Symbol:
Srd5a2
Name:
steroid 5 alpha-reductase 2
RGD ID:
621480
Description:
Enables 3-oxo-5-alpha-steroid 4-dehydrogenase activity and amide binding activity. Involved in several processes, including limbic system development; reproductive structure development; and steroid metabolic process. Located in cell body fiber and neuronal cell body. Biomarker of diabetes mellitus and hyperprolactinemia. Human ortholog(s) of this gene implicated in hypospadias and prostate cancer. Orthologous to human SRD5A2 (steroid 5 alpha-reductase 2); PARTICIPATES IN testosterone biosynthetic pathway; prostate cancer pathway; steroid hormone biosynthetic pathway; INTERACTS WITH 17beta-hydroxy-5alpha-androstan-3-one; 2,2',4,4',5,5'-hexachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3-oxo-5-alpha-steroid 4-dehydrogenase 2; 5 alpha-SR2; S5AR 2; SR type 2; steroid 5-alpha-reductase 2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 27,178,089 - 27,217,588 (+) NCBI GRCr8 mRatBN7.2 6 21,426,225 - 21,465,727 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 21,426,215 - 21,462,112 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 21,755,011 - 21,794,514 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 22,070,851 - 22,110,348 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 21,551,287 - 21,590,788 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 25,279,635 - 25,315,501 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 25,279,626 - 25,315,511 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 35,127,532 - 35,163,398 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 21,453,521 - 21,489,408 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 21,456,473 - 21,492,397 (+) NCBI Celera 6 20,976,906 - 21,012,848 (+) NCBI Celera Cytogenetic Map 6 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Srd5a2 Rat (-)-epigallocatechin 3-gallate decreases expression ISO SRD5A2 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat 1,2-dimethylhydrazine decreases expression ISO Srd5a2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SRD5A2 mRNA CTD PMID:22206623 Srd5a2 Rat 17beta-estradiol decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Estradiol results in decreased expression of SRD5A2 mRNA CTD PMID:20106945 Srd5a2 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO Srd5a2 (Mus musculus) 6480464 hydroxyflutamide inhibits the reaction [Dihydrotestosterone results in increased expression of SRD5A2 mRNA] CTD PMID:15056816 Srd5a2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of SRD5A2 mRNA CTD PMID:22131296 Srd5a2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO Srd5a2 (Mus musculus) 6480464 Dihydrotestosterone results in increased expression of SRD5A2 mRNA CTD PMID:15056816 Srd5a2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:19464308 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SRD5A2 mRNA CTD PMID:11222880 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Srd5a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SRD5A2 mRNA CTD PMID:28213091 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Srd5a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to SRD5A2 gene] CTD PMID:28213091 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SRD5A2 mRNA CTD PMID:21724226 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SRD5A2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SRD5A2 mRNA CTD PMID:22298810 Srd5a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SRD5A2 mRNA CTD PMID:22298810 Srd5a2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Srd5a2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Srd5a2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Srd5a2 Rat 3,17-Androstanediol glucuronide decreases abundance ISO SRD5A2 (Homo sapiens) 6480464 SRD5A2 gene SNP results in decreased abundance of androstane-3 and 17-diol glucuronide CTD PMID:17136762 Srd5a2 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:19464308 Srd5a2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of SRD5A2 mRNA CTD PMID:19162173 Srd5a2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Srd5a2 (Mus musculus) 6480464 bisphenol S results in decreased expression of SRD5A2 mRNA CTD PMID:39298647 Srd5a2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Srd5a2 (Mus musculus) 6480464 bisphenol S results in decreased methylation of SRD5A2 exon CTD PMID:33297965 Srd5a2 Rat 4-hydroxyphenyl retinamide increases expression ISO Srd5a2 (Mus musculus) 6480464 Fenretinide results in increased expression of SRD5A2 mRNA CTD PMID:28973697 Srd5a2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SRD5A2 mRNA CTD PMID:30047161 Srd5a2 Rat aflatoxin B1 affects expression ISO SRD5A2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of SRD5A2 protein CTD PMID:20106945 Srd5a2 Rat aflatoxin B1 decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SRD5A2 mRNA CTD PMID:22100608 Srd5a2 Rat aflatoxin B1 decreases expression ISO Srd5a2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SRD5A2 mRNA CTD PMID:19770486 Srd5a2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SRD5A2 mRNA CTD PMID:30047161 Srd5a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SRD5A2 mRNA CTD PMID:16483693 Srd5a2 Rat antirheumatic drug decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SRD5A2 mRNA CTD PMID:24449571 Srd5a2 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of SRD5A2 mRNA CTD PMID:16938428 Srd5a2 Rat Azoxymethane multiple interactions ISO Srd5a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SRD5A2 mRNA CTD PMID:29950665 Srd5a2 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of SRD5A2 gene CTD PMID:33854195 Srd5a2 Rat benzo[a]pyrene affects methylation ISO SRD5A2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SRD5A2 exon and Benzo(a)pyrene affects the methylation of SRD5A2 promoter CTD PMID:27901495 Srd5a2 Rat benzo[a]pyrene decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SRD5A2 mRNA CTD PMID:32234424 Srd5a2 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of SRD5A2 mRNA CTD PMID:38278498 Srd5a2 Rat bifenthrin decreases expression ISO Srd5a2 (Mus musculus) 6480464 bifenthrin results in decreased expression of SRD5A2 mRNA CTD PMID:26071804 Srd5a2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SRD5A2 mRNA CTD PMID:34015638 Srd5a2 Rat bisphenol A decreases expression ISO Srd5a2 (Mus musculus) 6480464 bisphenol A results in decreased expression of SRD5A2 mRNA and bisphenol A results in decreased expression of SRD5A2 protein CTD PMID:25434310 Srd5a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SRD5A2 mRNA CTD PMID:30816183 and PMID:32528016 Srd5a2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SRD5A2 mRNA and bisphenol A results in decreased expression of SRD5A2 protein CTD PMID:23405234 more ... Srd5a2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of SRD5A2 mRNA CTD PMID:19167457 Srd5a2 Rat cadmium atom increases expression ISO SRD5A2 (Homo sapiens) 6480464 Cadmium results in increased expression of SRD5A2 mRNA CTD PMID:21120746 Srd5a2 Rat chlorogenic acid decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Chlorogenic Acid results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of SRD5A2 gene CTD PMID:33854195 Srd5a2 Rat clothianidin increases expression ISO SRD5A2 (Homo sapiens) 6480464 clothianidin results in increased expression of SRD5A2 mRNA CTD PMID:31626844 Srd5a2 Rat cyclosporin A decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SRD5A2 mRNA CTD PMID:20106945 Srd5a2 Rat cypermethrin increases expression ISO Srd5a2 (Mus musculus) 6480464 cypermethrin results in increased expression of SRD5A2 mRNA CTD PMID:21142847 Srd5a2 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of SRD5A2 mRNA and cypermethrin results in decreased expression of SRD5A2 protein CTD PMID:34794910 Srd5a2 Rat D-aspartic acid increases expression EXP 6480464 D-Aspartic Acid results in increased expression of SRD5A2 mRNA CTD PMID:26044185 Srd5a2 Rat DDE decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat dextran sulfate multiple interactions ISO Srd5a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SRD5A2 mRNA CTD PMID:29950665 Srd5a2 Rat dibutyl phthalate decreases expression ISO Srd5a2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SRD5A2 mRNA and Dibutyl Phthalate results in decreased expression of SRD5A2 protein CTD PMID:25434310 Srd5a2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SRD5A2 mRNA CTD PMID:26948521 and PMID:27079746 Srd5a2 Rat diquat decreases expression ISO Srd5a2 (Mus musculus) 6480464 Diquat results in decreased expression of SRD5A2 mRNA CTD PMID:36851058 Srd5a2 Rat dutasteride decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Dutasteride results in decreased expression of SRD5A2 mRNA CTD PMID:16806904 Srd5a2 Rat epoxiconazole decreases expression ISO Srd5a2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SRD5A2 mRNA CTD PMID:35436446 Srd5a2 Rat fenarimol decreases activity ISO SRD5A2 (Homo sapiens) 6480464 fenarimol results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat finasteride decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Finasteride results in decreased activity of SRD5A2 protein CTD PMID:17218080 more ... Srd5a2 Rat finasteride multiple interactions ISO SRD5A2 (Homo sapiens) 6480464 Finasteride inhibits the reaction [Testosterone results in increased expression of SRD5A2 mRNA] more ... CTD PMID:23523586 Srd5a2 Rat fluoroethene decreases activity ISO SRD5A2 (Homo sapiens) 6480464 vinyl fluoride analog results in decreased activity of SRD5A2 protein CTD PMID:8689240 Srd5a2 Rat flutamide decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Flutamide results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat furan increases expression EXP 6480464 furan results in increased expression of SRD5A2 mRNA CTD PMID:22079235 Srd5a2 Rat galaxolide decreases expression EXP 6480464 galaxolide results in decreased expression of SRD5A2 mRNA CTD PMID:37797914 Srd5a2 Rat genistein decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Genistein results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of SRD5A2 gene CTD PMID:33854195 Srd5a2 Rat hydroxyflutamide multiple interactions ISO Srd5a2 (Mus musculus) 6480464 hydroxyflutamide inhibits the reaction [Dihydrotestosterone results in increased expression of SRD5A2 mRNA] CTD PMID:15056816 Srd5a2 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of SRD5A2 gene CTD PMID:33854195 Srd5a2 Rat lidocaine decreases expression EXP 6480464 Lidocaine results in decreased expression of SRD5A2 mRNA CTD PMID:35283115 Srd5a2 Rat linuron decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Linuron results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat lipopolysaccharide multiple interactions ISO SRD5A2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Srd5a2 Rat mangiferin decreases activity ISO SRD5A2 (Homo sapiens) 6480464 mangiferin results in decreased activity of SRD5A2 protein CTD PMID:20823678 Srd5a2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SRD5A2 mRNA CTD PMID:30047161 Srd5a2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SRD5A2 gene CTD PMID:35440735 Srd5a2 Rat methyltestosterone decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Methyltestosterone results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat metoclopramide increases expression EXP 6480464 Metoclopramide results in increased expression of SRD5A2 mRNA CTD PMID:18978642 Srd5a2 Rat N-Nitrosopyrrolidine decreases expression ISO SRD5A2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of SRD5A2 mRNA CTD PMID:32234424 Srd5a2 Rat O-methyleugenol decreases expression ISO SRD5A2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of SRD5A2 mRNA CTD PMID:32234424 Srd5a2 Rat okadaic acid decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of SRD5A2 mRNA CTD PMID:38832940 Srd5a2 Rat Osajin decreases expression ISO SRD5A2 (Homo sapiens) 6480464 osajin results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat paracetamol increases expression ISO Srd5a2 (Mus musculus) 6480464 Acetaminophen results in increased expression of SRD5A2 mRNA CTD PMID:29246445 Srd5a2 Rat paracetamol multiple interactions ISO Srd5a2 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of SRD5A2 mRNA] CTD PMID:29246445 Srd5a2 Rat PCB138 multiple interactions EXP 6480464 [3 more ... CTD PMID:19464308 Srd5a2 Rat perfluorooctanoic acid multiple interactions ISO Srd5a2 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats more ... CTD PMID:20118188 and PMID:23626681 Srd5a2 Rat perfluorooctanoic acid decreases expression ISO Srd5a2 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of SRD5A2 mRNA CTD PMID:20118188 and PMID:23626681 Srd5a2 Rat piperidine decreases activity ISO SRD5A2 (Homo sapiens) 6480464 piperidine analog results in decreased activity of SRD5A2 protein CTD PMID:10896124 Srd5a2 Rat piperidine decreases activity EXP 6480464 piperidine analog results in decreased activity of SRD5A2 protein CTD PMID:10896124 Srd5a2 Rat pirinixic acid multiple interactions ISO Srd5a2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SRD5A2 mRNA CTD PMID:19710929 Srd5a2 Rat Pomiferin decreases expression ISO SRD5A2 (Homo sapiens) 6480464 pomiferin results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat pravastatin decreases expression ISO Srd5a2 (Mus musculus) 6480464 Pravastatin results in decreased expression of SRD5A2 mRNA CTD PMID:27225895 Srd5a2 Rat prochloraz decreases activity ISO SRD5A2 (Homo sapiens) 6480464 prochloraz results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat progesterone decreases activity ISO SRD5A2 (Homo sapiens) 6480464 Progesterone analog results in decreased activity of SRD5A2 protein CTD PMID:20359488 Srd5a2 Rat propofol decreases expression ISO SRD5A2 (Homo sapiens) 6480464 Propofol results in decreased expression of SRD5A2 mRNA CTD PMID:35238236 Srd5a2 Rat puerarin decreases expression ISO SRD5A2 (Homo sapiens) 6480464 puerarin results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat resveratrol decreases expression ISO SRD5A2 (Homo sapiens) 6480464 resveratrol results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Testosterone results in increased expression of SRD5A2 mRNA] CTD PMID:25714330 Srd5a2 Rat Rosavin decreases expression ISO SRD5A2 (Homo sapiens) 6480464 rosavin results in decreased expression of SRD5A2 mRNA CTD PMID:20706672 Srd5a2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SRD5A2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Srd5a2 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO SRD5A2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of SRD5A2 mRNA CTD PMID:35811015 Srd5a2 Rat sodium arsenite increases expression ISO SRD5A2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SRD5A2 mRNA CTD PMID:38568856 Srd5a2 Rat sulpiride increases expression EXP 6480464 Sulpiride results in increased expression of SRD5A2 mRNA CTD PMID:18978642 Srd5a2 Rat testosterone multiple interactions ISO SRD5A2 (Homo sapiens) 6480464 Finasteride inhibits the reaction [Testosterone results in increased expression of SRD5A2 mRNA] more ... CTD PMID:23523586 Srd5a2 Rat testosterone increases expression EXP 6480464 Testosterone results in increased expression of SRD5A2 mRNA CTD PMID:22131296 more ... Srd5a2 Rat testosterone multiple interactions EXP 6480464 resveratrol inhibits the reaction [Testosterone results in increased expression of SRD5A2 mRNA] CTD PMID:25714330 Srd5a2 Rat testosterone increases expression ISO SRD5A2 (Homo sapiens) 6480464 Testosterone results in increased expression of SRD5A2 mRNA CTD PMID:23523586 Srd5a2 Rat tetrachloroethene decreases expression ISO Srd5a2 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of SRD5A2 mRNA CTD PMID:28973375 Srd5a2 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of SRD5A2 gene CTD PMID:33854195 Srd5a2 Rat titanium dioxide multiple interactions ISO Srd5a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SRD5A2 mRNA CTD PMID:29950665 Srd5a2 Rat titanium dioxide decreases methylation ISO Srd5a2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SRD5A2 gene CTD PMID:35295148 Srd5a2 Rat tributylstannane decreases activity ISO SRD5A2 (Homo sapiens) 6480464 tributyltin results in decreased activity of SRD5A2 protein CTD PMID:12231121 Srd5a2 Rat tributylstannane multiple interactions ISO SRD5A2 (Homo sapiens) 6480464 Finasteride promotes the reaction [tributyltin inhibits the reaction [Testosterone results in increased expression of SRD5A2 mRNA]] more ... CTD PMID:23523586 Srd5a2 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of SRD5A2 mRNA CTD PMID:21683754 Srd5a2 Rat Tributyltin oxide decreases activity ISO SRD5A2 (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SRD5A2 mRNA CTD PMID:33387578 Srd5a2 Rat triphenylstannane decreases activity ISO SRD5A2 (Homo sapiens) 6480464 triphenyltin results in decreased activity of SRD5A2 protein CTD PMID:17218080 Srd5a2 Rat zaragozic acid A decreases expression ISO Srd5a2 (Mus musculus) 6480464 squalestatin 1 results in decreased expression of SRD5A2 mRNA CTD PMID:27225895 Srd5a2 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of SRD5A2 mRNA CTD PMID:27225895 Srd5a2 Rat zoledronic acid increases expression ISO SRD5A2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of SRD5A2 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,17-Androstanediol glucuronide (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) Aroclor 1254 (EXP) Azoxymethane (ISO) azoxystrobin (EXP) benzo[a]pyrene (EXP,ISO) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) chlorogenic acid (ISO) chlorpyrifos (EXP) clothianidin (ISO) cyclosporin A (ISO) cypermethrin (EXP,ISO) D-aspartic acid (EXP) DDE (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) diquat (ISO) dutasteride (ISO) epoxiconazole (ISO) fenarimol (ISO) finasteride (ISO) fluoroethene (ISO) flutamide (ISO) furan (EXP) galaxolide (EXP) genistein (ISO) glyphosate (EXP) hydroxyflutamide (ISO) imidacloprid (EXP) lidocaine (EXP) linuron (ISO) lipopolysaccharide (ISO) mangiferin (ISO) methimazole (EXP) methoxychlor (EXP) methyltestosterone (ISO) metoclopramide (EXP) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) okadaic acid (ISO) Osajin (ISO) paracetamol (ISO) PCB138 (EXP) perfluorooctanoic acid (ISO) piperidine (EXP,ISO) pirinixic acid (ISO) Pomiferin (ISO) pravastatin (ISO) prochloraz (ISO) progesterone (ISO) propofol (ISO) puerarin (ISO) resveratrol (EXP,ISO) Rosavin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sulpiride (EXP) testosterone (EXP,ISO) tetrachloroethene (ISO) thiabendazole (EXP) titanium dioxide (ISO) tributylstannane (EXP,ISO) Tributyltin oxide (ISO) trichloroethene (EXP) triphenylstannane (ISO) zaragozic acid A (EXP,ISO) zoledronic acid (ISO)
Biological Process
androgen biosynthetic process (IDA,IEA,ISO) androgen metabolic process (IDA,IEA,ISO) biphenyl metabolic process (IEP) bone development (IEP) cell differentiation (IEA) dibenzo-p-dioxin metabolic process (IEP) female genitalia development (IEP) hippocampus development (IEP) hypothalamus development (IEP) lipid metabolic process (IEA) male genitalia development (IEA,IEP,ISO,TAS) male gonad development (IEA,IEP,ISO) phthalate metabolic process (IEP) response to biphenyl (IDA) response to follicle-stimulating hormone (IEP) response to nutrient levels (IEP) response to peptide hormone (IDA) response to steroid hormone (IEP) response to testosterone (IEP) response to xenobiotic stimulus (IEP) sex differentiation (IEA,TAS) steroid biosynthetic process (IBA,IDA,IEA,ISO) steroid catabolic process (IDA) steroid metabolic process (IEA) testosterone biosynthetic process (IEA,ISO,ISS)
1.
Inhibition of rat alpha-reductases by finasteride: evidence for isozyme differences in the mechanism of inhibition.
Azzolina B, etal., J Steroid Biochem Mol Biol. 1997 Apr;61(1-2):55-64.
2.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
3.
Regulation of prostate 5alpha-reductase-2 gene expression and prostate weight by dietary fat and caloric intake in the rat.
Cai LQ, etal., Prostate. 2006 May 15;66(7):738-48.
4.
Dimorphic expression of testosterone metabolizing enzymes in the hypothalamic area of developing rats.
Colciago A, etal., Brain Res Dev Brain Res. 2005 Mar 31;155(2):107-16.
5.
Prenatal Aroclor 1254 exposure and brain sexual differentiation: effect on the expression of testosterone metabolizing enzymes and androgen receptors in the hypothalamus of male and female rats.
Colciago A, etal., Reprod Toxicol. 2006 Nov;22(4):738-45. Epub 2006 Jul 14.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
9.
5alpha-reductase isoenzymes 1 and 2 in the rat testis during postnatal development.
Killian J, etal., Biol Reprod. 2003 May;68(5):1711-8. Epub 2002 Dec 11.
10.
Effects of in utero exposure to DI(n-Butyl) phthalate on development of male reproductive tracts in Sprague-Dawley rats.
Kim TS, etal., J Toxicol Environ Health A. 2010 Jan;73(21-22):1544-59.
11.
Semicomprehensive Analysis of the Postnatal Age-Related Changes in the mRNA Expression of Sex Steroidogenic Enzymes and Sex Steroid Receptors in the Male Rat Hippocampus.
Kimoto T, etal., Endocrinology. 2010 Nov 3.
12.
Expression of progesterone metabolizing enzyme genes (AKR1C1, AKR1C2, AKR1C3, SRD5A1, SRD5A2) is altered in human breast carcinoma.
Lewis MJ, etal., BMC Cancer. 2004 Jun 22;4:27.
13.
Decreased gene expression of steroid 5 alpha-reductase 2 in human prostate cancer: implications for finasteride therapy of prostate carcinoma.
Luo J, etal., Prostate. 2003 Oct 1;57(2):134-9.
14.
Association of mis-sense substitution in SRD5A2 gene with prostate cancer in African-American and Hispanic men in Los Angeles, USA.
Makridakis NM, etal., Lancet. 1999 Sep 18;354(9183):975-8.
15.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
16.
Androgen synthesis in adrenarche.
Miller WL Rev Endocr Metab Disord. 2009 Mar;10(1):3-17.
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
Tissue distribution and kinetic characteristics of rat steroid 5 alpha-reductase isozymes. Evidence for distinct physiological functions.
Normington K and Russell DW, J Biol Chem 1992 Sep 25;267(27):19548-54.
19.
Maternal exposure to a low dose of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) suppressed the development of reproductive organs of male rats: dose-dependent increase of mRNA levels of 5alpha-reductase type 2 in contrast to decrease of androgen receptor in the pubertal ventral prostate.
Ohsako S, etal., Toxicol Sci. 2001 Mar;60(1):132-43.
20.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
21.
Anatomical and cellular localization of neuroactive 5 alpha/3 alpha-reduced steroid-synthesizing enzymes in the spinal cord.
Patte-Mensah C, etal., J Comp Neurol. 2004 Sep 20;477(3):286-99.
22.
N-substituted 4-(4-carboxyphenoxy)benzamides. Synthesis and evaluation as inhibitors of steroid-5alpha-reductase type 1 and 2.
Picard F and Hartmann RW, J Enzyme Inhib Med Chem. 2002 Jun;17(3):187-96.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
Differential regulation of rat testicular 5alpha-reductase type 1 and 2 isoforms by testosterone and FSH.
Pratis K, etal., J Endocrinol. 2003 Mar;176(3):393-403.
25.
GOA pipeline
RGD automated data pipeline
26.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Comprehensive gene review and curation
RGD comprehensive gene curation
29.
Effects of sulpiride on mRNA levels of steroid 5alpha-reductase isozymes in prostate of adult rats.
Sanchez P, etal., IUBMB Life. 2008 Jan;60(1):68-72.
30.
Effects of dihydrotestosterone on brain mRNA levels of steroid 5alpha-reductase isozymes in early postnatal life of rat.
Sanchez P, etal., Neurochem Res. 2005 Apr;30(4):577-81.
31.
Effects of sulpiride on prolactin and mRNA levels of steroid 5alpha-reductase isozymes in adult rat brain.
Sanchez P, etal., Neurochem Res. 2008 May;33(5):820-5. Epub 2007 Oct 17.
32.
Effects of metoclopramide on mRNA levels of 5alpha-reductase isozymes in rat brain.
Sanchez P, etal., Neuroreport. 2009 Jan 7;20(1):93-6.
33.
Rat steroid 5 alpha-reductase kinetic characteristics: extreme pH-dependency of the type II isozyme in prostate and epididymis homogenates.
Span PN, etal., J Steroid Biochem Mol Biol. 1995 Aug;54(3-4):185-92.
34.
Pharmacokinetic parameters and mechanisms of inhibition of rat type 1 and 2 steroid 5alpha-reductases: determinants for different in vivo activities of GI198745 and finasteride in the rat.
Stuart JD, etal., Biochem Pharmacol 2001 Oct 1;62(7):933-42.
35.
Expression and regulation of steroid 5 alpha-reductase in the genital tubercle of the fetal rat.
Tian H and Russell DW, Dev Dyn. 1997 May;209(1):117-26.
36.
Steroid 5alpha-reductase isozymes in the adult female rat brain: central role of dihydrotestosterone.
Torres JM and Ortega E, J Mol Endocrinol. 2006 Apr;36(2):239-45.
37.
Expression of estrogen receptors and enzymes involved in sex steroid metabolism in the rat tibia during sexual maturation.
van der Eerden BC, etal., J Endocrinol. 2004 Mar;180(3):457-67.
38.
[Changes of 5 alpha-reductase type II activity in sexual gland of diabetic male rats]
Wang HJ, etal., Zhonghua Nan Ke Xue. 2003 Apr;9(2):82-4.
39.
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics
Zhou L, etal., Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 1999 Oct;16(5):311-4.
Srd5a2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 27,178,089 - 27,217,588 (+) NCBI GRCr8 mRatBN7.2 6 21,426,225 - 21,465,727 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 21,426,215 - 21,462,112 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 21,755,011 - 21,794,514 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 22,070,851 - 22,110,348 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 21,551,287 - 21,590,788 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 25,279,635 - 25,315,501 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 25,279,626 - 25,315,511 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 35,127,532 - 35,163,398 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 21,453,521 - 21,489,408 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 21,456,473 - 21,492,397 (+) NCBI Celera 6 20,976,906 - 21,012,848 (+) NCBI Celera Cytogenetic Map 6 q13 NCBI
SRD5A2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 31,522,480 - 31,663,009 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 31,522,480 - 31,580,938 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 31,747,550 - 31,806,007 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 31,603,160 - 31,659,544 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 31,661,306 - 31,717,691 NCBI Celera 2 31,590,884 - 31,647,296 (-) NCBI Celera Cytogenetic Map 2 p23.1 NCBI HuRef 2 31,485,637 - 31,542,001 (-) NCBI HuRef CHM1_1 2 31,678,089 - 31,734,473 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 31,567,195 - 31,707,768 (-) NCBI T2T-CHM13v2.0
Srd5a2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 74,321,886 - 74,354,855 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 74,323,950 - 74,354,911 (-) Ensembl GRCm39 Ensembl GRCm38 17 74,014,891 - 74,047,860 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 74,016,955 - 74,047,916 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 74,367,046 - 74,397,256 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 73,922,606 - 73,952,814 (-) NCBI MGSCv36 mm8 Celera 17 78,309,438 - 78,339,442 (-) NCBI Celera Cytogenetic Map 17 E2 NCBI cM Map 17 45.39 NCBI
Srd5a2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 10,443 - 95,743 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 12,149 - 95,733 (-) NCBI ChiLan1.0 ChiLan1.0
SRD5A2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 94,913,580 - 94,967,170 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 94,917,555 - 94,971,145 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 31,542,646 - 31,597,394 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 31,610,487 - 31,665,718 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 31,610,487 - 31,665,718 (-) Ensembl panpan1.1 panPan2
SRD5A2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 25,017,113 - 25,056,156 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 25,017,113 - 25,056,544 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 24,811,155 - 24,850,233 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 25,580,015 - 25,620,097 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 25,580,843 - 25,620,171 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 24,887,475 - 24,926,628 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 24,946,476 - 24,985,654 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 25,049,043 - 25,087,911 (-) NCBI UU_Cfam_GSD_1.0
Srd5a2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 69,130,023 - 69,175,570 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936493 1,663,911 - 1,708,502 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936493 1,663,999 - 1,708,530 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SRD5A2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 107,840,200 - 107,918,350 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 107,840,200 - 107,918,351 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 114,644,279 - 114,657,350 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SRD5A2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 75,915,495 - 75,971,280 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 75,917,260 - 75,970,365 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 36,088,943 - 36,288,753 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Srd5a2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 70 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000008983 Prediction methods: Miranda Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 8693645 Alc31 Alcohol consumption QTL 31 3.7 0.038 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 17532521 24011952 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1359023 Bp272 Blood pressure QTL 272 2.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 16536140 27261739 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat
BE120616
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 21,456,451 - 21,456,635 (-) MAPPER mRatBN7.2 Rnor_6.0 6 25,285,094 - 25,285,277 NCBI Rnor6.0 Rnor_5.0 6 35,132,991 - 35,133,174 UniSTS Rnor5.0 RGSC_v3.4 6 21,483,767 - 21,483,950 UniSTS RGSC3.4 Celera 6 21,007,206 - 21,007,389 UniSTS Cytogenetic Map 6 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
2
13
104
32
27
8
15
8
6
107
44
84
44
52
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008983 ⟹ ENSRNOP00000009254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 21,426,215 - 21,462,112 (+) Ensembl Rnor_6.0 Ensembl 6 25,279,626 - 25,315,511 (-) Ensembl
RefSeq Acc Id:
NM_022711 ⟹ NP_073202
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 27,178,089 - 27,217,588 (+) NCBI mRatBN7.2 6 21,426,225 - 21,465,727 (+) NCBI Rnor_6.0 6 25,279,635 - 25,315,501 (-) NCBI Rnor_5.0 6 35,127,532 - 35,163,398 (-) NCBI RGSC_v3.4 6 21,453,521 - 21,489,408 (+) RGD Celera 6 20,976,906 - 21,012,848 (+) NCBI
Sequence:
GAATTCCGGCTGAGGGGCGGCAGCTACCAACTGTGACCACAGGCGAGATGCAGATTGTCTGCCATCAGGTCCCGGTGCTGGCAGGTAGCGCCACATTGGCCACTATGGGGACCCTGATCCTGTGCTTA GGGAAACCCGCCAGTTACGGGAAACACACAGAGAGTGTGTCGTCGGGAGTTCCCTTCCTGCCGGCACGCATCGCCTGGTTCCTGCAGGAGTTGCCTTCCTTTGTGGTGTCGGTAGGGATGCTCGCTTG GCAGCCGCGCTCCCTCTTCGGACCGCCCGGGAATGTCCTGCTGGCTCTCTTCTCTGCACATTACTTCCACAGGACATTTATTTACTCGTTGCTCACAAGAGGGAGGCCTTTCCCAGCGGTGCTGTTTT TGAGAGCCACTGCCTTCTGCATAGGGAACGGACTCCTTCAAGCCTACTACCTGGTTTACTGCGCAGAATACCCCGAGGAGTGGTACACAGATGTGCGGTTTAGCTTTGGTGTCTTCCTGTTTATTCTG GGGATGGGAATCAACATCCACAGTGACTACACCCTGCGCCAGCTCAGGAAGCCTGGAGAAGTCATCTATAGGATTCCTCGAGGTGGCTTGTTTACGTATGTCTCTGGAGCCAATTTCCTGGGCGAGAT TATTGAATGGATTGGCTACGCCTTGGCCACGTGGTCCGTCCCAGCCTTCGCTTTCGCCTTTTTCACACTTTGTTTCCTGGGGATGCAAGCCTTTTACCACCACAGGTTCTACCTTAAGATGTTTAAGG ATTACCCCAAATCTAGGAAAGCTCTCATTCCATTCATCTTTTAAAGAACCCCAATTTTAAAGAGCAAAGTTTCTGTGGAGGAACTGCTCAGCTGCTGAAACTATAAACTGTAAACTATAACAGTGTCT TGCTCACATGTATATATGGTGATGTATGTGTTAAAAGGTCTCTTGTTATTCCAGTTGCTTGAGGCATGCAGGGTCATGCCTGCTTAGCCTATACTCCTTTCTGCCCAGGGAGCTCTAACCCAATTTCC TTTTGGAGCTTCACAGAGGCCATTTTATTCTTAGCTATACCATCTAGAAGCTTCTTGTTTCCCACGGTATGATCTGAAGAGGTAATTGTTTTCTTATTCCATGTCACTTTGGGGAAGTTCTGCAGTCA AAACCCTTTGGACTGACATAATGAATAATGAAATTATAGCAATTGCAGGAAAGTGGGTAGAACTGGAAATTATTATATTAAGCAACCTAATCCTGACTCAGAAAGACAAATACTGCATGTTTGTTTCA TGTGCAGGTTCTAGATTTTAATATATATCTAACTGTTCATATGTGTGTGTTGGGGGTCATATAGTTCATTGATTTGGAAAGGAGATCATGAGAAGAGAAAATGGGTCTTGCTGGGAGGAAAAAAAGAG GGAAATAAAATTTGTGTGGCAGAGAGAGGCTACTGCAGGAGGAAGGGGAGCATCAGGAGAAATGTAGGAGAGAAGGGGAGGAGGATTGGCAAAAATAAAGCATGTATGAAAATGTCCATAATGAAACC AATTACTTTATATGTTGGTTTTAAAAAACAACCAGCCAGCCAGTCAATAAACCATCCATCCAGGCAGTCAATCAACCAGCTGGCCAGCCAGCCAGCCGGCCAGCCAACCTACCAACCAACCAACTATC CAACCAACCAACCAACCAACCAGCCAACCAACTAACCAACCAACCAACAAATCAACCAACCAACCAAACAGCCAGCCACCAACCAACCAACCAACAAATCAACCAAGCACTCAAACACGACAACCCCG GAATTC
hide sequence
RefSeq Acc Id:
NP_073202 ⟸ NM_022711
- UniProtKB:
P31214 (UniProtKB/Swiss-Prot), A6H9Z5 (UniProtKB/TrEMBL)
- Sequence:
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCIGNGLLQAY YLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRIPRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF
hide sequence
Ensembl Acc Id:
ENSRNOP00000009254 ⟸ ENSRNOT00000008983
RGD ID: 13694426
Promoter ID: EPDNEW_R4951
Type: single initiation site
Name: Srd5a2_1
Description: steroid 5 alpha-reductase 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 25,315,501 - 25,315,561 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Srd5a2
steroid 5 alpha-reductase 2
Srd5a2
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-09-18
Srd5a2
steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Srd5a2
steroid 5-alpha-reductase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-12-14
Srd5a2
steroid 5-alpha-reductase 2
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Srd5a2
steroid 5-alpha-reductase 2
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA abundant in male reproductive tissues
729939
gene_regulation
mRNA can be induced by dihydrotestosterone
729939