Symbol:
Tdg
Name:
thymine-DNA glycosylase
RGD ID:
620959
Description:
Enables DNA-binding transcription factor binding activity and protein domain specific binding activity. Involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in PML body and plasma membrane. Predicted to be active in nucleus. Orthologous to human TDG (thymine DNA glycosylase); PARTICIPATES IN base excision repair pathway; INTERACTS WITH (+)-pilocarpine; 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
G/T mismatch-specific thymine DNA glycosylase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Tdg-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 22,965,388 - 22,990,311 (-) NCBI GRCr8 mRatBN7.2 7 21,077,853 - 21,097,617 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 21,077,853 - 21,097,567 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 23,052,578 - 23,072,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 25,215,283 - 25,234,966 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 24,992,359 - 25,012,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 27,194,000 - 27,213,676 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 27,193,998 - 27,214,236 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 27,313,355 - 27,333,031 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 23,300,450 - 23,320,095 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 23,320,723 - 23,340,366 (-) NCBI Celera 7 18,257,668 - 18,277,353 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tdg Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of TDG mRNA CTD PMID:17971868 Tdg Rat (-)-quinic acid multiple interactions ISO TDG (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Quinic Acid analog] results in increased expression of TDG mRNA CTD PMID:21751221 Tdg Rat 1,2,4-trimethylbenzene decreases expression EXP 6480464 pseudocumene results in decreased expression of TDG protein CTD PMID:17337753 Tdg Rat 1,2-dichloroethane increases expression ISO Tdg (Mus musculus) 6480464 ethylene dichloride results in increased expression of TDG mRNA CTD PMID:28960355 Tdg Rat 17alpha-ethynylestradiol affects expression ISO Tdg (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TDG mRNA CTD PMID:17555576 Tdg Rat 17alpha-ethynylestradiol multiple interactions ISO Tdg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TDG mRNA CTD PMID:17942748 Tdg Rat 17alpha-ethynylestradiol increases expression ISO Tdg (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TDG mRNA CTD PMID:17942748 Tdg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tdg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TDG mRNA CTD PMID:21570461 Tdg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TDG mRNA CTD PMID:33387578 Tdg Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tdg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TDG mRNA CTD PMID:17942748 Tdg Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TDG mRNA CTD PMID:21346803 Tdg Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TDG mRNA CTD PMID:21346803 Tdg Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of TDG mRNA CTD PMID:21061450 Tdg Rat 3,N(4)-ethenocytosine increases metabolic processing ISO TDG (Homo sapiens) 6480464 TDG protein results in increased metabolism of 3 and N(4)-ethenocytosine CTD PMID:10626224 Tdg Rat 4,4'-diaminodiphenylmethane decreases expression ISO Tdg (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TDG mRNA CTD PMID:18648102 Tdg Rat acrolein multiple interactions ISO TDG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TDG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TDG mRNA CTD PMID:32699268 Tdg Rat aflatoxin B1 decreases expression ISO Tdg (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TDG mRNA CTD PMID:19770486 Tdg Rat alpha-pinene multiple interactions ISO TDG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TDG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TDG mRNA CTD PMID:32699268 Tdg Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TDG mRNA CTD PMID:16483693 Tdg Rat arsane multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA CTD PMID:39836092 Tdg Rat arsenic atom multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA CTD PMID:39836092 Tdg Rat benzo[a]pyrene increases expression ISO TDG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TDG mRNA CTD PMID:28461126 Tdg Rat benzo[a]pyrene affects expression ISO Tdg (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of TDG mRNA CTD PMID:22641617 Tdg Rat benzo[a]pyrene diol epoxide I decreases expression ISO TDG (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tdg Rat benzo[a]pyrene diol epoxide I increases expression ISO TDG (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tdg Rat beta-lapachone increases expression ISO TDG (Homo sapiens) 6480464 beta-lapachone results in increased expression of TDG mRNA CTD PMID:38218311 Tdg Rat beta-lapachone decreases expression ISO TDG (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TDG mRNA CTD PMID:38218311 Tdg Rat bezafibrate increases expression ISO Tdg (Mus musculus) 6480464 Bezafibrate results in increased expression of TDG mRNA CTD PMID:15447978 Tdg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TDG mRNA CTD PMID:25181051 more ... Tdg Rat bisphenol A affects expression ISO TDG (Homo sapiens) 6480464 bisphenol A affects the expression of TDG mRNA CTD PMID:33670352 Tdg Rat cadmium dichloride decreases expression ISO TDG (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TDG protein CTD PMID:38185225 Tdg Rat chlorpyrifos decreases expression ISO Tdg (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TDG mRNA CTD PMID:37019170 Tdg Rat choline multiple interactions ISO Tdg (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TDG mRNA and [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TDG protein CTD PMID:25690533 Tdg Rat copper(II) sulfate increases expression ISO TDG (Homo sapiens) 6480464 Copper Sulfate results in increased expression of TDG mRNA CTD PMID:19549813 Tdg Rat CU-O LINKAGE increases expression ISO TDG (Homo sapiens) 6480464 cupric oxide results in increased expression of TDG mRNA CTD PMID:22077320 Tdg Rat dicrotophos decreases expression ISO TDG (Homo sapiens) 6480464 dicrotophos results in decreased expression of TDG mRNA CTD PMID:28302478 Tdg Rat dioxygen multiple interactions ISO Tdg (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TDG mRNA CTD PMID:30529165 Tdg Rat doxorubicin affects response to substance ISO TDG (Homo sapiens) 6480464 TDG protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Tdg Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TDG mRNA CTD PMID:24136188 Tdg Rat folic acid decreases expression ISO Tdg (Mus musculus) 6480464 Folic Acid results in decreased expression of TDG mRNA CTD PMID:25629700 Tdg Rat formaldehyde decreases expression ISO TDG (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TDG mRNA CTD PMID:20655997 Tdg Rat hydrogen peroxide affects expression ISO TDG (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TDG mRNA CTD PMID:20044591 and PMID:21179406 Tdg Rat hydrogen peroxide multiple interactions ISO TDG (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Quinic Acid analog] results in increased expression of TDG mRNA CTD PMID:21751221 Tdg Rat indometacin decreases expression ISO TDG (Homo sapiens) 6480464 Indomethacin results in decreased expression of TDG mRNA CTD PMID:16984733 Tdg Rat isoprenaline increases expression ISO Tdg (Mus musculus) 6480464 Isoproterenol results in increased expression of TDG mRNA CTD PMID:21335049 Tdg Rat L-ascorbic acid multiple interactions ISO TDG (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [sodium arsenite results in decreased expression of TDG protein] CTD PMID:33388378 Tdg Rat L-methionine multiple interactions ISO Tdg (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TDG mRNA and [Methionine deficiency co-treated with Choline deficiency] results in increased expression of TDG protein CTD PMID:25690533 Tdg Rat lead(0) affects expression ISO TDG (Homo sapiens) 6480464 Lead affects the expression of TDG mRNA CTD PMID:28903495 Tdg Rat manganese atom multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA CTD PMID:39836092 Tdg Rat manganese(0) multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA CTD PMID:39836092 Tdg Rat manganese(II) chloride multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA CTD PMID:39836092 Tdg Rat methidathion increases expression ISO Tdg (Mus musculus) 6480464 methidathion results in increased expression of TDG mRNA CTD PMID:34813904 Tdg Rat miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of TDG mRNA CTD PMID:22262564 Tdg Rat N(4)-hydroxycytidine decreases expression ISO Tdg (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of TDG mRNA CTD PMID:37748715 Tdg Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of TDG mRNA CTD PMID:24136188 Tdg Rat ochratoxin A decreases acetylation ISO TDG (Homo sapiens) 6480464 ochratoxin A results in decreased acetylation of TDG promoter CTD PMID:29098329 Tdg Rat ochratoxin A decreases expression ISO TDG (Homo sapiens) 6480464 ochratoxin A results in decreased expression of TDG mRNA CTD PMID:29098329 Tdg Rat ochratoxin A multiple interactions ISO TDG (Homo sapiens) 6480464 [ochratoxin A results in decreased acetylation of TDG promoter] which results in decreased expression of TDG mRNA CTD PMID:29098329 Tdg Rat ozone multiple interactions ISO TDG (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TDG mRNA more ... CTD PMID:32699268 Tdg Rat paclitaxel affects response to substance ISO TDG (Homo sapiens) 6480464 TDG protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Tdg Rat paracetamol decreases expression ISO TDG (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TDG mRNA CTD PMID:21420995 Tdg Rat paracetamol affects expression ISO Tdg (Mus musculus) 6480464 Acetaminophen affects the expression of TDG mRNA CTD PMID:17562736 Tdg Rat perfluorohexanesulfonic acid decreases expression ISO Tdg (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of TDG mRNA CTD PMID:37995155 Tdg Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tdg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TDG mRNA CTD PMID:36331819 Tdg Rat phenobarbital affects expression ISO TDG (Homo sapiens) 6480464 Phenobarbital affects the expression of TDG mRNA CTD PMID:19159669 Tdg Rat piroxicam decreases expression ISO TDG (Homo sapiens) 6480464 Piroxicam results in decreased expression of TDG mRNA CTD PMID:21858171 Tdg Rat resveratrol multiple interactions ISO TDG (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TDG mRNA CTD PMID:23557933 Tdg Rat sodium arsenite decreases expression ISO TDG (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TDG protein CTD PMID:33388378 Tdg Rat sodium arsenite decreases expression ISO Tdg (Mus musculus) 6480464 sodium arsenite results in decreased expression of TDG mRNA CTD PMID:25270620 and PMID:25787150 Tdg Rat sodium arsenite multiple interactions ISO TDG (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TDG mRNA more ... CTD PMID:33388378 and PMID:39836092 Tdg Rat sodium dichromate increases expression ISO Tdg (Mus musculus) 6480464 sodium bichromate results in increased expression of TDG mRNA CTD PMID:22155349 Tdg Rat tamoxifen affects expression ISO Tdg (Mus musculus) 6480464 Tamoxifen affects the expression of TDG mRNA CTD PMID:17555576 Tdg Rat temozolomide increases expression ISO TDG (Homo sapiens) 6480464 Temozolomide results in increased expression of TDG mRNA CTD PMID:31758290 Tdg Rat thalidomide decreases expression ISO Tdg (Mus musculus) 6480464 Thalidomide results in decreased expression of TDG mRNA CTD PMID:26217789 Tdg Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TDG mRNA CTD PMID:23411599 Tdg Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TDG mRNA CTD PMID:34492290 Tdg Rat thiram increases expression ISO TDG (Homo sapiens) 6480464 Thiram results in increased expression of TDG mRNA CTD PMID:38568856 Tdg Rat titanium dioxide decreases expression ISO Tdg (Mus musculus) 6480464 titanium dioxide results in decreased expression of TDG mRNA CTD PMID:29264374 Tdg Rat trimellitic anhydride increases expression ISO Tdg (Mus musculus) 6480464 trimellitic anhydride results in increased expression of TDG mRNA CTD PMID:19042947 Tdg Rat triphenyl phosphate affects expression ISO TDG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TDG mRNA CTD PMID:37042841 Tdg Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of TDG protein CTD PMID:17337753 Tdg Rat uranium atom affects expression ISO TDG (Homo sapiens) 6480464 Uranium affects the expression of TDG mRNA CTD PMID:15672453 Tdg Rat uranium atom decreases expression EXP 6480464 Uranium results in decreased expression of TDG mRNA CTD PMID:29024790 Tdg Rat valproic acid affects expression ISO Tdg (Mus musculus) 6480464 Valproic Acid affects the expression of TDG mRNA CTD PMID:17292431 Tdg Rat valproic acid decreases expression ISO TDG (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TDG mRNA CTD PMID:23179753 and PMID:27188386 Tdg Rat vincaleukoblastine affects response to substance ISO TDG (Homo sapiens) 6480464 TDG protein affects the susceptibility to Vinblastine CTD PMID:16217747 Tdg Rat vitamin E decreases expression ISO TDG (Homo sapiens) 6480464 Vitamin E results in decreased expression of TDG mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(+)-pilocarpine (EXP) (-)-quinic acid (ISO) 1,2,4-trimethylbenzene (EXP) 1,2-dichloroethane (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methoxyethanol (EXP) 3,N(4)-ethenocytosine (ISO) 4,4'-diaminodiphenylmethane (ISO) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bezafibrate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) choline (ISO) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) dicrotophos (ISO) dioxygen (ISO) doxorubicin (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoprenaline (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) miconazole (EXP) N(4)-hydroxycytidine (ISO) nefazodone (EXP) ochratoxin A (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) piroxicam (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium dichromate (ISO) tamoxifen (ISO) temozolomide (ISO) thalidomide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) undecane (EXP) uranium atom (EXP,ISO) valproic acid (ISO) vincaleukoblastine (ISO) vitamin E (ISO)
Molecular Function
ATP binding (IEA,ISO) chloride ion binding (IEA,ISO) DNA binding (IEA,ISO) DNA N-glycosylase activity (IEA,ISO) DNA-binding transcription factor binding (IPI) double-stranded DNA binding (IEA,ISO) G/U mismatch-specific uracil-DNA glycosylase activity (IEA,ISO) hydrolase activity (IEA) magnesium ion binding (IEA,ISO) mismatch base pair DNA N-glycosylase activity (IEA) mismatched DNA binding (IEA,ISO) nucleic acid binding (ISO) protein binding (ISO) protein domain specific binding (IPI) protein kinase C binding (IEA,ISO) pyrimidine-specific mismatch base pair DNA N-glycosylase activity (IBA,IEA,ISO) sodium ion binding (IEA,ISO) SUMO binding (IEA,ISO) transcription coregulator activity (IEA,ISO) uracil DNA N-glycosylase activity (IBA,IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Expression of long-patch and short-patch DNA mismatch repair proteins in the embryonic and adult mammalian brain.
Marietta C, etal., Brain Res Mol Brain Res. 1998 Jan;53(1-2):317-20.
3.
The DNA glycosylase T:G mismatch-specific thymine DNA glycosylase represses thyroid transcription factor-1-activated transcription.
Missero C, etal., J Biol Chem 2001 Sep 7;276(36):33569-75.
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
Expression of T:G mismatch-specific thymidine-DNA glycosylase and DNA methyl transferase genes during development and tumorigenesis.
Niederreither K, etal., Oncogene. 1998 Sep 24;17(12):1577-85.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Expression and activity of the DNA repair enzyme uracil DNA glycosylase during organogenesis in the rat conceptus and following methotrexate exposure in vitro.
Vinson RK and Hales BF, Biochem Pharmacol 2002 Aug 15;64(4):711-21.
10.
Thymine DNA glycosylase represses myocardin-induced smooth muscle cell differentiation by competing with serum response factor for myocardin binding.
Zhou J, etal., J Biol Chem. 2008 Dec 19;283(51):35383-92. Epub 2008 Oct 21.
Tdg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 22,965,388 - 22,990,311 (-) NCBI GRCr8 mRatBN7.2 7 21,077,853 - 21,097,617 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 21,077,853 - 21,097,567 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 23,052,578 - 23,072,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 25,215,283 - 25,234,966 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 24,992,359 - 25,012,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 27,194,000 - 27,213,676 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 27,193,998 - 27,214,236 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 27,313,355 - 27,333,031 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 23,300,450 - 23,320,095 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 23,320,723 - 23,340,366 (-) NCBI Celera 7 18,257,668 - 18,277,353 (-) NCBI Celera Cytogenetic Map 7 q13 NCBI
TDG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 103,965,872 - 103,988,874 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 103,965,822 - 103,988,874 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 104,359,650 - 104,382,652 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 102,883,747 - 102,906,786 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 102,862,083 - 102,885,122 NCBI Celera 12 104,023,344 - 104,046,415 (+) NCBI Celera Cytogenetic Map 12 q23.3 NCBI HuRef 12 101,419,052 - 101,442,123 (+) NCBI HuRef CHM1_1 12 104,325,507 - 104,348,573 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 103,927,571 - 103,950,593 (+) NCBI T2T-CHM13v2.0
Tdg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 82,465,649 - 82,486,633 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 82,465,662 - 82,486,633 (+) Ensembl GRCm39 Ensembl GRCm38 10 82,629,814 - 82,650,799 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 82,629,828 - 82,650,799 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 82,092,583 - 82,113,239 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 82,059,680 - 82,080,598 (+) NCBI MGSCv36 mm8 Celera 10 84,612,863 - 84,633,428 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Tdg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 38,673,180 - 38,678,481 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 38,661,687 - 38,680,138 (+) NCBI ChiLan1.0 ChiLan1.0
TDG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 112,030,023 - 112,053,392 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 112,026,680 - 112,049,681 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 101,543,945 - 101,567,035 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 104,938,543 - 104,961,284 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 104,938,519 - 104,961,284 (+) Ensembl panpan1.1 panPan2
TDG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 42,493,593 - 42,516,868 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 42,493,737 - 42,515,448 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 42,863,005 - 42,886,348 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 43,151,141 - 43,174,489 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 43,151,223 - 43,174,538 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 42,417,248 - 42,440,580 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 42,515,997 - 42,539,627 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 42,787,401 - 42,810,747 (+) NCBI UU_Cfam_GSD_1.0
Tdg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 17,466,063 - 17,495,748 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 10,475,183 - 10,497,151 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 10,476,472 - 10,506,144 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TDG
TDG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 99,168,051 - 99,191,168 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 99,181,608 - 99,193,591 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 145,814,432 - 145,837,331 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tdg
.
Predicted Target Of
Count of predictions: 297 Count of miRNA genes: 184 Interacting mature miRNAs: 228 Transcripts: ENSRNOT00000034213 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 2290372 Gluco33 Glucose level QTL 33 2.71 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 20555705 29891047 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat 70207 Niddm31 Non-insulin dependent diabetes mellitus QTL 31 3.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 18169505 26029351 Rat
D3Mco19
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 166,291,690 - 166,291,871 (+) Marker Load Pipeline mRatBN7.2 7 21,089,863 - 21,090,040 (+) MAPPER mRatBN7.2 mRatBN7.2 3 145,871,677 - 145,871,858 (+) MAPPER mRatBN7.2 Rnor_6.0 7 27,206,010 - 27,206,186 NCBI Rnor6.0 Rnor_6.0 3 153,327,515 - 153,327,695 NCBI Rnor6.0 Rnor_5.0 7 27,325,365 - 27,325,541 UniSTS Rnor5.0 Rnor_5.0 3 158,391,833 - 158,392,013 UniSTS Rnor5.0 RGSC_v3.4 3 147,799,021 - 147,799,201 UniSTS RGSC3.4 RGSC_v3.4 7 23,312,460 - 23,312,636 UniSTS RGSC3.4 RGSC_v3.1 3 147,704,929 - 147,705,110 RGD Celera 7 18,269,688 - 18,269,864 UniSTS Celera 3 144,577,423 - 144,577,603 UniSTS Cytogenetic Map 7 q13 UniSTS
RH129740
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 11,574,635 - 11,574,831 (+) MAPPER mRatBN7.2 mRatBN7.2 7 21,077,908 - 21,078,103 (+) MAPPER mRatBN7.2 Rnor_6.0 7 27,194,056 - 27,194,250 NCBI Rnor6.0 Rnor_6.0 19 12,453,070 - 12,453,265 NCBI Rnor6.0 Rnor_5.0 19 23,566,835 - 23,567,030 UniSTS Rnor5.0 Rnor_5.0 7 27,313,411 - 27,313,605 UniSTS Rnor5.0 RGSC_v3.4 7 23,300,506 - 23,300,700 UniSTS RGSC3.4 RGSC_v3.4 19 12,015,325 - 12,015,520 UniSTS RGSC3.4 Celera 19 11,451,608 - 11,451,803 UniSTS Celera 7 18,257,724 - 18,257,918 UniSTS Cytogenetic Map 7 q13 UniSTS
AI010217
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 21,080,764 - 21,080,977 (+) MAPPER mRatBN7.2 Rnor_6.0 7 27,196,912 - 27,197,124 NCBI Rnor6.0 Rnor_5.0 7 27,316,267 - 27,316,479 UniSTS Rnor5.0 RGSC_v3.4 7 23,303,362 - 23,303,574 UniSTS RGSC3.4 Celera 7 18,260,580 - 18,260,792 UniSTS RH 3.4 Map 7 120.6 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034213 ⟹ ENSRNOP00000037966
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 27,194,002 - 27,214,236 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076468 ⟹ ENSRNOP00000068361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 21,077,853 - 21,089,256 (-) Ensembl Rnor_6.0 Ensembl 7 27,193,998 - 27,213,704 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077041 ⟹ ENSRNOP00000067921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 21,077,853 - 21,097,567 (-) Ensembl Rnor_6.0 Ensembl 7 27,193,998 - 27,213,651 (-) Ensembl
RefSeq Acc Id:
NM_001388503 ⟹ NP_001375432
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,965,388 - 22,985,100 (-) NCBI mRatBN7.2 7 21,077,853 - 21,097,566 (-) NCBI
RefSeq Acc Id:
NM_053729 ⟹ NP_446181
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,965,388 - 22,985,100 (-) NCBI mRatBN7.2 7 21,077,853 - 21,097,566 (-) NCBI Rnor_6.0 7 27,194,000 - 27,213,676 (-) NCBI Rnor_5.0 7 27,313,355 - 27,333,031 (-) NCBI RGSC_v3.4 7 23,300,450 - 23,320,095 (-) RGD Celera 7 18,257,668 - 18,277,353 (-) RGD
Sequence:
CCACGCGTCCGGATGTAGCAGCGTGGGAGGGGCCGAGGCCAGCGCCATCCGTCCACCGGCCGCCCGGATCCTGTGCTACTCTCTGGAGCAAGTTCAAGCTCTGTATTCATTTCCATTCCAACAAATGA
hide sequence
RefSeq Acc Id:
XM_039078241 ⟹ XP_038934169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,965,388 - 22,990,311 (-) NCBI mRatBN7.2 7 21,077,853 - 21,097,574 (-) NCBI
RefSeq Acc Id:
XM_039078242 ⟹ XP_038934170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 22,965,388 - 22,985,060 (-) NCBI mRatBN7.2 7 21,077,853 - 21,097,617 (-) NCBI
RefSeq Acc Id:
NP_446181 ⟸ NM_053729
- Peptide Label:
isoform 2
- UniProtKB:
A6IFI8 (UniProtKB/TrEMBL), Q99NG8 (UniProtKB/TrEMBL)
- Sequence:
MMAEAPNMADVAGQQMPAEAPAQDPVPEAPKRRKRKTRAAEAQDPVEPKKPAASKKSGKSTKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000067921 ⟸ ENSRNOT00000077041
Ensembl Acc Id:
ENSRNOP00000037966 ⟸ ENSRNOT00000034213
Ensembl Acc Id:
ENSRNOP00000068361 ⟸ ENSRNOT00000076468
RefSeq Acc Id:
XP_038934170 ⟸ XM_039078242
- Peptide Label:
isoform X2
- UniProtKB:
A1L1J2 (UniProtKB/TrEMBL), Q99NG8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934169 ⟸ XM_039078241
- Peptide Label:
isoform X1
- UniProtKB:
A0A096MK32 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001375432 ⟸ NM_001388503
- Peptide Label:
isoform 1
- UniProtKB:
A0A096MIY3 (UniProtKB/TrEMBL), A0A096MK32 (UniProtKB/TrEMBL)
RGD ID: 13695120 Promoter ID: EPDNEW_R5638 Type: initiation region Name: Tdg_1 Description: thymine-DNA glycosylase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 27,213,692 - 27,213,752 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Tdg
thymine-DNA glycosylase
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Tdg
thymine-DNA glycosylase
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_physical_interaction
interacts with transcription factor thyroid transcription factor-1 (TTF-1)
634482
