Symbol:
Itsn1
Name:
intersectin 1
RGD ID:
2935
Description:
Predicted to enable kinase activator activity; molecular adaptor activity; and proline-rich region binding activity. Involved in positive regulation of dendritic spine development; positive regulation of transport; and regulation of synapse organization. Located in several cellular components, including clathrin-coated pit; dendrite; and neuronal cell body. Is active in glutamatergic synapse; postsynaptic actin cytoskeleton; and postsynaptic endocytic zone. Orthologous to human ITSN1 (intersectin 1); PARTICIPATES IN clathrin-dependent synaptic vesicle endocytosis; ephrin - ephrin receptor bidirectional signaling axis; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
EH domain and SH3 domain regulator of endocytosis 1; EHSH1; intersectin (SH3 domain protein 1A); intersectin 1 (SH3 domain protein 1A); intersectin 1 (SH3 domain protein); intersectin-1; intersectin-1-like; intersection (SH3 domain protein 1A); Itsn; LOC100911851
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITSN1 (intersectin 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):
Itsn1 (intersectin 1 (SH3 domain protein 1A)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Itsn1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITSN1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITSN1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itsn1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITSN1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITSN1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itsn1 (intersectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ITSN1 (intersectin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Itsn1 (intersectin 1 (SH3 domain protein 1A))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
itsn1 (intersectin 1 (SH3 domain protein))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dap160
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
itsn-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
itsn1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 44,464,515 - 44,646,598 (+) NCBI GRCr8 mRatBN7.2 11 30,978,590 - 31,160,645 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 30,978,590 - 31,160,645 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 39,672,533 - 39,854,583 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,343,963 - 32,526,016 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 31,506,203 - 31,688,572 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 31,943,119 - 32,069,249 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 31,893,489 - 32,069,249 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 35,547,331 - 35,672,959 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 31,721,528 - 31,901,963 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 31,815,217 - 31,903,071 (+) NCBI Celera 11 30,687,099 - 30,812,424 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itsn1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ITSN1 mRNA CTD PMID:22079256 Itsn1 Rat (1->4)-beta-D-glucan multiple interactions ISO Itsn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITSN1 mRNA CTD PMID:36331819 Itsn1 Rat 1,2-dichloroethane affects expression ISO Itsn1 (Mus musculus) 6480464 ethylene dichloride affects the expression of ITSN1 mRNA CTD PMID:28960355 Itsn1 Rat 17beta-estradiol increases expression ISO Itsn1 (Mus musculus) 6480464 Estradiol results in increased expression of ITSN1 mRNA CTD PMID:39298647 Itsn1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Itsn1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itsn1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO ITSN1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Itsn1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Itsn1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itsn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ITSN1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ITSN1 mRNA CTD PMID:21296121 Itsn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITSN1 mRNA CTD PMID:33387578 Itsn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITSN1 mRNA CTD PMID:32109520 Itsn1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ITSN1 mRNA CTD PMID:21346803 Itsn1 Rat 2-butoxyethanol increases expression ISO Itsn1 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of ITSN1 mRNA CTD PMID:19812364 Itsn1 Rat 2-methylcholine affects expression ISO ITSN1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ITSN1 mRNA CTD PMID:21179406 Itsn1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO ITSN1 (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Itsn1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Itsn1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Itsn1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ITSN1 mRNA CTD PMID:20188158 Itsn1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Itsn1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ITSN1 mRNA CTD PMID:26251327 Itsn1 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Itsn1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ITSN1 promoter CTD PMID:26251327 Itsn1 Rat 4,4'-sulfonyldiphenol increases expression ISO ITSN1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ITSN1 protein CTD PMID:34186270 Itsn1 Rat 4-hydroxynon-2-enal decreases expression ISO ITSN1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ITSN1 mRNA CTD PMID:12419474 Itsn1 Rat 5-fluorouracil affects response to substance ISO ITSN1 (Homo sapiens) 6480464 ITSN1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Itsn1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ITSN1 mRNA CTD PMID:28959563 Itsn1 Rat aflatoxin B1 decreases expression ISO ITSN1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ITSN1 mRNA CTD PMID:21641981 Itsn1 Rat aflatoxin B1 increases methylation ISO ITSN1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ITSN1 gene and Aflatoxin B1 results in increased methylation of ITSN1 intron CTD PMID:27153756 and PMID:30157460 Itsn1 Rat Aflatoxin B2 alpha increases methylation ISO ITSN1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ITSN1 intron CTD PMID:30157460 Itsn1 Rat all-trans-retinoic acid increases expression ISO ITSN1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ITSN1 mRNA CTD PMID:33167477 Itsn1 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ITSN1 protein CTD PMID:34896426 Itsn1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ITSN1 mRNA CTD PMID:16483693 Itsn1 Rat Aroclor 1254 decreases expression ISO Itsn1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ITSN1 mRNA CTD PMID:23650126 Itsn1 Rat arsane multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat arsenic atom multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat arsenite(3-) decreases expression ISO Itsn1 (Mus musculus) 6480464 arsenite results in decreased expression of ITSN1 protein CTD PMID:37955338 Itsn1 Rat arsenite(3-) multiple interactions ISO ITSN1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ITSN1 mRNA] CTD PMID:32406909 Itsn1 Rat benzo[a]pyrene decreases expression ISO ITSN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ITSN1 mRNA CTD PMID:20064835 Itsn1 Rat benzo[a]pyrene decreases methylation ISO ITSN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ITSN1 5' UTR CTD PMID:27901495 Itsn1 Rat benzo[a]pyrene affects methylation ISO ITSN1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ITSN1 intron CTD PMID:30157460 Itsn1 Rat benzo[a]pyrene decreases expression ISO Itsn1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ITSN1 mRNA CTD PMID:20713471 Itsn1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ITSN1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Itsn1 Rat benzo[e]pyrene increases methylation ISO ITSN1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ITSN1 intron CTD PMID:30157460 Itsn1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ITSN1 mRNA CTD PMID:25181051 Itsn1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITSN1 mRNA CTD PMID:30816183 and PMID:32528016 Itsn1 Rat bisphenol AF increases expression ISO ITSN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ITSN1 protein CTD PMID:34186270 Itsn1 Rat Bisphenol B increases expression ISO ITSN1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ITSN1 protein CTD PMID:34186270 Itsn1 Rat butanal decreases expression ISO ITSN1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ITSN1 mRNA CTD PMID:26079696 Itsn1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of ITSN1 mRNA CTD PMID:19167457 Itsn1 Rat cadmium atom multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ITSN1 mRNA CTD PMID:35301059 Itsn1 Rat cadmium dichloride increases expression ISO ITSN1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ITSN1 mRNA CTD PMID:38382870 Itsn1 Rat cadmium dichloride multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ITSN1 mRNA CTD PMID:35301059 Itsn1 Rat caffeine affects phosphorylation ISO ITSN1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ITSN1 protein CTD PMID:35688186 Itsn1 Rat carbon nanotube decreases expression ISO Itsn1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Itsn1 Rat chlorpyrifos affects expression ISO Itsn1 (Mus musculus) 6480464 Chlorpyrifos affects the expression of ITSN1 mRNA CTD PMID:37019170 Itsn1 Rat cisplatin decreases expression ISO ITSN1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ITSN1 mRNA CTD PMID:27392435 Itsn1 Rat clobetasol decreases expression ISO Itsn1 (Mus musculus) 6480464 Clobetasol results in decreased expression of ITSN1 mRNA CTD PMID:27462272 Itsn1 Rat clothianidin decreases expression ISO ITSN1 (Homo sapiens) 6480464 clothianidin results in decreased expression of ITSN1 mRNA CTD PMID:31626844 Itsn1 Rat cobalt dichloride decreases expression ISO ITSN1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ITSN1 mRNA CTD PMID:19320972 Itsn1 Rat cobalt dichloride increases expression ISO ITSN1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ITSN1 mRNA CTD PMID:19376846 Itsn1 Rat copper atom multiple interactions ISO Itsn1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of ITSN1 mRNA CTD PMID:15467011 Itsn1 Rat copper(0) multiple interactions ISO Itsn1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of ITSN1 mRNA CTD PMID:15467011 Itsn1 Rat crocidolite asbestos multiple interactions ISO Itsn1 (Mus musculus) 6480464 Asbestos and Crocidolite inhibits the reaction [SPARC gene mutant form results in increased expression of ITSN1 mRNA] CTD PMID:19446018 Itsn1 Rat crocidolite asbestos decreases expression ISO ITSN1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of ITSN1 mRNA CTD PMID:29523930 Itsn1 Rat crocidolite asbestos increases expression ISO Itsn1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of ITSN1 mRNA CTD PMID:19446018 Itsn1 Rat cyclosporin A decreases expression ISO ITSN1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ITSN1 mRNA CTD PMID:20106945 Itsn1 Rat cyclosporin A decreases expression ISO Itsn1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of ITSN1 mRNA CTD PMID:19770486 Itsn1 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ITSN1 protein CTD PMID:34896426 Itsn1 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ITSN1 protein CTD PMID:34896426 Itsn1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of ITSN1 mRNA CTD PMID:23640034 Itsn1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ITSN1 mRNA CTD PMID:20032058 Itsn1 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of ITSN1 mRNA] CTD PMID:20032058 Itsn1 Rat Diacetoxyscirpenol increases expression ISO Itsn1 (Mus musculus) 6480464 diacetoxyscirpenol results in increased expression of ITSN1 mRNA CTD PMID:31836554 Itsn1 Rat Dibutyl phosphate affects expression ISO ITSN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ITSN1 mRNA CTD PMID:37042841 Itsn1 Rat dibutyl phthalate increases expression ISO Itsn1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ITSN1 mRNA CTD PMID:21266533 Itsn1 Rat dieldrin affects methylation ISO Itsn1 (Mus musculus) 6480464 Dieldrin affects the methylation of ITSN1 gene CTD PMID:38995845 Itsn1 Rat ethanol multiple interactions ISO Itsn1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of ITSN1 mRNA CTD PMID:30319688 Itsn1 Rat ethanol increases expression ISO Itsn1 (Mus musculus) 6480464 Ethanol results in increased expression of ITSN1 mRNA CTD PMID:30319688 Itsn1 Rat ethanol affects splicing ISO Itsn1 (Mus musculus) 6480464 Ethanol affects the splicing of ITSN1 mRNA CTD PMID:30319688 Itsn1 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ITSN1 protein CTD PMID:34896426 Itsn1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of ITSN1 mRNA CTD PMID:34044035 Itsn1 Rat formaldehyde decreases expression ISO ITSN1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ITSN1 mRNA CTD PMID:23649840 Itsn1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ITSN1 mRNA CTD PMID:22061828 Itsn1 Rat glyphosate increases expression ISO Itsn1 (Mus musculus) 6480464 Glyphosate results in increased expression of ITSN1 mRNA CTD PMID:35897073 Itsn1 Rat hexadecanoic acid increases phosphorylation ISO ITSN1 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of ITSN1 protein CTD PMID:28073184 Itsn1 Rat hydralazine multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ITSN1 mRNA CTD PMID:17183730 Itsn1 Rat ivermectin decreases expression ISO ITSN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ITSN1 protein CTD PMID:32959892 Itsn1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of ITSN1 mRNA CTD PMID:35283115 Itsn1 Rat manganese atom multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat manganese(0) multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat manganese(II) chloride multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat methapyrilene increases methylation ISO ITSN1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ITSN1 intron CTD PMID:30157460 Itsn1 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of ITSN1 gene CTD PMID:23303685 Itsn1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ITSN1 gene CTD PMID:35440735 Itsn1 Rat nickel atom increases expression ISO Itsn1 (Mus musculus) 6480464 Nickel results in increased expression of ITSN1 mRNA CTD PMID:18922574 Itsn1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ITSN1 mRNA CTD PMID:25729387 Itsn1 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of ITSN1 mRNA CTD PMID:35737395 Itsn1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ITSN1 mRNA CTD PMID:33387578 Itsn1 Rat PCB138 multiple interactions ISO Itsn1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Itsn1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Itsn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ITSN1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of ITSN1 mRNA CTD PMID:36331819 Itsn1 Rat perfluorooctanoic acid decreases expression ISO Itsn1 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of ITSN1 protein CTD PMID:28126411 Itsn1 Rat phenobarbital affects expression ISO Itsn1 (Mus musculus) 6480464 Phenobarbital affects the expression of ITSN1 mRNA CTD PMID:23091169 Itsn1 Rat pirinixic acid decreases expression ISO Itsn1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ITSN1 mRNA CTD PMID:18445702 Itsn1 Rat potassium chromate decreases expression ISO ITSN1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ITSN1 mRNA CTD PMID:22079256 Itsn1 Rat potassium chromate multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ITSN1 mRNA CTD PMID:22079256 Itsn1 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of ITSN1 protein CTD PMID:34896426 Itsn1 Rat quercetin decreases expression ISO ITSN1 (Homo sapiens) 6480464 Quercetin results in decreased expression of ITSN1 mRNA CTD PMID:21632981 Itsn1 Rat sodium arsenite multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ITSN1 mRNA CTD PMID:39836092 Itsn1 Rat sodium fluoride increases expression ISO Itsn1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of ITSN1 mRNA CTD PMID:27862939 Itsn1 Rat sunitinib decreases expression ISO ITSN1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ITSN1 mRNA CTD PMID:31533062 Itsn1 Rat tert-butyl hydroperoxide decreases expression ISO ITSN1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ITSN1 mRNA CTD PMID:12419474 Itsn1 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of ITSN1 mRNA] CTD PMID:20032058 Itsn1 Rat testosterone increases expression ISO ITSN1 (Homo sapiens) 6480464 Testosterone results in increased expression of ITSN1 mRNA CTD PMID:33359661 Itsn1 Rat tetrachloromethane affects expression ISO Itsn1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of ITSN1 mRNA CTD PMID:17484886 Itsn1 Rat tetraphene decreases expression ISO Itsn1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of ITSN1 mRNA CTD PMID:26377693 Itsn1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ITSN1 mRNA CTD PMID:23411599 Itsn1 Rat titanium dioxide decreases methylation ISO Itsn1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ITSN1 gene CTD PMID:35295148 Itsn1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ITSN1 mRNA CTD PMID:25729387 Itsn1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ITSN1 mRNA CTD PMID:25729387 Itsn1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ITSN1 mRNA CTD PMID:33387578 Itsn1 Rat triptonide affects expression ISO Itsn1 (Mus musculus) 6480464 triptonide affects the expression of ITSN1 mRNA CTD PMID:33045310 Itsn1 Rat valproic acid multiple interactions ISO ITSN1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ITSN1 mRNA CTD PMID:17183730 Itsn1 Rat valproic acid decreases expression ISO ITSN1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ITSN1 mRNA CTD PMID:29154799 Itsn1 Rat valproic acid affects expression ISO ITSN1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ITSN1 mRNA CTD PMID:25979313 Itsn1 Rat valproic acid increases expression ISO ITSN1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ITSN1 mRNA CTD PMID:23179753 more ... Itsn1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ITSN1 mRNA CTD PMID:29427782
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-fluorouracil (ISO) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) bisphenol AF (ISO) Bisphenol B (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) clobetasol (ISO) clothianidin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) decabromodiphenyl ether (EXP) dexamethasone (EXP) Diacetoxyscirpenol (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dieldrin (ISO) ethanol (ISO) fenvalerate (EXP) fipronil (EXP) formaldehyde (ISO) gentamycin (EXP) glyphosate (ISO) hexadecanoic acid (ISO) hydralazine (ISO) ivermectin (ISO) lidocaine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) nickel atom (ISO) oxaliplatin (EXP) ozone (EXP) paracetamol (EXP) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) pyrethrins (EXP) quercetin (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP,ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) triptonide (ISO) valproic acid (EXP,ISO)
Cellular Component
apical dendrite (IDA) calyx of Held (ISO) cell projection (IEA) clathrin-coated pit (IDA,IEA,ISO) cytoplasm (IBA,IEA,ISO,ISS) cytoplasmic vesicle (IEA) cytosol (ISO) dendritic spine (IDA) endocytic vesicle (ISO) endomembrane system (IEA) endosome (IEA) glutamatergic synapse (IDA,IMP) intracellular vesicle (IBA,IDA) lamellipodium (IEA,ISO) membrane (IEA) neuron projection (IEA) neuronal cell body (IDA) nuclear envelope (IEA,ISO,ISS) nucleus (IEA) plasma membrane (IBA,IEA,ISO) postsynaptic actin cytoskeleton (IDA) postsynaptic endocytic zone (IDA,IMP) presynaptic endocytic zone (ISO) presynaptic membrane (IBA) recycling endosome (IEA) synapse (IEA) terminal bouton (HDA)
1.
Dynamics and nanoscale organization of the postsynaptic endocytic zone at excitatory synapses.
Catsburg LA, etal., Elife. 2022 Jan 24;11:e74387. doi: 10.7554/eLife.74387.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Neuronal distribution of EHSH1/intersectin: molecular linker between clathrin-mediated endocytosis and signaling pathways.
Ma YJ, etal., J Neurosci Res. 2003 Feb 15;71(4):468-77. doi: 10.1002/jnr.10500.
5.
Intersectin-1L nucleotide exchange factor regulates secretory granule exocytosis by activating Cdc42.
Malacombe M, etal., EMBO J. 2006 Aug 9;25(15):3494-503. doi: 10.1038/sj.emboj.7601247. Epub 2006 Jul 27.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
EHSH1/intersectin, a protein that contains EH and SH3 domains and binds to dynamin and SNAP-25. A protein connection between exocytosis and endocytosis?
Okamoto M, etal., J Biol Chem 1999 Jun 25;274(26):18446-54.
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Synaptic vesicle endocytosis.
Saheki Y and De Camilli P, Cold Spring Harb Perspect Biol. 2012 Sep 1;4(9):a005645. doi: 10.1101/cshperspect.a005645.
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Intersectin regulates dendritic spine development and somatodendritic endocytosis but not synaptic vesicle recycling in hippocampal neurons.
Thomas S, etal., J Biol Chem. 2009 May 1;284(18):12410-9. doi: 10.1074/jbc.M809746200. Epub 2009 Mar 3.
15.
Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.
Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
Itsn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 44,464,515 - 44,646,598 (+) NCBI GRCr8 mRatBN7.2 11 30,978,590 - 31,160,645 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 30,978,590 - 31,160,645 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 39,672,533 - 39,854,583 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,343,963 - 32,526,016 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 31,506,203 - 31,688,572 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 31,943,119 - 32,069,249 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 31,893,489 - 32,069,249 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 35,547,331 - 35,672,959 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 31,721,528 - 31,901,963 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 31,815,217 - 31,903,071 (+) NCBI Celera 11 30,687,099 - 30,812,424 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
ITSN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 33,642,501 - 33,899,861 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 33,642,400 - 33,899,861 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 35,014,807 - 35,272,165 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 33,936,654 - 34,183,479 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 33,936,653 - 34,183,479 NCBI Celera 21 20,214,405 - 20,461,193 (+) NCBI Celera Cytogenetic Map 21 q22.11 NCBI HuRef 21 20,493,109 - 20,739,668 (+) NCBI HuRef CHM1_1 21 34,577,248 - 34,824,084 (+) NCBI CHM1_1 T2T-CHM13v2.0 21 32,024,315 - 32,281,564 (+) NCBI T2T-CHM13v2.0
Itsn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 91,526,198 - 91,717,479 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 91,526,169 - 91,717,485 (+) Ensembl GRCm39 Ensembl GRCm38 16 91,729,310 - 91,920,591 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 91,729,281 - 91,920,597 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 91,729,616 - 91,920,824 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 91,671,052 - 91,800,868 (+) NCBI MGSCv36 mm8 Celera 16 92,808,009 - 93,004,876 (+) NCBI Celera Cytogenetic Map 16 C4 NCBI cM Map 16 53.28 NCBI
Itsn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 33,113,319 - 33,275,675 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 33,056,004 - 33,275,681 (+) NCBI ChiLan1.0 ChiLan1.0
ITSN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 29,759,728 - 30,017,340 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 24,617,929 - 24,875,764 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 20,009,385 - 20,266,835 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 33,381,640 - 33,625,603 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 33,457,081 - 33,625,248 (+) Ensembl panpan1.1 panPan2
ITSN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 29,144,754 - 29,360,134 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 28,243,620 - 28,459,926 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 28,451,006 - 28,667,391 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 28,451,116 - 28,661,479 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 28,317,804 - 28,534,014 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 28,331,715 - 28,548,460 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 28,831,446 - 29,047,794 (+) NCBI UU_Cfam_GSD_1.0
Itsn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 28,789,742 - 28,977,174 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936500 8,468,940 - 8,612,942 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936500 8,490,514 - 8,678,127 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITSN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 197,249,061 - 197,481,245 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 197,301,515 - 197,492,537 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 207,205,545 - 207,267,672 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITSN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 58,298,529 - 58,543,297 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 58,301,399 - 58,543,281 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 805,376 - 1,047,516 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itsn1
.
Predicted Target Of
Count of predictions: 266 Count of miRNA genes: 123 Interacting mature miRNAs: 149 Transcripts: ENSRNOT00000042750, ENSRNOT00000047843 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
D11Rat13
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,071,112 - 31,071,247 (+) MAPPER mRatBN7.2 Rnor_6.0 11 31,987,001 - 31,987,134 NCBI Rnor6.0 Rnor_5.0 11 35,591,213 - 35,591,346 UniSTS Rnor5.0 RGSC_v3.4 11 31,820,214 - 31,820,348 RGD RGSC3.4 RGSC_v3.4 11 31,820,215 - 31,820,348 UniSTS RGSC3.4 RGSC_v3.1 11 31,859,087 - 31,859,220 RGD Celera 11 30,730,986 - 30,731,119 UniSTS RH 3.4 Map 11 202.3 UniSTS RH 3.4 Map 11 202.3 RGD FHH x ACI Map 11 12.19 UniSTS FHH x ACI Map 11 12.19 RGD Cytogenetic Map 11 q11 UniSTS
D11Got26
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 11 35,640,985 - 35,641,186 NCBI Rnor5.0 Rnor_5.0 11 35,640,986 - 35,641,186 NCBI Rnor5.0 RGSC_v3.4 11 31,869,988 - 31,870,188 RGD RGSC3.4 RGSC_v3.4 11 31,869,989 - 31,870,188 UniSTS RGSC3.4 RGSC_v3.1 11 31,908,865 - 31,909,064 RGD Celera 11 30,779,811 - 30,780,014 UniSTS RH 3.4 Map 11 203.1 RGD RH 3.4 Map 11 203.1 UniSTS RH 2.0 Map 11 453.4 RGD Cytogenetic Map 11 q11 UniSTS
RH140585
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 11 44,556,582 - 44,556,771 (+) Marker Load Pipeline mRatBN7.2 11 31,070,630 - 31,070,819 (+) MAPPER mRatBN7.2 Rnor_6.0 11 31,986,519 - 31,986,707 NCBI Rnor6.0 Rnor_5.0 11 35,590,731 - 35,590,919 UniSTS Rnor5.0 RGSC_v3.4 11 31,819,733 - 31,819,921 UniSTS RGSC3.4 Celera 11 30,730,504 - 30,730,692 UniSTS RH 3.4 Map 11 176.8 UniSTS Cytogenetic Map 11 q11 UniSTS
BI283741
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,096,782 - 31,096,948 (+) MAPPER mRatBN7.2 Rnor_6.0 11 32,013,163 - 32,013,328 NCBI Rnor6.0 Rnor_5.0 11 35,616,875 - 35,617,040 UniSTS Rnor5.0 RGSC_v3.4 11 31,845,877 - 31,846,042 UniSTS RGSC3.4 Celera 11 30,756,527 - 30,756,692 UniSTS RH 3.4 Map 11 198.1 UniSTS Cytogenetic Map 11 q11 UniSTS
RH135361
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 11 44,487,179 - 44,487,410 (+) Marker Load Pipeline mRatBN7.2 11 31,001,225 - 31,001,456 (+) MAPPER mRatBN7.2 Rnor_6.0 11 31,917,115 - 31,917,345 NCBI Rnor6.0 Rnor_5.0 11 35,521,327 - 35,521,557 UniSTS Rnor5.0 RGSC_v3.4 11 31,750,342 - 31,750,572 UniSTS RGSC3.4 Celera 11 30,661,081 - 30,661,311 UniSTS RH 3.4 Map 11 200.5 UniSTS Cytogenetic Map 11 q11 UniSTS
REN86881
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,114,822 - 31,115,068 (+) MAPPER mRatBN7.2 Rnor_6.0 11 27,576,301 - 27,576,546 NCBI Rnor6.0 Rnor_6.0 11 32,031,204 - 32,031,449 NCBI Rnor6.0 Rnor_5.0 11 35,634,916 - 35,635,161 UniSTS Rnor5.0 Rnor_5.0 11 31,196,421 - 31,196,666 UniSTS Rnor5.0 RGSC_v3.4 11 31,863,918 - 31,864,163 UniSTS RGSC3.4 Cytogenetic Map 11 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042750 ⟹ ENSRNOP00000044773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 30,978,590 - 31,116,225 (+) Ensembl Rnor_6.0 Ensembl 11 31,893,489 - 32,069,249 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000047843 ⟹ ENSRNOP00000045513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,027,230 - 31,115,100 (+) Ensembl Rnor_6.0 Ensembl 11 31,943,119 - 32,031,481 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 27,568,537 - 27,577,691 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087733
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 27,566,879 - 27,577,691 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089993
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 27,571,533 - 27,577,691 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096706 ⟹ ENSRNOP00000097531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 30,978,590 - 31,160,645 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096792 ⟹ ENSRNOP00000095645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 30,978,590 - 31,160,645 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110949 ⟹ ENSRNOP00000089593
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,146,593 - 31,160,645 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114620 ⟹ ENSRNOP00000077439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,028,827 - 31,160,645 (+) Ensembl
RefSeq Acc Id:
NM_001136096 ⟹ NP_001129568
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,547 - 44,646,598 (+) NCBI mRatBN7.2 11 30,978,590 - 31,160,645 (+) NCBI Rnor_6.0 11 31,943,121 - 32,069,249 (+) NCBI Rnor_5.0 11 35,547,331 - 35,672,959 (+) NCBI RGSC_v3.4 11 31,721,528 - 31,901,963 (+) RGD Celera 11 30,687,101 - 30,812,424 (+) NCBI
Sequence:
GCGGCCGCGCGCACCCGCCCGGAGATGAGGCGTCGATTAGCAAGGTAAAGGTAACAGAACCATGGCTCAGTTTCCGACACCTTTTGGTGGGAGCCTGGACATCTGGGCCATAACCGTGGAGGAAAGAG
hide sequence
RefSeq Acc Id:
NM_019227 ⟹ NP_062100
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,547 - 44,602,171 (+) NCBI mRatBN7.2 11 30,978,590 - 31,116,225 (+) NCBI Rnor_6.0 11 31,943,119 - 32,031,481 (+) NCBI Rnor_5.0 11 35,547,331 - 35,672,959 (+) NCBI RGSC_v3.4 11 31,721,528 - 31,901,963 (+) RGD Celera 11 30,687,099 - 30,792,058 (+) NCBI
Sequence:
GAGATGAGGCGTCGATTAGCAAGGTAAAGGTAACAGAACCATGGCTCAGTTTCCGACACCTTTTGGTGGGAGCCTGGACATCTGGGCCATAACCGTGGAGGAAAGAGCCAAGCATGACCAGCAGTTCC
hide sequence
RefSeq Acc Id:
XM_039088246 ⟹ XP_038944174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,566 - 44,646,598 (+) NCBI mRatBN7.2 11 30,978,689 - 31,153,195 (+) NCBI
RefSeq Acc Id:
XM_039088247 ⟹ XP_038944175
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,465,434 - 44,646,598 (+) NCBI mRatBN7.2 11 30,979,480 - 31,154,490 (+) NCBI
RefSeq Acc Id:
XM_039088248 ⟹ XP_038944176
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,601 - 44,583,059 (+) NCBI mRatBN7.2 11 30,978,689 - 31,097,115 (+) NCBI
RefSeq Acc Id:
XM_039088249 ⟹ XP_038944177
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,545 - 44,583,059 (+) NCBI mRatBN7.2 11 30,978,689 - 31,097,115 (+) NCBI
RefSeq Acc Id:
XM_039088250 ⟹ XP_038944178
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,608 - 44,588,891 (+) NCBI mRatBN7.2 11 30,978,689 - 31,102,947 (+) NCBI
RefSeq Acc Id:
XM_039088251 ⟹ XP_038944179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,605 - 44,574,802 (+) NCBI mRatBN7.2 11 30,978,689 - 31,088,160 (+) NCBI
RefSeq Acc Id:
XM_063270443 ⟹ XP_063126513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,465,435 - 44,646,598 (+) NCBI
RefSeq Acc Id:
XM_063270444 ⟹ XP_063126514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,534,246 - 44,646,598 (+) NCBI
RefSeq Acc Id:
XM_063270445 ⟹ XP_063126515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,464,515 - 44,602,171 (+) NCBI
RefSeq Acc Id:
XM_063270446 ⟹ XP_063126516
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 44,534,246 - 44,602,171 (+) NCBI
RefSeq Acc Id:
NP_001129568 ⟸ NM_001136096
- Peptide Label:
isoform a
- UniProtKB:
Q9WVE9 (UniProtKB/Swiss-Prot), F1M823 (UniProtKB/Swiss-Prot), Q9WVE1 (UniProtKB/Swiss-Prot), D3ZV52 (UniProtKB/TrEMBL), A0A8I5Y9J0 (UniProtKB/TrEMBL)
- Sequence:
MAQFPTPFGGSLDIWAITVEERAKHDQQFQSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNKDGRMDQVEFSIAMKLIKLKLQGYQLPPALPPVMKQQPAAISSAPAFGIGGMAGMPPLTA
hide sequence
RefSeq Acc Id:
NP_062100 ⟸ NM_019227
- Peptide Label:
isoform b
- UniProtKB:
A0A8L2QLK0 (UniProtKB/TrEMBL)
- Sequence:
MAQFPTPFGGSLDIWAITVEERAKHDQQFQSLKPISGFITGDQARNFFFQSGLPQPVLAQIWAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000045513 ⟸ ENSRNOT00000047843
Ensembl Acc Id:
ENSRNOP00000044773 ⟸ ENSRNOT00000042750
RefSeq Acc Id:
XP_038944174 ⟸ XM_039088246
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ARZ8 (UniProtKB/TrEMBL), A0A8I5Y9J0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944178 ⟸ XM_039088250
- Peptide Label:
isoform X8
- UniProtKB:
A0A8L2QM65 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944176 ⟸ XM_039088248
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038944177 ⟸ XM_039088249
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038944179 ⟸ XM_039088251
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_038944175 ⟸ XM_039088247
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ARZ8 (UniProtKB/TrEMBL), A0A8I5Y9J0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000077439 ⟸ ENSRNOT00000114620
Ensembl Acc Id:
ENSRNOP00000089593 ⟸ ENSRNOT00000110949
Ensembl Acc Id:
ENSRNOP00000097531 ⟸ ENSRNOT00000096706
Ensembl Acc Id:
ENSRNOP00000095645 ⟸ ENSRNOT00000096792
RefSeq Acc Id:
XP_063126515 ⟸ XM_063270445
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2QLK0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126513 ⟸ XM_063270443
- Peptide Label:
isoform X2
- UniProtKB:
Q9WVE9 (UniProtKB/Swiss-Prot), Q9WVE1 (UniProtKB/Swiss-Prot), F1M823 (UniProtKB/Swiss-Prot), D3ZV52 (UniProtKB/Swiss-Prot), A0A8I5Y9J0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126514 ⟸ XM_063270444
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5Y9J0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126516 ⟸ XM_063270446
- Peptide Label:
isoform X5
- UniProtKB:
A0A8L2QLK0 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Itsn1
intersectin 1
LOC100911851
intersectin-1-like
Data merged from RGD:6490732
737654 PROVISIONAL
2015-11-19
Itsn1
intersectin 1
Itsn1
intersectin 1 (SH3 domain protein)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100911851
intersectin-1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-11-17
Itsn1
intersectin 1 (SH3 domain protein)
Itsn1
intersectin 1 (SH3 domain protein 1A)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-19
Itsn1
intersectin 1 (SH3 domain protein 1A)
Itsn1
intersectin 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Itsn1
intersectin 1
Itsn
Symbol updated
1299863 APPROVED
2002-06-10
Itsn
intersectin 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
has two EH domains,a central KLERQ domain and five SH3 domains
69862
gene_expression
expressed abundantly in the brain
69862
gene_function
an adaptor protein which participates in ther coupling of endocytic membrane traffic to exocytosis
69862
