 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 27,659,448 - 27,670,671 (+) NCBI UU_Cfam_GSD_1.0
Nts Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 32,906,185 - 32,916,431 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936507 3,318,915 - 3,329,342 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936507 3,318,982 - 3,329,248 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NTS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 96,260,560 - 96,272,976 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 96,261,299 - 96,272,947 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 101,076,752 - 101,088,628 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NTS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 81,270,147 - 81,278,327 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 81,270,593 - 81,277,713 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 164,046,316 - 164,054,238 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nts
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 66 Interacting mature miRNAs: 78 Transcripts: ENSRNOT00000005706 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
1
23
101
65
71
46
9
46
2
118
39
92
25
41
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005706 ⟹ ENSRNOP00000005706
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 37,564,533 - 37,574,423 (-) Ensembl Rnor_6.0 Ensembl 7 44,111,151 - 44,121,130 (-) Ensembl
RefSeq Acc Id:
NM_001102381 ⟹ NP_001095851
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 39,451,484 - 39,460,888 (-) NCBI mRatBN7.2 7 37,564,944 - 37,574,350 (-) NCBI Rnor_6.0 7 44,111,594 - 44,120,998 (-) NCBI Rnor_5.0 7 44,140,647 - 44,150,051 (-) NCBI RGSC_v3.4 7 40,474,654 - 40,484,058 (-) RGD Celera 7 34,527,468 - 34,536,872 (-) RGD
Sequence:
GCCAGCTGAAGGCAAGAGGAAGCACCAAGAGAGCTCCTTCCGTGTCTGTGTGGACCTGCTTGTCAGAAGGCTGAGACAAGATGATAGGAATGAACCTTCAGCTGGTGTGCCTGACTCTCCTGGCTTTC
hide sequence
RefSeq Acc Id:
NP_001095851 ⟸ NM_001102381
- Peptide Label:
precursor
- UniProtKB:
Q9QV80 (UniProtKB/Swiss-Prot), P20068 (UniProtKB/Swiss-Prot), A6IGA8 (UniProtKB/TrEMBL), G3V6J4 (UniProtKB/TrEMBL)
- Sequence:
MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRVLEADLLTNMHASKVSKGSPPSWKMTLLNVCSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEIIQEDILDH
hide sequence
Ensembl Acc Id:
ENSRNOP00000005706 ⟸ ENSRNOT00000005706
RGD ID: 13695176 Promoter ID: EPDNEW_R5701 Type: single initiation site Name: Nts_1 Description: neurotensin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 44,121,018 - 44,121,078 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2007-10-18
Nts
neurotensin
Nts_predicted
neurotensin (predicted)
Data merged from RGD:1308997
737654 APPROVED
2005-01-20
Nts
neurotensin
neurotensin/neuromedin N gene
Name updated
1299863 APPROVED
2005-01-12
Nts_predicted
neurotensin (predicted)
Symbol and Name status set to approved
70820 APPROVED
2002-08-07
Nts
neurotensin/neuromedin N gene
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_transcript
neurotensin and neuromedin N coding domains are tandemly positioned on exon 4
728959
