Symbol:
Hdac7
Name:
histone deacetylase 7
RGD ID:
619982
Description:
Predicted to enable several functions, including 14-3-3 protein binding activity; protein kinase C binding activity; and transcription corepressor activity. Involved in cellular response to mechanical stimulus; neuron apoptotic process; and neuron differentiation. Predicted to be located in cytosol. Predicted to be part of histone deacetylase complex. Predicted to be active in nucleus. Orthologous to human HDAC7 (histone deacetylase 7); PARTICIPATES IN histone modification pathway; hypoxia inducible factor pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; amphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
HD7; HD7a; Hdac7a; histone deacetylase 7A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 130,803,013 - 130,841,181 (-) NCBI GRCr8 mRatBN7.2 7 128,923,918 - 128,961,926 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 128,923,920 - 128,962,072 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 139,280,396 - 139,319,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 139,281,187 - 139,318,455 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 136,501,738 - 136,523,073 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 136,593,467 - 136,597,288 (-) NCBI Celera 7 125,415,230 - 125,435,773 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hdac7 Rat (S)-nicotine increases expression ISO HDAC7 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC7 mRNA CTD PMID:24709674 Hdac7 Rat 1,2-dimethylhydrazine multiple interactions ISO Hdac7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of HDAC7 mRNA CTD PMID:22206623 Hdac7 Rat 17beta-estradiol multiple interactions ISO HDAC7 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Estradiol results in decreased expression of HDAC7 mRNA] CTD PMID:22952798 Hdac7 Rat 17beta-estradiol affects expression ISO HDAC7 (Homo sapiens) 6480464 Estradiol affects the expression of HDAC7 mRNA CTD PMID:22574217 Hdac7 Rat 17beta-estradiol decreases expression ISO HDAC7 (Homo sapiens) 6480464 Estradiol results in decreased expression of HDAC7 mRNA CTD PMID:22952798 Hdac7 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Hdac7 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Hdac7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HDAC7 mRNA CTD PMID:22493514 Hdac7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hdac7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HDAC7 mRNA CTD PMID:21570461 Hdac7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hdac7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HDAC7 mRNA CTD PMID:15667827 Hdac7 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Hdac7 (Mus musculus) 6480464 Dicarbethoxydihydrocollidine results in increased expression of HDAC7 mRNA CTD PMID:18098314 Hdac7 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HDAC7 mRNA CTD PMID:28628672 Hdac7 Rat 4,4'-sulfonyldiphenol multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HDAC7 mRNA CTD PMID:28628672 Hdac7 Rat 5-aza-2'-deoxycytidine increases expression ISO Hdac7 (Mus musculus) 6480464 Decitabine results in increased expression of HDAC7 mRNA CTD PMID:27915011 Hdac7 Rat 5-fluorouracil decreases expression ISO Hdac7 (Mus musculus) 6480464 Fluorouracil results in decreased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat acrolein multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HDAC7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HDAC7 mRNA CTD PMID:32699268 Hdac7 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HDAC7 mRNA CTD PMID:28959563 Hdac7 Rat alpha-pinene multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HDAC7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of HDAC7 mRNA CTD PMID:32699268 Hdac7 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of HDAC7 mRNA CTD PMID:30779732 Hdac7 Rat antirheumatic drug increases expression ISO HDAC7 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of HDAC7 mRNA CTD PMID:24449571 Hdac7 Rat arsenite(3-) decreases methylation ISO HDAC7 (Homo sapiens) 6480464 arsenite results in decreased methylation of HDAC7 promoter CTD PMID:23974009 Hdac7 Rat benzo[a]pyrene affects methylation ISO HDAC7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HDAC7 intron CTD PMID:30157460 Hdac7 Rat benzo[a]pyrene increases expression ISO HDAC7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HDAC7 mRNA CTD PMID:32234424 Hdac7 Rat benzylpenicillin increases expression ISO Hdac7 (Mus musculus) 6480464 Penicillin G results in increased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HDAC7 mRNA CTD PMID:25181051 Hdac7 Rat bisphenol A decreases expression ISO Hdac7 (Mus musculus) 6480464 bisphenol A results in decreased expression of HDAC7 mRNA CTD PMID:38074096 Hdac7 Rat bisphenol A increases expression ISO HDAC7 (Homo sapiens) 6480464 bisphenol A results in increased expression of HDAC7 mRNA CTD PMID:32030086 Hdac7 Rat bisphenol F decreases expression ISO Hdac7 (Mus musculus) 6480464 bisphenol F results in decreased expression of HDAC7 mRNA CTD PMID:38685157 Hdac7 Rat buta-1,3-diene decreases expression ISO Hdac7 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of HDAC7 mRNA CTD PMID:29038090 Hdac7 Rat butanal decreases expression ISO HDAC7 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of HDAC7 mRNA CTD PMID:26079696 Hdac7 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of HDAC7 mRNA CTD PMID:19167457 Hdac7 Rat cadmium atom multiple interactions ISO Hdac7 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HDAC7 mRNA CTD PMID:37325564 Hdac7 Rat cadmium dichloride increases expression ISO Hdac7 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of HDAC7 mRNA CTD PMID:18974090 Hdac7 Rat cadmium dichloride multiple interactions ISO Hdac7 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HDAC7 mRNA CTD PMID:37325564 Hdac7 Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of HDAC7 mRNA and Caffeine results in increased expression of HDAC7 protein CTD PMID:31306741 Hdac7 Rat caffeine increases phosphorylation ISO HDAC7 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of HDAC7 protein CTD PMID:35688186 Hdac7 Rat carbamazepine decreases activity ISO HDAC7 (Homo sapiens) 6480464 Carbamazepine results in decreased activity of HDAC7 protein CTD PMID:15850602 Hdac7 Rat carbon nanotube decreases expression ISO Hdac7 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Hdac7 Rat chlorpyrifos increases expression ISO Hdac7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of HDAC7 mRNA CTD PMID:37019170 Hdac7 Rat copper(II) sulfate increases expression ISO HDAC7 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of HDAC7 mRNA CTD PMID:19549813 Hdac7 Rat corticosterone multiple interactions EXP 6480464 HDAC7 protein affects the reaction [Corticosterone results in decreased expression of KLF4 mRNA] more ... CTD PMID:31306741 Hdac7 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of HDAC7 mRNA and Corticosterone results in increased expression of HDAC7 protein CTD PMID:31306741 Hdac7 Rat coumarin increases phosphorylation ISO HDAC7 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of HDAC7 protein CTD PMID:35688186 Hdac7 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of HDAC7 mRNA CTD PMID:26577399 Hdac7 Rat curcumin decreases expression ISO Hdac7 (Mus musculus) 6480464 Curcumin analog results in decreased expression of HDAC7 protein CTD PMID:29228771 Hdac7 Rat dexamethasone multiple interactions ISO Hdac7 (Mus musculus) 6480464 Mifepristone inhibits the reaction [Dexamethasone results in increased expression of HDAC7 mRNA] CTD PMID:29902490 Hdac7 Rat dexamethasone increases expression ISO Hdac7 (Mus musculus) 6480464 Dexamethasone results in increased expression of HDAC7 mRNA CTD PMID:29902490 Hdac7 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of HDAC7 mRNA and Dexamethasone results in increased expression of HDAC7 protein CTD PMID:29902490 Hdac7 Rat dexamethasone multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HDAC7 mRNA CTD PMID:28628672 Hdac7 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of HDAC7 mRNA CTD PMID:21266533 Hdac7 Rat dicrotophos increases expression ISO HDAC7 (Homo sapiens) 6480464 dicrotophos results in increased expression of HDAC7 mRNA CTD PMID:28302478 Hdac7 Rat diethylstilbestrol decreases expression ISO HDAC7 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of HDAC7 mRNA CTD PMID:32088792 Hdac7 Rat disodium selenite increases expression ISO HDAC7 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of HDAC7 mRNA CTD PMID:18175754 Hdac7 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of HDAC7 mRNA CTD PMID:28865727 Hdac7 Rat ethanol multiple interactions EXP 6480464 Ethanol promotes the reaction [HDAC3 protein binds to HDAC4 protein binds to HDAC5 protein binds to HDAC7 protein] more ... CTD PMID:23544086 Hdac7 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of HDAC7 protein CTD PMID:23544086 Hdac7 Rat folic acid multiple interactions ISO Hdac7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of HDAC7 mRNA CTD PMID:22206623 Hdac7 Rat FR900359 affects phosphorylation ISO HDAC7 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HDAC7 protein CTD PMID:37730182 Hdac7 Rat indometacin multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of HDAC7 mRNA CTD PMID:28628672 Hdac7 Rat ivermectin decreases expression ISO HDAC7 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HDAC7 protein CTD PMID:32959892 Hdac7 Rat lead diacetate increases expression ISO Hdac7 (Mus musculus) 6480464 lead acetate results in increased expression of HDAC7 mRNA CTD PMID:20542052 Hdac7 Rat lead diacetate multiple interactions ISO Hdac7 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of HDAC7 promoter CTD PMID:33445541 Hdac7 Rat lead(0) multiple interactions ISO Hdac7 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of HDAC7 promoter CTD PMID:33445541 Hdac7 Rat lithium chloride decreases expression ISO Hdac7 (Mus musculus) 6480464 Lithium Chloride results in decreased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat methamphetamine increases expression ISO Hdac7 (Mus musculus) 6480464 Methamphetamine results in increased expression of HDAC7 mRNA CTD PMID:26307267 Hdac7 Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in increased expression of HDAC7 mRNA] and Mifepristone inhibits the reaction [Corticosterone results in increased expression of HDAC7 protein] CTD PMID:31306741 Hdac7 Rat mifepristone multiple interactions ISO Hdac7 (Mus musculus) 6480464 Mifepristone inhibits the reaction [Dexamethasone results in increased expression of HDAC7 mRNA] CTD PMID:29902490 Hdac7 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of HDAC7 mRNA CTD PMID:21515302 Hdac7 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of HDAC7 mRNA CTD PMID:22546817 Hdac7 Rat nicotine increases expression ISO HDAC7 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC7 mRNA CTD PMID:24709674 Hdac7 Rat ozone multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of HDAC7 mRNA more ... CTD PMID:32699268 and PMID:35430440 Hdac7 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of HDAC7 protein CTD PMID:21777615 Hdac7 Rat pelargonidin decreases expression ISO Hdac7 (Mus musculus) 6480464 pelargonidin results in decreased expression of HDAC7 protein CTD PMID:31181187 Hdac7 Rat perfluorohexanesulfonic acid decreases expression ISO HDAC7 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of HDAC7 mRNA CTD PMID:25812627 Hdac7 Rat perfluorononanoic acid decreases expression ISO HDAC7 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of HDAC7 mRNA CTD PMID:25812627 Hdac7 Rat perfluorooctane-1-sulfonic acid decreases expression ISO HDAC7 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of HDAC7 mRNA CTD PMID:25812627 Hdac7 Rat perfluorooctanoic acid decreases expression ISO HDAC7 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of HDAC7 mRNA CTD PMID:25812627 Hdac7 Rat phenytoin increases expression ISO Hdac7 (Mus musculus) 6480464 Phenytoin results in increased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat propanal decreases expression ISO HDAC7 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of HDAC7 mRNA CTD PMID:26079696 Hdac7 Rat quercetin decreases phosphorylation ISO HDAC7 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of HDAC7 protein CTD PMID:35688186 Hdac7 Rat resveratrol multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of HDAC7 mRNA CTD PMID:23557933 Hdac7 Rat saccharin decreases expression ISO Hdac7 (Mus musculus) 6480464 Saccharin results in decreased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat sodium arsenite affects expression ISO HDAC7 (Homo sapiens) 6480464 sodium arsenite affects the expression of HDAC7 mRNA CTD PMID:22952798 Hdac7 Rat sodium arsenite multiple interactions ISO HDAC7 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Estradiol results in decreased expression of HDAC7 mRNA] CTD PMID:22952798 Hdac7 Rat sunitinib increases expression ISO HDAC7 (Homo sapiens) 6480464 Sunitinib results in increased expression of HDAC7 mRNA CTD PMID:31533062 Hdac7 Rat tauroursodeoxycholic acid multiple interactions EXP 6480464 ursodoxicoltaurine inhibits the reaction [Ethanol promotes the reaction [HDAC3 protein binds to HDAC4 protein binds to HDAC5 protein binds to HDAC7 protein]] and ursodoxicoltaurine inhibits the reaction [Ethanol results in increased expression of HDAC7 protein] CTD PMID:23544086 Hdac7 Rat tert-butyl hydroperoxide increases expression ISO Hdac7 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of HDAC7 mRNA CTD PMID:15003993 Hdac7 Rat thiram increases expression ISO HDAC7 (Homo sapiens) 6480464 Thiram results in increased expression of HDAC7 mRNA CTD PMID:38568856 Hdac7 Rat triphenyl phosphate affects expression ISO HDAC7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HDAC7 mRNA CTD PMID:37042841 Hdac7 Rat triptonide increases expression ISO Hdac7 (Mus musculus) 6480464 triptonide results in increased expression of HDAC7 mRNA CTD PMID:33045310 Hdac7 Rat tungsten decreases expression ISO Hdac7 (Mus musculus) 6480464 Tungsten results in decreased expression of HDAC7 mRNA CTD PMID:30912803 Hdac7 Rat valproic acid decreases expression ISO HDAC7 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HDAC7 mRNA and Valproic Acid results in decreased expression of HDAC7 protein CTD PMID:24200999 and PMID:29154799 Hdac7 Rat valproic acid affects expression ISO HDAC7 (Homo sapiens) 6480464 Valproic Acid affects the expression of HDAC7 mRNA CTD PMID:25979313 Hdac7 Rat valproic acid decreases expression ISO Hdac7 (Mus musculus) 6480464 Valproic Acid results in decreased expression of HDAC7 mRNA CTD PMID:26272751 Hdac7 Rat vorinostat multiple interactions ISO HDAC7 (Homo sapiens) 6480464 [vorinostat co-treated with monomethylarsonous acid] results in decreased expression of HDAC7 mRNA CTD PMID:23891734 Hdac7 Rat vorinostat decreases expression ISO HDAC7 (Homo sapiens) 6480464 vorinostat results in decreased expression of HDAC7 mRNA and vorinostat results in decreased expression of HDAC7 protein CTD PMID:18850582 and PMID:27188386
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) acrolein (ISO) acrylamide (EXP) alpha-pinene (ISO) amphetamine (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzylpenicillin (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (EXP,ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) copper(II) sulfate (ISO) corticosterone (EXP) coumarin (ISO) Cuprizon (EXP) curcumin (ISO) dexamethasone (EXP,ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) disodium selenite (ISO) doxorubicin (EXP) ethanol (EXP) folic acid (ISO) FR900359 (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) lithium chloride (ISO) methamphetamine (ISO) mifepristone (EXP,ISO) Muraglitazar (EXP) nickel dichloride (EXP) nicotine (ISO) ozone (ISO) paraquat (EXP) pelargonidin (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenytoin (ISO) propanal (ISO) quercetin (ISO) resveratrol (ISO) saccharin (ISO) sodium arsenite (ISO) sunitinib (ISO) tauroursodeoxycholic acid (EXP) tert-butyl hydroperoxide (ISO) thiram (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vorinostat (ISO)
Biological Process
B cell activation (TAS) B cell differentiation (TAS) cell-cell junction assembly (IEA,ISO) cellular response to mechanical stimulus (IEP) chromatin organization (IEA,TAS) inflammatory response (TAS) negative regulation of DNA-templated transcription (IEA,ISO,TAS) negative regulation of interleukin-2 production (IEA,ISO) negative regulation of non-canonical NF-kappaB signal transduction (IEA,ISO) negative regulation of osteoblast differentiation (IEA,ISO) negative regulation of striated muscle tissue development (TAS) negative regulation of transcription by RNA polymerase II (IEA,ISO) nervous system development (TAS) neuron apoptotic process (IEP) neuron differentiation (IEP) positive regulation of cell migration involved in sprouting angiogenesis (IEA,ISO) protein deacetylation (ISO) regulation of biosynthetic process (IEA) regulation of mRNA processing (IEA,ISO) vasculogenesis (IEA,ISO)
Molecular Function
14-3-3 protein binding (IEA,ISO,ISS) chromatin binding (IEA,ISO) DNA-binding transcription factor binding (IEA,ISO,TAS) histone deacetylase activity (IEA,ISO,ISS,TAS) histone deacetylase activity, hydrolytic mechanism (IEA) hydrolase activity (IEA) metal ion binding (IEA) protein binding (ISO) protein kinase binding (IEA,ISO) protein kinase C binding (IEA,ISO) protein lysine deacetylase activity (IEA,ISO,ISS) transcription corepressor activity (IEA,ISO)
1.
Upregulation of class II histone deacetylases mRNA during neural differentiation of cultured rat hippocampal progenitor cells.
Ajamian F, etal., Neurosci Lett 2003 Jul 31;346(1-2):57-60.
2.
Isolation of a novel histone deacetylase reveals that class I and class II deacetylases promote SMRT-mediated repression.
Kao HY, etal., Genes Dev 2000 Jan 1;14(1):55-66.
3.
Neuroprotection by histone deacetylase-7 (HDAC7) occurs by inhibition of c-jun expression through a deacetylase-independent mechanism.
Ma C and D'Mello SR, J Biol Chem. 2011 Feb 11;286(6):4819-28. doi: 10.1074/jbc.M110.146860. Epub 2010 Nov 30.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
Physical and functional HAT/HDAC interplay regulates protein acetylation balance.
Peserico A and Simone C, J Biomed Biotechnol. 2011;2011:371832. doi: 10.1155/2011/371832. Epub 2010 Dec 5.
7.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
HDAC up-regulation in early colon field carcinogenesis is involved in cell tumorigenicity through regulation of chromatin structure.
Stypula-Cyrus Y, etal., PLoS One. 2013 May 28;8(5):e64600. doi: 10.1371/journal.pone.0064600. Print 2013.
13.
Class II histone deacetylases: versatile regulators.
Verdin E, etal., Trends Genet. 2003 May;19(5):286-93.
14.
Histone deacetylases modulate vascular smooth muscle cell migration induced by cyclic mechanical strain.
Yan ZQ, etal., J Biomech. 2009 May 11;42(7):945-8. doi: 10.1016/j.jbiomech.2009.01.012. Epub 2009 Mar 3.
15.
Abnormal epigenetic modifications in peripheral blood mononuclear cells from patients with alopecia areata.
Zhao M, etal., Br J Dermatol. 2012 Feb;166(2):226-73. doi: 10.1111/j.1365-2133.2011.10646.x. Epub 2012 Jan 9.
Hdac7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 130,803,013 - 130,841,181 (-) NCBI GRCr8 mRatBN7.2 7 128,923,918 - 128,961,926 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 128,923,920 - 128,962,072 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 7 139,280,396 - 139,319,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 139,281,187 - 139,318,455 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 136,501,738 - 136,523,073 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 136,593,467 - 136,597,288 (-) NCBI Celera 7 125,415,230 - 125,435,773 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
HDAC7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 47,782,722 - 47,821,344 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 47,782,722 - 47,833,132 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 48,176,505 - 48,213,686 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 46,462,772 - 46,499,924 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 46,462,775 - 46,479,190 NCBI Celera 12 46,974,055 - 47,011,314 (-) NCBI Celera Cytogenetic Map 12 q13.11 NCBI HuRef 12 45,207,665 - 45,244,811 (-) NCBI HuRef CHM1_1 12 48,142,408 - 48,179,666 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 47,744,115 - 47,782,739 (-) NCBI T2T-CHM13v2.0
Hdac7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 97,690,542 - 97,742,383 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 97,690,545 - 97,742,383 (-) Ensembl GRCm39 Ensembl GRCm38 15 97,792,661 - 97,844,502 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 97,792,664 - 97,844,502 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 97,623,112 - 97,662,102 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 97,620,715 - 97,659,705 (-) NCBI MGSCv36 mm8 Celera 15 99,920,309 - 99,939,192 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 53.79 NCBI
Hdac7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955500 6,693,668 - 6,709,864 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955500 6,692,656 - 6,707,453 (-) NCBI ChiLan1.0 ChiLan1.0
HDAC7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 46,347,359 - 46,384,891 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 46,344,312 - 46,381,649 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 40,913,301 - 40,950,542 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 41,788,202 - 41,825,123 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 41,789,367 - 41,825,123 (+) Ensembl panpan1.1 panPan2
HDAC7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 6,941,287 - 6,968,370 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 6,929,829 - 6,979,317 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 39,338,114 - 39,375,845 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 6,998,714 - 7,036,476 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 6,997,822 - 7,036,540 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 6,935,774 - 6,973,459 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 6,971,287 - 7,008,847 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 39,626,577 - 39,664,313 (-) NCBI UU_Cfam_GSD_1.0
Hdac7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 67,447,349 - 67,482,511 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 5,682,490 - 5,697,869 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 5,680,564 - 5,701,182 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HDAC7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 78,150,561 - 78,186,072 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 78,150,554 - 78,186,051 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 81,388,011 - 81,393,534 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HDAC7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 44,002,616 - 44,040,766 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 44,003,736 - 44,039,902 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 202,340,868 - 202,378,940 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hdac7
.
Predicted Target Of
Count of predictions: 318 Count of miRNA genes: 88 Interacting mature miRNAs: 97 Transcripts: ENSRNOT00000011159, ENSRNOT00000011322, ENSRNOT00000071974, ENSRNOT00000072948 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Rat117
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 130,819,165 - 130,819,291 (+) Marker Load Pipeline mRatBN7.2 7 128,940,074 - 128,940,200 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,296,547 - 139,296,672 NCBI Rnor6.0 Rnor_5.0 7 139,488,296 - 139,488,421 UniSTS Rnor5.0 RGSC_v3.4 7 136,519,125 - 136,519,250 UniSTS RGSC3.4 RGSC_v3.4 7 136,625,917 - 136,626,043 RGD RGSC3.4 RGSC_v3.4 7 136,519,124 - 136,519,250 RGD RGSC3.4 RGSC_v3.4 7 136,625,918 - 136,626,043 UniSTS RGSC3.4 RGSC_v3.1 7 136,702,355 - 136,702,480 RGD RH 3.4 Map 7 1096.1 UniSTS RH 3.4 Map 7 1096.1 RGD RH 2.0 Map 7 778.4 RGD SHRSP x BN Map 7 86.2099 RGD Cytogenetic Map 7 q36 UniSTS
RH130958
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 128,923,707 - 128,923,900 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,280,183 - 139,280,375 NCBI Rnor6.0 Rnor_5.0 7 139,471,765 - 139,471,957 UniSTS Rnor5.0 RGSC_v3.4 7 136,500,906 - 136,501,098 UniSTS RGSC3.4 Celera 7 125,415,017 - 125,415,209 UniSTS RH 3.4 Map 7 1096.1 UniSTS Cytogenetic Map 7 q36 UniSTS
MARC_6513-6514:996689732:1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 130,806,355 - 130,807,140 (+) Marker Load Pipeline mRatBN7.2 7 128,927,261 - 128,928,046 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,283,736 - 139,284,520 NCBI Rnor6.0 Rnor_5.0 7 139,475,318 - 139,476,102 UniSTS Rnor5.0 RGSC_v3.4 7 136,504,459 - 136,505,243 UniSTS RGSC3.4 Celera 7 125,418,570 - 125,419,354 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000092029 ⟹ ENSRNOP00000073744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,923,920 - 128,962,072 (-) Ensembl Rnor_6.0 Ensembl 7 139,281,187 - 139,318,455 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094130 ⟹ ENSRNOP00000086506
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,923,920 - 128,941,801 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100053 ⟹ ENSRNOP00000096380
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,923,920 - 128,942,587 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106809 ⟹ ENSRNOP00000089609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,923,920 - 128,962,072 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118593 ⟹ ENSRNOP00000084448
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,923,920 - 128,941,801 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119709 ⟹ ENSRNOP00000080988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 128,925,137 - 128,944,545 (-) Ensembl
RefSeq Acc Id:
NM_001419534 ⟹ NP_001406463
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,017 (-) NCBI mRatBN7.2 7 128,923,918 - 128,961,926 (-) NCBI
RefSeq Acc Id:
XM_006242364 ⟹ XP_006242426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,111 (-) NCBI mRatBN7.2 7 128,923,918 - 128,943,938 (-) NCBI Rnor_6.0 7 139,280,396 - 139,301,009 (-) NCBI Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI
Sequence:
CCGCCCAGTCAGACCCTGCCCCAGTCAGACCCCGCCCCAGTCAGACCCCACCACAGTCAGGCAGGCAGCAGGTGAGTTCTGTTCCTGTTTTCAAGTCGTTCATCCCCCATATGGGCCCTGCAGGGAGG
hide sequence
RefSeq Acc Id:
XM_006242365 ⟹ XP_006242427
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,116 (-) NCBI mRatBN7.2 7 128,923,918 - 128,943,938 (-) NCBI Rnor_6.0 7 139,280,396 - 139,301,009 (-) NCBI Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI
Sequence:
CCGCCCAGTCAGACCCTGCCCCAGTCAGACCCCGCCCCAGTCAGACCCCACCACAGTCAGGCAG
hide sequence
RefSeq Acc Id:
XM_006242366 ⟹ XP_006242428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,108 (-) NCBI mRatBN7.2 7 128,923,918 - 128,943,938 (-) NCBI Rnor_6.0 7 139,280,396 - 139,301,009 (-) NCBI Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI
Sequence:
CCGCCCAGTCAGACCCTGCCCCAGTCAGACCCCGCCCCAGTCAGACCCCACCACAGTCAGGCAG
hide sequence
RefSeq Acc Id:
XM_006242367 ⟹ XP_006242429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,113 (-) NCBI mRatBN7.2 7 128,923,918 - 128,943,938 (-) NCBI Rnor_6.0 7 139,280,396 - 139,301,009 (-) NCBI Rnor_5.0 7 139,471,977 - 139,510,581 (-) NCBI
Sequence:
CCGCCCAGTCAGACCCTGCCCCAGTCAGACCCCGCCCCAGTCAGACCCCACCACAGTCAGGCAGGCAGCAGGTGAGTTCTGTTCCTGTTTTCAAGTCGTTCATCCCCCATATGGGCCCTGCAGGGAGG
hide sequence
RefSeq Acc Id:
XM_039080355 ⟹ XP_038936283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,810,808 - 130,841,157 (-) NCBI mRatBN7.2 7 128,931,714 - 128,943,938 (-) NCBI
RefSeq Acc Id:
XM_063264340 ⟹ XP_063120410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,181 (-) NCBI
RefSeq Acc Id:
XM_063264341 ⟹ XP_063120411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,106 (-) NCBI
RefSeq Acc Id:
XM_063264342 ⟹ XP_063120412
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,181 (-) NCBI
RefSeq Acc Id:
XM_063264343 ⟹ XP_063120413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,803,013 - 130,841,181 (-) NCBI
RefSeq Acc Id:
XP_006242427 ⟸ XM_006242365
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ASC9 (UniProtKB/TrEMBL)
- Sequence:
MNLIPVKLRPRPLRRKQDFPCGSDYCPPGCVLSRGDEQQQTRAQPLELILGLLPPLDSYGAVSSQRGVQEEGCPALQPDTPGSQPQPMDLRVGQRPTVEPPPEPALLTLQHPQRLHRHLFLAGLQQQQ
hide sequence
RefSeq Acc Id:
XP_006242426 ⟸ XM_006242364
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ASC9 (UniProtKB/TrEMBL)
- Sequence:
MNLIPVKLRPRPLRRKQDFPCGSDYCPPGCVLSRGDEQQQTRAQPLELILGLLPPLDSYGAVSS
hide sequence
RefSeq Acc Id:
XP_006242429 ⟸ XM_006242367
- Peptide Label:
isoform X4
- UniProtKB:
A6KC44 (UniProtKB/TrEMBL)
- Sequence:
MNLIPVKLRPRPLRRKQDFPCGSDYCPPGCVLSRGDEQQQTRAQPLELILGLLPPLDSYGAVSSQRGVQEEGCPALQPDTPGSQPQPMDLRVGQRPTVEPPPEPALLTLQHPQRLHRHLFLAGLQQQQ
hide sequence
RefSeq Acc Id:
XP_006242428 ⟸ XM_006242366
- Peptide Label:
isoform X3
- UniProtKB:
A6KC44 (UniProtKB/TrEMBL)
- Sequence:
MNLIPVKLRPRPLRRKQDFPCGSDYCPPGCVLSRGDEQQQTRAQPLELILGLLPPLDSYGAVSSQRGVQEEGCPALQPDTPGSQPQPMDLRVGQRPTVEPPPEPALLTLQHPQRLHRHLFLAGLQQQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000073744 ⟸ ENSRNOT00000092029
RefSeq Acc Id:
XP_038936283 ⟸ XM_039080355
- Peptide Label:
isoform X9
Ensembl Acc Id:
ENSRNOP00000096380 ⟸ ENSRNOT00000100053
Ensembl Acc Id:
ENSRNOP00000080988 ⟸ ENSRNOT00000119709
Ensembl Acc Id:
ENSRNOP00000086506 ⟸ ENSRNOT00000094130
Ensembl Acc Id:
ENSRNOP00000084448 ⟸ ENSRNOT00000118593
Ensembl Acc Id:
ENSRNOP00000089609 ⟸ ENSRNOT00000106809
RefSeq Acc Id:
NP_001406463 ⟸ NM_001419534
- UniProtKB:
A0A0G2K6B1 (UniProtKB/TrEMBL), A0A8I6ASC9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120413 ⟸ XM_063264343
- Peptide Label:
isoform X8
- UniProtKB:
A6KC44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120412 ⟸ XM_063264342
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6ACZ5 (UniProtKB/TrEMBL), A6KC44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120410 ⟸ XM_063264340
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6ASC9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120411 ⟸ XM_063264341
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6ASC9 (UniProtKB/TrEMBL)
RGD ID: 13695631 Promoter ID: EPDNEW_R6142 Type: initiation region Name: Hdac7_1 Description: histone deacetylase 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 139,318,400 - 139,318,460 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-04-14
Hdac7
histone deacetylase 7
Hdac7a
histone deacetylase 7A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Hdac7a
histone deacetylase 7A
histone deacetylase 7
Name updated
1299863 APPROVED
2004-09-10
Hdac7a
histone deacetylase 7
Hdac7
Symbol and Name updated
1299863 APPROVED
2002-08-07
Hdac7
histone deacetylase 7
Symbol and Name status set to provisional
70820 PROVISIONAL
