Symbol:
Pfkp
Name:
phosphofructokinase, platelet
RGD ID:
61893
Description:
Enables 6-phosphofructokinase activity; anion binding activity; and identical protein binding activity. Involved in fructose 1,6-bisphosphate metabolic process; fructose 6-phosphate metabolic process; and glycolytic process. Predicted to be located in cytosol. Predicted to be part of 6-phosphofructokinase complex. Predicted to be active in membrane. Orthologous to human PFKP (phosphofructokinase, platelet); PARTICIPATES IN fructose and mannose metabolic pathway; galactose metabolic pathway; gluconeogenesis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
6-phosphofructo-1-kinase, C-type; 6-phosphofructokinase type C; ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; MGC105718; PFK-C; PFK-P; pfkc; phosphofructo-1-kinase isozyme C; phosphofructokinase 1; phosphofructokinase C-type subunit; phosphohexokinase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PFKP (phosphofructokinase, platelet) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pfkp (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pfkp (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PFKP (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PFKP (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pfkp (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PFKP (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PFKP (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pfkp (phosphofructokinase, platelet) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pfkp (phosphofructokinase, platelet)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PFKP (phosphofructokinase, platelet)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pfkpb (phosphofructokinase, platelet b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pfkpa (phosphofructokinase, platelet a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PFK1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pfk
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfk-1.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pfk-1.2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
pfkp
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 68,639,749 - 68,704,055 (+) NCBI GRCr8 mRatBN7.2 17 63,729,743 - 63,794,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 63,729,780 - 63,794,018 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 67,232,016 - 67,296,305 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 71,060,799 - 71,125,092 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 65,083,081 - 65,147,319 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 68,510,765 - 68,574,387 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 68,511,064 - 68,559,471 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 70,227,547 - 70,290,384 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 74,760,912 - 74,823,046 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 74,771,768 - 74,833,862 (+) NCBI Celera 17 63,327,855 - 63,392,034 (+) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pfkp Rat (2,4,5-trichlorophenoxy)acetic acid decreases expression ISO Pfkp (Mus musculus) 6480464 2 more ... CTD PMID:18579281 Pfkp Rat 1,1-dichloroethene increases expression ISO Pfkp (Mus musculus) 6480464 vinylidene chloride results in increased expression of PFKP mRNA CTD PMID:26682919 Pfkp Rat 1,2-dichloroethane decreases expression ISO Pfkp (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PFKP mRNA CTD PMID:28960355 Pfkp Rat 1,2-dimethylhydrazine affects expression ISO Pfkp (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of PFKP mRNA CTD PMID:22206623 Pfkp Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PFKP mRNA CTD PMID:25380136 Pfkp Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PFKP mRNA CTD PMID:12075121 Pfkp Rat 17beta-estradiol increases expression ISO PFKP (Homo sapiens) 6480464 Estradiol results in increased expression of PFKP mRNA CTD PMID:31614463 Pfkp Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pfkp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pfkp Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pfkp (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pfkp Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PFKP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pfkp Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pfkp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pfkp (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PFKP gene] CTD PMID:20819909 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PFKP (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of PFKP mRNA and [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of PFKP protein CTD PMID:26159488 and PMID:36753968 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PFKP mRNA CTD PMID:20959002 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PFKP (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PFKP mRNA and Tetrachlorodibenzodioxin results in increased expression of PFKP protein CTD PMID:20106945 more ... Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pfkp (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PFKP mRNA CTD PMID:21570461 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pfkp (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PFKP mRNA CTD PMID:19770486 Pfkp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pfkp (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PFKP mRNA CTD PMID:20819909 Pfkp Rat 2,4,6-tribromophenol decreases expression ISO PFKP (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pfkp Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pfkp (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pfkp Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO Pfkp (Mus musculus) 6480464 Glucosamine results in increased expression of PFKP mRNA CTD PMID:17178593 Pfkp Rat 2-hydroxypropanoic acid decreases expression ISO PFKP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PFKP mRNA CTD PMID:30851411 Pfkp Rat 2-methylcholine affects expression ISO PFKP (Homo sapiens) 6480464 beta-methylcholine affects the expression of PFKP mRNA CTD PMID:21179406 Pfkp Rat 3,3',5-triiodo-L-thyronine increases expression ISO PFKP (Homo sapiens) 6480464 Triiodothyronine results in increased expression of PFKP mRNA CTD PMID:15507505 Pfkp Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PFKP mRNA CTD PMID:28087314 Pfkp Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of PFKP mRNA CTD PMID:28522335 Pfkp Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PFKP protein CTD PMID:34915118 Pfkp Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PFKP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFKP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PFKP mRNA CTD PMID:28628672 Pfkp Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PFKP mRNA CTD PMID:25380136 Pfkp Rat 4,4'-sulfonyldiphenol increases expression ISO PFKP (Homo sapiens) 6480464 bisphenol S results in increased expression of PFKP protein CTD PMID:34186270 Pfkp Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKP mRNA CTD PMID:36041667 Pfkp Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PFKP mRNA CTD PMID:30047161 Pfkp Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PFKP mRNA CTD PMID:31881176 Pfkp Rat acrylamide decreases expression ISO PFKP (Homo sapiens) 6480464 Acrylamide results in decreased expression of PFKP mRNA CTD PMID:32763439 Pfkp Rat actinomycin D multiple interactions ISO PFKP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PFKP protein CTD PMID:38460933 Pfkp Rat aflatoxin B1 affects expression ISO PFKP (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PFKP protein CTD PMID:20106945 Pfkp Rat aflatoxin B1 increases methylation ISO PFKP (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PFKP intron CTD PMID:30157460 Pfkp Rat aflatoxin B1 increases expression ISO PFKP (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PFKP mRNA CTD PMID:22100608 more ... Pfkp Rat aflatoxin B1 decreases expression ISO Pfkp (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of PFKP mRNA CTD PMID:19770486 Pfkp Rat aldehydo-D-glucosamine increases expression ISO Pfkp (Mus musculus) 6480464 Glucosamine results in increased expression of PFKP mRNA CTD PMID:17178593 Pfkp Rat aldrin decreases expression ISO Pfkp (Mus musculus) 6480464 Aldrin results in decreased expression of PFKP mRNA CTD PMID:18579281 Pfkp Rat all-trans-retinoic acid decreases expression ISO Pfkp (Mus musculus) 6480464 Tretinoin results in decreased expression of PFKP mRNA CTD PMID:16604517 Pfkp Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PFKP mRNA CTD PMID:30047161 Pfkp Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PFKP mRNA CTD PMID:16483693 Pfkp Rat antimycin A increases expression ISO PFKP (Homo sapiens) 6480464 Antimycin A results in increased expression of PFKP mRNA CTD PMID:34642769 Pfkp Rat aristolochic acids increases expression EXP 6480464 Aristolochic Acids results in increased expression of PFKP mRNA CTD PMID:19717638 Pfkp Rat Aroclor 1254 decreases expression ISO Pfkp (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PFKP mRNA CTD PMID:23650126 Pfkp Rat arsane multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat arsenic atom multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat arsenous acid decreases expression ISO PFKP (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PFKP protein CTD PMID:25419056 Pfkp Rat Azaspiracid increases expression ISO PFKP (Homo sapiens) 6480464 azaspiracid results in increased expression of PFKP mRNA CTD PMID:28939011 Pfkp Rat benzo[a]pyrene increases expression ISO PFKP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PFKP mRNA CTD PMID:20106945 and PMID:32234424 Pfkp Rat benzo[a]pyrene increases methylation ISO PFKP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PFKP promoter CTD PMID:27901495 Pfkp Rat benzo[a]pyrene decreases expression ISO Pfkp (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PFKP mRNA CTD PMID:19770486 Pfkp Rat beta-D-glucosamine increases expression ISO Pfkp (Mus musculus) 6480464 Glucosamine results in increased expression of PFKP mRNA CTD PMID:17178593 Pfkp Rat bis(2-ethylhexyl) phthalate increases expression ISO PFKP (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PFKP mRNA CTD PMID:31163220 Pfkp Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat bisphenol A decreases expression ISO PFKP (Homo sapiens) 6480464 bisphenol A results in decreased expression of PFKP mRNA and bisphenol A results in decreased expression of PFKP protein CTD PMID:25047013 and PMID:31675489 Pfkp Rat bisphenol A multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat bisphenol A increases expression ISO PFKP (Homo sapiens) 6480464 bisphenol A results in increased expression of PFKP protein CTD PMID:37567409 Pfkp Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKP mRNA CTD PMID:36041667 Pfkp Rat bisphenol A multiple interactions ISO PFKP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFKP mRNA CTD PMID:28628672 Pfkp Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PFKP mRNA CTD PMID:30816183 Pfkp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PFKP mRNA CTD PMID:12075121 more ... Pfkp Rat bisphenol AF increases expression ISO PFKP (Homo sapiens) 6480464 bisphenol AF results in increased expression of PFKP protein CTD PMID:34186270 Pfkp Rat bisphenol F multiple interactions ISO PFKP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PFKP mRNA CTD PMID:28628672 Pfkp Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PFKP mRNA CTD PMID:36041667 Pfkp Rat butan-1-ol multiple interactions ISO PFKP (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PFKP mRNA CTD PMID:29432896 Pfkp Rat Butylbenzyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat butyric acid multiple interactions ISO Pfkp (Mus musculus) 6480464 Butyric Acid inhibits the reaction [[Permethrin co-treated with Pyridostigmine Bromide co-treated with Corticosterone] results in increased expression of PFKP mRNA] CTD PMID:29751049 Pfkp Rat cadmium acetate multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PFKP mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PFKP mRNA] CTD PMID:33404196 Pfkp Rat cadmium atom multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PFKP mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PFKP mRNA] CTD PMID:33404196 Pfkp Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PFKP mRNA CTD PMID:33453195 Pfkp Rat cadmium sulfate increases expression ISO Pfkp (Mus musculus) 6480464 cadmium sulfate results in increased expression of PFKP mRNA CTD PMID:19274763 Pfkp Rat caffeine decreases phosphorylation ISO PFKP (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PFKP protein CTD PMID:35688186 Pfkp Rat chloroethene decreases expression ISO Pfkp (Mus musculus) 6480464 Vinyl Chloride results in decreased expression of PFKP mRNA CTD PMID:18579281 Pfkp Rat chloropicrin increases expression ISO PFKP (Homo sapiens) 6480464 chloropicrin results in increased expression of PFKP mRNA CTD PMID:26352163 Pfkp Rat chlorpyrifos increases expression ISO Pfkp (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PFKP mRNA CTD PMID:32715474 Pfkp Rat choline multiple interactions ISO Pfkp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PFKP mRNA CTD PMID:20938992 Pfkp Rat cisplatin affects response to substance ISO PFKP (Homo sapiens) 6480464 PFKP protein affects the susceptibility to Cisplatin CTD PMID:16217747 Pfkp Rat clofibrate increases expression ISO Pfkp (Mus musculus) 6480464 Clofibrate results in increased expression of PFKP mRNA CTD PMID:17585979 Pfkp Rat clotrimazole affects localization ISO Pfkp (Mus musculus) 6480464 Clotrimazole affects the localization of PFKP protein CTD PMID:12126931 Pfkp Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of PFKP mRNA CTD PMID:15860345 Pfkp Rat copper atom multiple interactions ISO Pfkp (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of PFKP mRNA CTD PMID:15467011 Pfkp Rat copper(0) multiple interactions ISO Pfkp (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of PFKP mRNA CTD PMID:15467011 Pfkp Rat copper(II) chloride increases expression ISO PFKP (Homo sapiens) 6480464 cupric chloride results in increased expression of PFKP mRNA CTD PMID:34921933 Pfkp Rat copper(II) sulfate increases expression ISO PFKP (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PFKP mRNA CTD PMID:19549813 Pfkp Rat copper(II) sulfate decreases expression ISO Pfkp (Mus musculus) 6480464 Copper Sulfate results in decreased expression of PFKP mRNA CTD PMID:18579281 Pfkp Rat corticosterone multiple interactions ISO Pfkp (Mus musculus) 6480464 [Permethrin co-treated with Pyridostigmine Bromide co-treated with Corticosterone] results in increased expression of PFKP mRNA more ... CTD PMID:29751049 Pfkp Rat Cuprizon multiple interactions ISO PFKP (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of PFKP protein CTD PMID:34122009 Pfkp Rat cyclosporin A increases expression ISO PFKP (Homo sapiens) 6480464 Cyclosporine results in increased expression of PFKP mRNA CTD PMID:20106945 and PMID:25562108 Pfkp Rat cytarabine decreases expression ISO PFKP (Homo sapiens) 6480464 Cytarabine results in decreased expression of PFKP mRNA CTD PMID:21198554 Pfkp Rat deguelin increases expression ISO PFKP (Homo sapiens) 6480464 deguelin results in increased expression of PFKP mRNA CTD PMID:34642769 Pfkp Rat dexamethasone multiple interactions ISO PFKP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFKP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PFKP mRNA CTD PMID:28628672 Pfkp Rat Di-n-octyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat diarsenic trioxide decreases expression ISO PFKP (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PFKP protein CTD PMID:25419056 Pfkp Rat diazinon increases methylation ISO PFKP (Homo sapiens) 6480464 Diazinon results in increased methylation of PFKP gene CTD PMID:22964155 Pfkp Rat dibutyl phthalate increases expression ISO Pfkp (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PFKP mRNA CTD PMID:21266533 Pfkp Rat dibutyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PFKP mRNA CTD PMID:17379624 and PMID:21266533 Pfkp Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PFKP mRNA CTD PMID:21266533 Pfkp Rat diethyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat Diisodecyl phthalate increases expression ISO Pfkp (Mus musculus) 6480464 diisodecyl phthalate results in increased expression of PFKP mRNA CTD PMID:25270620 Pfkp Rat Diisodecyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat diisononyl phthalate multiple interactions ISO Pfkp (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PFKP mRNA CTD PMID:37364641 Pfkp Rat dioxygen increases expression ISO PFKP (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PFKP mRNA CTD PMID:20042640 Pfkp Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of PFKP mRNA CTD PMID:33729688 Pfkp Rat dioxygen increases expression ISO Pfkp (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PFKP mRNA CTD PMID:20880076 Pfkp Rat dioxygen affects expression ISO Pfkp (Mus musculus) 6480464 Oxygen deficiency affects the expression of PFKP mRNA CTD PMID:17193925 Pfkp Rat dorsomorphin multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pfkp Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of PFKP mRNA CTD PMID:19915844 Pfkp Rat doxorubicin increases expression ISO PFKP (Homo sapiens) 6480464 Doxorubicin results in increased expression of PFKP mRNA CTD PMID:29803840 Pfkp Rat doxorubicin multiple interactions EXP 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of PFKP mRNA] CTD PMID:19915844 Pfkp Rat duvoglustat multiple interactions ISO Pfkp (Mus musculus) 6480464 [1-Deoxynojirimycin co-treated with Polysaccharides] inhibits the reaction [[Dietary Fats co-treated with Streptozocin] results in decreased expression of PFKP protein] CTD PMID:25446853 Pfkp Rat endosulfan multiple interactions ISO PFKP (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of PFKP mRNA and [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in increased expression of PFKP protein CTD PMID:26159488 and PMID:36753968 Pfkp Rat endosulfan increases expression ISO PFKP (Homo sapiens) 6480464 Endosulfan results in increased expression of PFKP protein CTD PMID:36753968 Pfkp Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PFKP mRNA CTD PMID:29391264 Pfkp Rat entinostat increases expression ISO PFKP (Homo sapiens) 6480464 entinostat results in increased expression of PFKP mRNA CTD PMID:26272509 and PMID:27188386 Pfkp Rat entinostat multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat ethanol affects splicing ISO Pfkp (Mus musculus) 6480464 Ethanol affects the splicing of PFKP mRNA CTD PMID:30319688 Pfkp Rat ethyl methanesulfonate decreases expression ISO PFKP (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PFKP mRNA CTD PMID:23649840 Pfkp Rat fenpyroximate increases expression ISO PFKP (Homo sapiens) 6480464 fenpyroximate results in increased expression of PFKP mRNA CTD PMID:34642769 Pfkp Rat folic acid multiple interactions ISO Pfkp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PFKP mRNA CTD PMID:20938992 Pfkp Rat formaldehyde decreases expression ISO PFKP (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PFKP mRNA CTD PMID:23649840 Pfkp Rat FR900359 increases phosphorylation ISO PFKP (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PFKP protein CTD PMID:37730182 Pfkp Rat fulvestrant increases methylation ISO PFKP (Homo sapiens) 6480464 Fulvestrant results in increased methylation of PFKP gene CTD PMID:31601247 Pfkp Rat furfural multiple interactions ISO PFKP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PFKP protein CTD PMID:38598786 Pfkp Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PFKP mRNA CTD PMID:12075121 Pfkp Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PFKP mRNA CTD PMID:22061828 and PMID:33387578 Pfkp Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of PFKP mRNA CTD PMID:15860345 Pfkp Rat haloperidol multiple interactions ISO PFKP (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of PFKP protein CTD PMID:34122009 Pfkp Rat hydrogen sulfide decreases expression ISO Pfkp (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of PFKP protein CTD PMID:29932956 Pfkp Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of PFKP mRNA CTD PMID:21396975 Pfkp Rat indometacin multiple interactions ISO PFKP (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFKP mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PFKP mRNA CTD PMID:28628672 Pfkp Rat inulin multiple interactions ISO Pfkp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PFKP mRNA CTD PMID:36331819 Pfkp Rat ivermectin decreases expression ISO PFKP (Homo sapiens) 6480464 Ivermectin results in decreased expression of PFKP protein CTD PMID:32959892 Pfkp Rat josamycin decreases response to substance ISO PFKP (Homo sapiens) 6480464 PFKP protein results in decreased susceptibility to Josamycin CTD PMID:31915244 Pfkp Rat L-methionine multiple interactions ISO Pfkp (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PFKP mRNA CTD PMID:20938992 Pfkp Rat lipopolysaccharide multiple interactions ISO PFKP (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PFKP mRNA CTD PMID:35877022 Pfkp Rat manganese atom multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat manganese(0) multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat manganese(II) chloride multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat menadione decreases expression ISO Pfkp (Mus musculus) 6480464 Vitamin K 3 results in decreased expression of PFKP mRNA CTD PMID:25270620 Pfkp Rat mercury dibromide increases expression ISO PFKP (Homo sapiens) 6480464 mercuric bromide results in increased expression of PFKP mRNA CTD PMID:26272509 Pfkp Rat mercury dibromide multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of PFKP protein CTD PMID:37182599 Pfkp Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PFKP mRNA CTD PMID:30047161 Pfkp Rat methyl methanesulfonate decreases expression ISO PFKP (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PFKP mRNA CTD PMID:23649840 Pfkp Rat methylmercury chloride decreases expression ISO PFKP (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PFKP mRNA CTD PMID:23179753 and PMID:27188386 Pfkp Rat methylmercury chloride increases expression ISO PFKP (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PFKP mRNA CTD PMID:28001369 Pfkp Rat mithramycin decreases expression ISO Pfkp (Mus musculus) 6480464 Plicamycin results in decreased expression of PFKP mRNA CTD PMID:34087332 Pfkp Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Pfkp (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PFKP mRNA] CTD PMID:25566086 Pfkp Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Pfkp (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PFKP mRNA CTD PMID:25566086 Pfkp Rat N-methyl-4-phenylpyridinium multiple interactions ISO Pfkp (Mus musculus) 6480464 [IL4 protein co-treated with 1-Methyl-4-phenylpyridinium] results in increased expression of PFKP mRNA CTD PMID:32606391 Pfkp Rat N-methyl-N-nitrosourea decreases expression ISO Pfkp (Mus musculus) 6480464 Methylnitrosourea results in decreased expression of PFKP mRNA CTD PMID:25270620 Pfkp Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PFKP mRNA CTD PMID:20360939 Pfkp Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PFKP mRNA CTD PMID:25380136 Pfkp Rat N-Nitrosopyrrolidine increases expression ISO PFKP (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of PFKP mRNA CTD PMID:32234424 Pfkp Rat nickel atom increases expression ISO PFKP (Homo sapiens) 6480464 Nickel results in increased expression of PFKP mRNA CTD PMID:24768652 and PMID:25583101 Pfkp Rat Nutlin-3 multiple interactions ISO PFKP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PFKP protein CTD PMID:38460933 Pfkp Rat O-methyleugenol increases expression ISO PFKP (Homo sapiens) 6480464 methyleugenol results in increased expression of PFKP mRNA CTD PMID:32234424 Pfkp Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of PFKP mRNA CTD PMID:19717638 Pfkp Rat ochratoxin A increases expression ISO PFKP (Homo sapiens) 6480464 ochratoxin A results in increased expression of PFKP protein CTD PMID:32835834 Pfkp Rat oxaliplatin decreases expression ISO PFKP (Homo sapiens) 6480464 oxaliplatin results in decreased expression of PFKP mRNA CTD PMID:17762391 Pfkp Rat panobinostat increases expression ISO PFKP (Homo sapiens) 6480464 panobinostat results in increased expression of PFKP mRNA CTD PMID:26272509 Pfkp Rat panobinostat multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat paracetamol affects expression ISO Pfkp (Mus musculus) 6480464 Acetaminophen affects the expression of PFKP mRNA CTD PMID:17562736 Pfkp Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PFKP mRNA CTD PMID:15084756 and PMID:33387578 Pfkp Rat paraquat decreases expression ISO Pfkp (Mus musculus) 6480464 Paraquat results in decreased expression of PFKP mRNA CTD PMID:21371552 Pfkp Rat PCB138 multiple interactions ISO Pfkp (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Pfkp Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pfkp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PFKP mRNA CTD PMID:36331819 Pfkp Rat permethrin multiple interactions ISO Pfkp (Mus musculus) 6480464 [Permethrin co-treated with Pyridostigmine Bromide co-treated with Corticosterone] results in increased expression of PFKP mRNA more ... CTD PMID:29751049 Pfkp Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PFKP mRNA CTD PMID:20360939 Pfkp Rat phenylmercury acetate increases expression ISO PFKP (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PFKP mRNA CTD PMID:26272509 Pfkp Rat phenylmercury acetate multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of PFKP mRNA CTD PMID:15170462 Pfkp Rat pirinixic acid decreases expression ISO Pfkp (Mus musculus) 6480464 pirinixic acid results in decreased expression of PFKP mRNA CTD PMID:17426115 Pfkp Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PFKP mRNA CTD PMID:19162173 Pfkp Rat pirinixic acid increases expression ISO Pfkp (Mus musculus) 6480464 pirinixic acid results in increased expression of PFKP mRNA CTD PMID:20813756 Pfkp Rat puerarin multiple interactions EXP 6480464 puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PFKP mRNA] CTD PMID:33404196 Pfkp Rat Pyridostigmine bromide multiple interactions ISO Pfkp (Mus musculus) 6480464 [Permethrin co-treated with Pyridostigmine Bromide co-treated with Corticosterone] results in increased expression of PFKP mRNA more ... CTD PMID:29751049 Pfkp Rat pyrimidifen increases expression ISO PFKP (Homo sapiens) 6480464 pyrimidifen results in increased expression of PFKP mRNA CTD PMID:34642769 Pfkp Rat quercetin increases expression ISO PFKP (Homo sapiens) 6480464 Quercetin results in increased expression of PFKP mRNA CTD PMID:19729006 and PMID:21632981 Pfkp Rat rac-lactic acid decreases expression ISO PFKP (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PFKP mRNA CTD PMID:30851411 Pfkp Rat razoxane multiple interactions EXP 6480464 Razoxane inhibits the reaction [Doxorubicin results in increased expression of PFKP mRNA] CTD PMID:19915844 Pfkp Rat resveratrol increases expression ISO Pfkp (Mus musculus) 6480464 resveratrol results in increased expression of PFKP protein CTD PMID:25505154 Pfkp Rat rotenone increases expression ISO PFKP (Homo sapiens) 6480464 Rotenone results in increased expression of PFKP mRNA CTD PMID:29955902 and PMID:34642769 Pfkp Rat rotenone multiple interactions ISO Pfkp (Mus musculus) 6480464 Rotenone inhibits the reaction [[lipopolysaccharide and E. coli O26-B6 co-treated with IFNG protein] results in increased expression of PFKP mRNA] CTD PMID:30686998 Pfkp Rat sarin decreases expression ISO PFKP (Homo sapiens) 6480464 Sarin results in decreased expression of PFKP mRNA CTD PMID:19522546 Pfkp Rat SB 431542 multiple interactions ISO PFKP (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Pfkp Rat scoparone decreases expression ISO PFKP (Homo sapiens) 6480464 scoparone results in decreased expression of PFKP mRNA CTD PMID:37449671 Pfkp Rat silicon dioxide increases expression ISO PFKP (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PFKP mRNA CTD PMID:25895662 Pfkp Rat sodium arsenite multiple interactions ISO PFKP (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of PFKP mRNA CTD PMID:39836092 Pfkp Rat sodium chloride multiple interactions ISO PFKP (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PFKP protein CTD PMID:38598786 Pfkp Rat sodium fluoride increases expression ISO Pfkp (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PFKP protein CTD PMID:28918527 Pfkp Rat streptozocin multiple interactions ISO Pfkp (Mus musculus) 6480464 [1-Deoxynojirimycin co-treated with Polysaccharides] inhibits the reaction [[Dietary Fats co-treated with Streptozocin] results in decreased expression of PFKP protein] and [Dietary Fats co-treated with Streptozocin] results in decreased expression of PFKP protein CTD PMID:25446853 Pfkp Rat sunitinib increases expression ISO PFKP (Homo sapiens) 6480464 Sunitinib results in increased expression of PFKP mRNA CTD PMID:31533062 Pfkp Rat tebufenpyrad increases expression ISO PFKP (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of PFKP mRNA CTD PMID:34642769 Pfkp Rat tert-butyl hydroperoxide increases expression ISO Pfkp (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of PFKP mRNA CTD PMID:15003993 Pfkp Rat tetrachloroethene increases expression ISO Pfkp (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of PFKP mRNA CTD PMID:28973375 Pfkp Rat tetrachloromethane affects expression ISO Pfkp (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PFKP mRNA CTD PMID:17484886 Pfkp Rat thapsigargin decreases expression ISO PFKP (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PFKP mRNA CTD PMID:22378314 Pfkp Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PFKP protein CTD PMID:35544339 Pfkp Rat thimerosal decreases expression ISO PFKP (Homo sapiens) 6480464 Thimerosal results in decreased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PFKP mRNA CTD PMID:34492290 Pfkp Rat titanium dioxide increases methylation ISO Pfkp (Mus musculus) 6480464 titanium dioxide results in increased methylation of PFKP promoter CTD PMID:35295148 Pfkp Rat trichostatin A increases expression ISO PFKP (Homo sapiens) 6480464 trichostatin A results in increased expression of PFKP mRNA CTD PMID:24935251 and PMID:26272509 Pfkp Rat trichostatin A multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat trimellitic anhydride increases expression ISO Pfkp (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PFKP mRNA CTD PMID:19042947 Pfkp Rat triphenyl phosphate affects expression ISO PFKP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PFKP mRNA CTD PMID:37042841 Pfkp Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PFKP protein CTD PMID:32519852 Pfkp Rat Triptolide decreases expression ISO Pfkp (Mus musculus) 6480464 triptolide results in decreased expression of PFKP mRNA more ... CTD PMID:34087332 Pfkp Rat tris(2-butoxyethyl) phosphate affects expression ISO PFKP (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of PFKP mRNA CTD PMID:29024780 Pfkp Rat tunicamycin decreases expression ISO PFKP (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PFKP mRNA CTD PMID:22378314 Pfkp Rat valproic acid increases expression ISO Pfkp (Mus musculus) 6480464 Valproic Acid results in increased expression of PFKP mRNA CTD PMID:19136453 more ... Pfkp Rat valproic acid multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat valproic acid increases expression ISO PFKP (Homo sapiens) 6480464 Valproic Acid results in increased expression of PFKP mRNA CTD PMID:23179753 more ... Pfkp Rat valproic acid increases methylation ISO PFKP (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PFKP gene CTD PMID:29154799 Pfkp Rat valproic acid affects expression ISO PFKP (Homo sapiens) 6480464 Valproic Acid affects the expression of PFKP mRNA CTD PMID:25979313 Pfkp Rat vanadium atom decreases expression ISO PFKP (Homo sapiens) 6480464 Vanadium results in decreased expression of PFKP mRNA CTD PMID:19000753 Pfkp Rat vanadium(0) decreases expression ISO PFKP (Homo sapiens) 6480464 Vanadium results in decreased expression of PFKP mRNA CTD PMID:19000753 Pfkp Rat vitamin E increases expression ISO PFKP (Homo sapiens) 6480464 Vitamin E results in increased expression of PFKP mRNA CTD PMID:19244175 Pfkp Rat vorinostat multiple interactions ISO PFKP (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PFKP mRNA CTD PMID:27188386 Pfkp Rat vorinostat increases expression ISO PFKP (Homo sapiens) 6480464 vorinostat results in increased expression of PFKP mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
(2,4,5-trichlorophenoxy)acetic acid (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucosamine (ISO) aldrin (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) antimycin A (ISO) aristolochic acids (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) Azaspiracid (ISO) benzo[a]pyrene (ISO) beta-D-glucosamine (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) butan-1-ol (ISO) Butylbenzyl phthalate (ISO) butyric acid (ISO) cadmium acetate (EXP) cadmium atom (EXP) cadmium dichloride (EXP) cadmium sulfate (ISO) caffeine (ISO) chloroethene (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) clotrimazole (ISO) clozapine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corticosterone (ISO) Cuprizon (ISO) cyclosporin A (ISO) cytarabine (ISO) deguelin (ISO) dexamethasone (ISO) Di-n-octyl phthalate (ISO) diarsenic trioxide (ISO) diazinon (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) duvoglustat (ISO) endosulfan (EXP,ISO) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenpyroximate (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) genistein (EXP) gentamycin (EXP) haloperidol (EXP,ISO) hydrogen sulfide (ISO) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) ivermectin (ISO) josamycin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) Mesaconitine (EXP) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mithramycin (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) Nutlin-3 (ISO) O-methyleugenol (ISO) ochratoxin A (EXP,ISO) oxaliplatin (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (ISO) phenethyl caffeate (EXP) phenylmercury acetate (ISO) picrotoxin (EXP) pirinixic acid (EXP,ISO) puerarin (EXP) Pyridostigmine bromide (ISO) pyrimidifen (ISO) quercetin (ISO) rac-lactic acid (ISO) razoxane (EXP) resveratrol (ISO) rotenone (ISO) sarin (ISO) SB 431542 (ISO) scoparone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) streptozocin (ISO) sunitinib (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thapsigargin (EXP,ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) Triptolide (EXP,ISO) tris(2-butoxyethyl) phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vitamin E (ISO) vorinostat (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Structure, distribution, and functional expression of the phosphofructokinase C isozyme.
Gekakis N, etal., J Biol Chem 1994 Feb 4;269(5):3348-55.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
Response of rat cerebral glycolytic enzymes to hyperammonemic states.
Ratnakumari L and Murthy CR, Neurosci Lett. 1993 Oct 14;161(1):37-40.
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Isoenzymes of phosphofructokinase in the rat. Demonstration of the three non-identical subunits by biochemical, immunochemical and kinetic studies.
Vora S, etal., Biochem J. 1985 Jul 15;229(2):333-41.
11.
Identification of cell-specific messenger ribonucleic acids in oxytocinergic and vasopressinergic magnocellular neurons in rat supraoptic nucleus by single-cell differential hybridization.
Yamashita M, etal., Endocrinology 2002 Nov;143(11):4464-76.
Pfkp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 68,639,749 - 68,704,055 (+) NCBI GRCr8 mRatBN7.2 17 63,729,743 - 63,794,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 63,729,780 - 63,794,018 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 67,232,016 - 67,296,305 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 71,060,799 - 71,125,092 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 65,083,081 - 65,147,319 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 68,510,765 - 68,574,387 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 68,511,064 - 68,559,471 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 70,227,547 - 70,290,384 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 74,760,912 - 74,823,046 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 74,771,768 - 74,833,862 (+) NCBI Celera 17 63,327,855 - 63,392,034 (+) NCBI Celera Cytogenetic Map 17 q12.1 NCBI
PFKP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 3,067,548 - 3,136,805 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 3,066,333 - 3,137,718 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 3,109,740 - 3,178,997 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 3,099,752 - 3,168,996 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 3,099,751 - 3,168,995 NCBI Celera 10 3,056,125 - 3,124,845 (+) NCBI Celera Cytogenetic Map 10 p15.2 NCBI HuRef 10 3,045,950 - 3,114,052 (+) NCBI HuRef CHM1_1 10 3,109,390 - 3,178,958 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 3,068,649 - 3,138,082 (+) NCBI T2T-CHM13v2.0
Pfkp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 6,629,910 - 6,699,096 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 6,629,804 - 6,698,813 (-) Ensembl GRCm39 Ensembl GRCm38 13 6,579,874 - 6,649,060 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 6,579,768 - 6,648,777 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 6,579,120 - 6,647,970 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 6,579,120 - 6,647,970 (-) NCBI MGSCv36 mm8 Celera 13 6,529,169 - 6,596,776 (-) NCBI Celera Cytogenetic Map 13 A1 NCBI cM Map 13 3.25 NCBI
Pfkp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 28,043,271 - 28,086,796 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 28,042,973 - 28,098,358 (-) NCBI ChiLan1.0 ChiLan1.0
PFKP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 15,557,973 - 15,629,863 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 15,563,326 - 15,635,185 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 3,062,844 - 3,134,955 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 3,080,248 - 3,148,018 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 3,080,242 - 3,244,790 (+) Ensembl panpan1.1 panPan2
PFKP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 32,220,876 - 32,254,354 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 32,220,878 - 32,260,911 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 29,249,439 - 29,293,199 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 32,603,570 - 32,647,286 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 32,603,572 - 32,647,341 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 29,690,270 - 29,734,042 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 30,527,797 - 30,571,404 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 31,255,597 - 31,299,277 (-) NCBI UU_Cfam_GSD_1.0
Pfkp Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 34,940,588 - 34,996,015 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936484 11,103,142 - 11,161,344 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936484 11,105,814 - 11,161,238 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PFKP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 67,022,655 - 67,082,449 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 67,022,652 - 67,082,336 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 73,581,212 - 73,608,200 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PFKP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 3,130,701 - 3,191,590 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 3,130,566 - 3,191,576 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 8,281,360 - 8,342,269 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pfkp
.
Predicted Target Of
Count of predictions: 165 Count of miRNA genes: 129 Interacting mature miRNAs: 137 Transcripts: ENSRNOT00000023252 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 70210 Cm15 Cardiac mass QTL 15 6.5 heart right ventricle mass (VT:0007033) heart right ventricle wet weight (CMO:0000072) 17 57246723 70156904 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2301412 Kidm40 Kidney mass QTL 40 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 37479847 82479847 Rat 1354588 Bvd4 Brain ventricular dilatation QTL 4 5.31 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 53498828 82479847 Rat 7411577 Bw141 Body weight QTL 141 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 62619516 86533673 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2317038 Ginf3 Gastrointestinal inflammation QTL 3 2.89 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 17 49920154 86533673 Rat 724549 Niddm56 Non-insulin dependent diabetes mellitus QTL 56 0.03 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 31990784 76990784 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1598871 Memor5 Memory QTL 5 5.3 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 17 40540041 80387013 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 1600398 Edcs5 Endometrial carcinoma susceptibility QTL 5 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 17 57246723 70852846 Rat 2317045 Aia11 Adjuvant induced arthritis QTL 11 4.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 60781426 86533673 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 2317054 Aia12 Adjuvant induced arthritis QTL 12 4.24 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 38281509 83281509 Rat 1354635 Bp245 Blood pressure QTL 245 6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 42073160 69599340 Rat 8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 1300148 Bp192 Blood pressure QTL 192 3.47 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 17 34550843 73951021 Rat 2317060 Aia26 Adjuvant induced arthritis QTL 26 3.22 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 38281509 83281509 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 4889894 Eae33 Experimental allergic encephalomyelitis QTL 33 5.2 0.0001 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 50909099 86022412 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 2324621 Coatc5 Coat color QTL 5 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 17 31368391 73951021 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1300131 Bp193 Blood pressure QTL 193 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 63640009 73951021 Rat 7488963 Bp369 Blood pressure QTL 369 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 59005649 77910000 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1354663 Bvd5 Brain ventricular dilatation QTL 5 3.51 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 31990784 81292925 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 724528 Uae4 Urinary albumin excretion QTL 4 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 17 35837085 69599340 Rat 2302365 Gluco40 Glucose level QTL 40 4.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 57246843 82046127 Rat 2303580 Gluco49 Glucose level QTL 49 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 50040271 86533673 Rat
RH127612
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 63,793,692 - 63,793,903 (-) MAPPER mRatBN7.2 Rnor_6.0 17 68,510,879 - 68,511,089 NCBI Rnor6.0 Rnor_5.0 17 70,227,661 - 70,227,871 UniSTS Rnor5.0 RGSC_v3.4 17 74,822,722 - 74,822,932 UniSTS RGSC3.4 Celera 17 63,391,710 - 63,391,920 UniSTS Cytogenetic Map 17 q12.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023252 ⟹ ENSRNOP00000023252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 63,729,780 - 63,794,018 (+) Ensembl Rnor_6.0 Ensembl 17 68,511,064 - 68,559,471 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094864 ⟹ ENSRNOP00000084974
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 63,729,780 - 63,794,018 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108657 ⟹ ENSRNOP00000097741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 63,729,780 - 63,794,018 (+) Ensembl
RefSeq Acc Id:
NM_206847 ⟹ NP_996729
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 68,639,813 - 68,704,055 (+) NCBI mRatBN7.2 17 63,729,776 - 63,794,026 (+) NCBI Rnor_6.0 17 68,510,765 - 68,574,387 (-) NCBI Rnor_5.0 17 70,227,547 - 70,290,384 (-) NCBI RGSC_v3.4 17 74,760,912 - 74,823,046 (+) RGD Celera 17 63,327,855 - 63,392,034 (+) RGD
Sequence:
CATCTCACGACCTCCTTAAGATGAGTGACCAGGACTCTTCGACGTCCAGCACCTCCTTTCCGAAGTACCTGGAGCACCTCTCTGGGGATGGCAAAGCCATCGGTGTCCTGACCAGCGGCGGGGATGCC
hide sequence
RefSeq Acc Id:
XM_039096037 ⟹ XP_038951965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 68,639,749 - 68,704,050 (+) NCBI mRatBN7.2 17 63,729,747 - 63,794,021 (+) NCBI
RefSeq Acc Id:
XM_063276718 ⟹ XP_063132788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 68,639,749 - 68,704,050 (+) NCBI
RefSeq Acc Id:
NP_996729 ⟸ NM_206847
- UniProtKB:
Q5HZX8 (UniProtKB/Swiss-Prot), P47860 (UniProtKB/Swiss-Prot), C7C5T2 (UniProtKB/TrEMBL), A0A0A0MXY5 (UniProtKB/TrEMBL)
- Sequence:
MSDQDSSTSSTSFPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGMVDGGSNIVEAKWECVSSILQVGGTIIGSARCQAFRSREGRLKAACNLVRLGITNLCVIGGD
hide sequence
Ensembl Acc Id:
ENSRNOP00000023252 ⟸ ENSRNOT00000023252
RefSeq Acc Id:
XP_038951965 ⟸ XM_039096037
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6B663 (UniProtKB/TrEMBL), A0A8I5ZYA2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097741 ⟸ ENSRNOT00000108657
Ensembl Acc Id:
ENSRNOP00000084974 ⟸ ENSRNOT00000094864
RefSeq Acc Id:
XP_063132788 ⟸ XM_063276718
- Peptide Label:
isoform X2
- UniProtKB:
A0A0A0MXY5 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-8868 BioCyc
BioCyc Pathway ANAGLYCOLYSIS-PWY [glycolysis III (from glucose)] BioCyc
BioCyc Pathway Image ANAGLYCOLYSIS-PWY BioCyc
Ensembl Genes ENSRNOG00000017163 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000023252 ENTREZGENE, UniProtKB/TrEMBL
ENSRNOT00000023252.8 UniProtKB/Swiss-Prot
ENSRNOT00000094864.1 UniProtKB/TrEMBL
ENSRNOT00000108657 ENTREZGENE
ENSRNOT00000108657.1 UniProtKB/TrEMBL
ENSRNOT00000170052 ENTREZGENE
Gene3D-CATH 3.40.50.450 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.40.50.460 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7312293 IMAGE-MGC_LOAD
InterPro 6-Pfructokinase_euk UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ATP_PFK UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PFK_vert-type UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Phosphofructokinase_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Phosphofructokinase_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PKF_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:60416 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:105718 IMAGE-MGC_LOAD
NCBI Gene 60416 ENTREZGENE
PANTHER ATP-DEPENDENT 6-PHOSPHOFRUCTOKINASE, PLATELET TYPE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PHOSPHOFRUCTOKINASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam PFK UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Pfkp PhenoGen
PIRSF ATP_PFK_euk UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS PHFRCTKINASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE PHOSPHOFRUCTOKINASE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000017163 RatGTEx
Superfamily-SCOP SSF53784 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A0A0MXY5 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZYA2 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6B663 ENTREZGENE, UniProtKB/TrEMBL
A6JLM4_RAT UniProtKB/TrEMBL
A6JLM5_RAT UniProtKB/TrEMBL
A6JLM6_RAT UniProtKB/TrEMBL
C7C5T2 ENTREZGENE, UniProtKB/TrEMBL
P47860 ENTREZGENE, UniProtKB/Swiss-Prot
Q5HZX8 ENTREZGENE
UniProt Secondary Q5HZX8 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pfkp
phosphofructokinase, platelet
phosphofructokinase, platelet
Name updated
1299863 APPROVED
2002-06-10
Pfkp
phosphofructokinase, platelet
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
enriched in brain
61692
gene_expression
preferentially expressed in oxytocin-expressing magnocellular neurons (MCNs)
628363
gene_expression
expressed mainly in the brain and in neuroendocrine tissues
628363
gene_function
catalyzes the ATP-dependent conversion of fructose 6-phosphate to fructose 1, 6-bisphosphate
628363
gene_protein
765 amino acids
61692
