Advanced Search (OLGA)

Gene: Chrnb1 (cholinergic receptor nicotinic beta 1 subunit) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Chrnb1

Name:

cholinergic receptor nicotinic beta 1 subunit

RGD ID:

2349

Description:

Enables acetylcholine-gated monoatomic cation-selective channel activity. Involved in monoatomic cation transport and skeletal muscle contraction. Part of acetylcholine-gated channel complex. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome 2A and congenital myasthenic syndrome 2C. Orthologous to human CHRNB1 (cholinergic receptor nicotinic beta 1 subunit); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; INTERACTS WITH 6-propyl-2-thiouracil; acetylcholine; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Acetylcholine receptor beta; acetylcholine receptor subunit beta; Acrb; cholinergic receptor nicotinic beta polypeptide 1; cholinergic receptor, nicotinic beta 1; cholinergic receptor, nicotinic, beta 1 (muscle); cholinergic receptor, nicotinic, beta polypeptide 1; cholinergic receptor, nicotinic, beta polypeptide 1 (muscle); cholinergic receptor, nicotinic, beta polypeptide 1(muscle); n acetylcholine receptor; nAChR; RNACRB1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,999,943 - 55,015,137 (-)	NCBI		GRCr8
mRatBN7.2	10	54,501,096 - 54,516,418 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,501,093 - 54,516,345 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,166,354 - 59,178,879 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,654,919 - 58,667,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,162,545 - 54,175,096 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,390,671 - 56,403,255 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,390,671 - 56,403,188 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,135,720 - 56,148,237 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,604,907 - 56,617,423 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,618,529 - 56,631,046 (-)	NCBI
Celera	10	53,658,103 - 53,670,628 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	common variable immunodeficiency		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Common variable immunodeficiency	ClinVar	PMID:28492532
Chrnb1	Rat	congenital myasthenic syndrome		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Congenital Myasthenic Syndrome, Dominant/Recessive	ClinVar	PMID:28492532
Chrnb1	Rat	congenital myasthenic syndrome 2A		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Congenital myasthenic syndrome 2A	ClinVar	PMID:10562302\|PMID:16199547\|PMID:17576681\|PMID:17686188\|PMID:18414213\|PMID:20562457\|PMID:25741868\|PMID:26467025\|PMID:27375219\|PMID:27391121\|PMID:28492532\|PMID:28686619\|PMID:8651643\|PMID:8872460\|PMID:9536098
Chrnb1	Rat	congenital myasthenic syndrome 2C		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Congenital myasthenic syndrome 2C	ClinVar	PMID:10562302\|PMID:20562457\|PMID:25741868\|PMID:27391121\|PMID:28492532\|PMID:32504635\|PMID:33060286\|PMID:8872460
Chrnb1	Rat	congenital myasthenic syndrome 4C		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Congenital myasthenic syndrome 4C	ClinVar	PMID:10562302\|PMID:17576681\|PMID:18414213\|PMID:25741868\|PMID:26467025\|PMID:28492532\|PMID:9536098
Chrnb1	Rat	dyskeratosis congenita		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita	ClinVar	PMID:28492532
Chrnb1	Rat	genetic disease		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:26467025\|PMID:28492532
Chrnb1	Rat	intellectual disability		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Intellectual disability, mild	ClinVar
Chrnb1	Rat	Li-Fraumeni syndrome		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Li-Fraumeni syndrome	ClinVar	PMID:20522432\|PMID:21056402\|PMID:23172776\|PMID:26681312\|PMID:28492532
Chrnb1	Rat	very long chain acyl-CoA dehydrogenase deficiency		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Very long chain acyl-CoA dehydrogenase deficiency	ClinVar	PMID:11590124\|PMID:28492532\|PMID:9973285
Chrnb1	Rat	Weissenbacher-Zweymuller syndrome		ISO	RGD:733898	8554872	ClinVar Annotator: match by term: Glossoptosis, micrognathia, and cleft palate	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	congenital myasthenic syndrome		ISO	RGD:733898	11554173	CTD Direct Evidence: marker/mechanism	CTD
Chrnb1	Rat	Congenital Myasthenic Syndrome, with Facial Dysmorphism, associated with Acetylcholine Receptor Deficiency		ISO	RGD:733898	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	congenital myasthenic syndrome 2A		ISO	RGD:733898	7240710		OMIM
Chrnb1	Rat	congenital myasthenic syndrome 2C		ISO	RGD:733898	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:10358	6480464	1,2-Dimethylhydrazine results in increased expression of CHRNB1 mRNA	CTD	PMID:22206623
Chrnb1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:10358	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to CHRNB1 promoter]	CTD	PMID:19654925
Chrnb1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:10358	6480464	Tetrachlorodibenzodioxin affects the expression of CHRNB1 mRNA	CTD	PMID:21570461
Chrnb1	Rat	3-methylcholanthrene	multiple interactions	ISO	RGD:10358	6480464	[Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of CHRNB1 mRNA	CTD	PMID:23519560
Chrnb1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:10358	6480464	Fenretinide results in increased expression of CHRNB1 mRNA	CTD	PMID:28973697
Chrnb1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CHRNB1 mRNA	CTD	PMID:24780913
Chrnb1	Rat	acetylcholine	multiple interactions	ISO	RGD:733898	6480464	Acetylcholine binds to and results in increased activity of [CHRNA1 protein binds to CHRNA1 protein more ...	CTD	PMID:16931985\|PMID:22461452
Chrnb1	Rat	acetylcholine	multiple interactions	EXP		6480464	Acetylcholine binds to and results in increased activity of [CHRNA1 protein binds to CHRNA1 protein more ...	CTD	PMID:22461452
Chrnb1	Rat	acrylamide	increases expression	ISO	RGD:733898	6480464	Acrylamide results in increased expression of CHRNB1 mRNA	CTD	PMID:32763439
Chrnb1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:10358	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of CHRNB1 mRNA	CTD	PMID:30951980
Chrnb1	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of CHRNB1 mRNA	CTD	PMID:35163327
Chrnb1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CHRNB1 mRNA	CTD	PMID:35163327
Chrnb1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of CHRNB1 mRNA	CTD	PMID:16483693
Chrnb1	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of CHRNB1 mRNA	CTD	PMID:36841081
Chrnb1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:733898	6480464	Benzo(a)pyrene results in decreased expression of CHRNB1 mRNA	CTD	PMID:20106945
Chrnb1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:733898	6480464	Benzo(a)pyrene results in decreased methylation of CHRNB1 exon	CTD	PMID:27901495
Chrnb1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:733898	6480464	Benzo(a)pyrene affects the methylation of CHRNB1 promoter	CTD	PMID:27901495
Chrnb1	Rat	Benzo[k]fluoranthene	decreases expression	ISO	RGD:10358	6480464	benzo(k)fluoranthene results in decreased expression of CHRNB1 mRNA	CTD	PMID:26377693
Chrnb1	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CHRNB1 mRNA	CTD	PMID:18164116
Chrnb1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CHRNB1 mRNA	CTD	PMID:25181051
Chrnb1	Rat	bisphenol A	decreases methylation	ISO	RGD:733898	6480464	bisphenol A results in decreased methylation of CHRNB1 gene	CTD	PMID:31601247
Chrnb1	Rat	bisphenol A	increases expression	ISO	RGD:10358	6480464	bisphenol A results in increased expression of CHRNB1 mRNA	CTD	PMID:34585602
Chrnb1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CHRNB1 mRNA	CTD	PMID:29552716
Chrnb1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CHRNB1 mRNA	CTD	PMID:30816183\|PMID:32528016
Chrnb1	Rat	bisphenol F	multiple interactions	ISO	RGD:10358	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of CHRNB1 mRNA	CTD	PMID:30951980
Chrnb1	Rat	carbon nanotube	increases expression	ISO	RGD:10358	6480464	Nanotubes, Carbon results in increased expression of CHRNB1 mRNA	CTD	PMID:25554681
Chrnb1	Rat	choline	multiple interactions	ISO	RGD:10358	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Chrnb1	Rat	copper atom	multiple interactions	ISO	RGD:10358	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Chrnb1	Rat	copper(0)	multiple interactions	ISO	RGD:10358	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Chrnb1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:733898	6480464	Copper Sulfate results in decreased expression of CHRNB1 mRNA	CTD	PMID:19549813
Chrnb1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of CHRNB1 mRNA	CTD	PMID:26577399
Chrnb1	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of CHRNB1 mRNA	CTD	PMID:23640034
Chrnb1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:733898	6480464	di-n-butylphosphoric acid affects the expression of CHRNB1 mRNA	CTD	PMID:37042841
Chrnb1	Rat	dibutyl phthalate	increases expression	ISO	RGD:10358	6480464	Dibutyl Phthalate results in increased expression of CHRNB1 mRNA	CTD	PMID:17361019\|PMID:21266533
Chrnb1	Rat	dichlorine	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in increased expression of CHRNB1 mRNA	CTD	PMID:18636392
Chrnb1	Rat	dioxygen	increases expression	ISO	RGD:733898	6480464	Oxygen deficiency results in increased expression of CHRNB1 mRNA	CTD	PMID:26516004
Chrnb1	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of CHRNB1 mRNA	CTD	PMID:25152437
Chrnb1	Rat	doxorubicin	decreases expression	ISO	RGD:733898	6480464	Doxorubicin results in decreased expression of CHRNB1 mRNA	CTD	PMID:29803840
Chrnb1	Rat	entinostat	increases expression	ISO	RGD:733898	6480464	entinostat results in increased expression of CHRNB1 mRNA	CTD	PMID:27188386
Chrnb1	Rat	epoxiconazole	decreases expression	ISO	RGD:10358	6480464	epoxiconazole results in decreased expression of CHRNB1 mRNA	CTD	PMID:35436446
Chrnb1	Rat	ethanol	decreases expression	ISO	RGD:733898	6480464	Ethanol results in decreased expression of CHRNB1 protein	CTD	PMID:20621659
Chrnb1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of CHRNB1 mRNA	CTD	PMID:30307764
Chrnb1	Rat	folic acid	multiple interactions	ISO	RGD:10358	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Chrnb1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of CHRNB1 mRNA	CTD	PMID:25539665
Chrnb1	Rat	gamma-aminobutyric acid	multiple interactions	ISO	RGD:733898	6480464	gamma-Aminobutyric Acid binds to and results in increased activity of [CHRNA5 protein co-treated with CHRNB1 more ...	CTD	PMID:8388298
Chrnb1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of CHRNB1 mRNA	CTD	PMID:33387578
Chrnb1	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of CHRNB1 mRNA	CTD	PMID:21396975
Chrnb1	Rat	inulin	multiple interactions	ISO	RGD:10358	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CHRNB1 mRNA	CTD	PMID:36331819
Chrnb1	Rat	L-methionine	multiple interactions	ISO	RGD:10358	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Chrnb1	Rat	mercury dichloride	multiple interactions	ISO	RGD:10358	6480464	Mercuric Chloride inhibits the reaction [AGRN protein results in increased phosphorylation of CHRNB1 protein]	CTD	PMID:15045580
Chrnb1	Rat	methamphetamine	increases expression	EXP		6480464	Methamphetamine results in increased expression of CHRNB1 mRNA	CTD	PMID:19564919
Chrnb1	Rat	muscimol	multiple interactions	ISO	RGD:733898	6480464	Muscimol binds to and results in increased activity of [CHRNA5 protein co-treated with CHRNB1 protein]	CTD	PMID:8388298
Chrnb1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CHRNB1 mRNA	CTD	PMID:18164116
Chrnb1	Rat	niclosamide	increases expression	ISO	RGD:733898	6480464	Niclosamide results in increased expression of CHRNB1 mRNA	CTD	PMID:36318118
Chrnb1	Rat	okadaic acid	decreases expression	ISO	RGD:733898	6480464	Okadaic Acid results in decreased expression of CHRNB1 mRNA	CTD	PMID:38832940
Chrnb1	Rat	ozone	multiple interactions	EXP		6480464	[Ozone co-treated with Chlorine] results in increased expression of CHRNB1 mRNA	CTD	PMID:18636392
Chrnb1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of CHRNB1 mRNA	CTD	PMID:17077588
Chrnb1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:10358	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CHRNB1 mRNA	CTD	PMID:36331819
Chrnb1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CHRNB1 mRNA	CTD	PMID:35163327
Chrnb1	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	RGD:10358	6480464	[Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of CHRNB1 mRNA	CTD	PMID:23519560
Chrnb1	Rat	resveratrol	decreases expression	ISO	RGD:733898	6480464	resveratrol results in decreased expression of CHRNB1 protein	CTD	PMID:18089832
Chrnb1	Rat	resveratrol	multiple interactions	ISO	RGD:733898	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of CHRNB1 mRNA	CTD	PMID:23557933
Chrnb1	Rat	sarin	decreases expression	ISO	RGD:733898	6480464	Sarin results in decreased expression of CHRNB1 mRNA	CTD	PMID:19522546
Chrnb1	Rat	SCH 23390	decreases expression	EXP		6480464	SCH 23390 results in decreased expression of CHRNB1 mRNA	CTD	PMID:19564919
Chrnb1	Rat	sodium arsenite	decreases expression	ISO	RGD:10358	6480464	sodium arsenite results in decreased expression of CHRNB1 mRNA	CTD	PMID:37682722
Chrnb1	Rat	sulforaphane	decreases expression	ISO	RGD:733898	6480464	sulforaphane results in decreased expression of CHRNB1 mRNA	CTD	PMID:31838189
Chrnb1	Rat	sulfoxaflor	multiple interactions	EXP		6480464	sulfoxaflor binds to and results in increased activity of [CHRNA1 protein binds to CHRNA1 protein more ...	CTD	PMID:22461452
Chrnb1	Rat	sunitinib	decreases expression	ISO	RGD:733898	6480464	Sunitinib results in decreased expression of CHRNB1 mRNA	CTD	PMID:31533062
Chrnb1	Rat	tetrachloromethane	increases expression	ISO	RGD:10358	6480464	Carbon Tetrachloride results in increased expression of CHRNB1 mRNA	CTD	PMID:17484886\|PMID:31919559
Chrnb1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of CHRNB1 mRNA	CTD	PMID:34492290
Chrnb1	Rat	titanium dioxide	decreases methylation	ISO	RGD:10358	6480464	titanium dioxide results in decreased methylation of CHRNB1 gene	CTD	PMID:35295148
Chrnb1	Rat	triphenyl phosphate	affects expression	ISO	RGD:733898	6480464	triphenyl phosphate affects the expression of CHRNB1 mRNA	CTD	PMID:37042841

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	acetylcholine receptor signaling pathway	involved_in	IBA	MGI:87891\|PANTHER:PTN001450431\|RGD:2350	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	behavioral response to nicotine	involved_in	ISO	RGD:733898	1624291	PMID:16874522	RGD	PMID:16874522
Chrnb1	Rat	behavioral response to nicotine	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	chemical synaptic transmission	involved_in	IBA	FB:FBgn0000036\|FB:FBgn0000038\|FB:FBgn0000039\|FB:FBgn0004118\|FB:FBgn0032151\|FB:FBgn0086778\|MGI:3609260\|MGI:87887\|MGI:87888\|MGI:87891\|MGI:87892\|MGI:99779\|PANTHER:PTN000434994\|RGD:2346\|RGD:2348\|RGD:2350\|UniProtKB:P02708\|UniProtKB:P11230\|UniProtKB:P30926\|UniProtKB:P32297\|UniProtKB:P36544\|WB:WBGene00000042\|WB:WBGene00000050\|WB:WBGene00000054\|WB:WBGene00001133\|WB:WBGene00006765\|WB:WBGene00006774\|WB:WBGene00006797\|ZFIN:ZDB-GENE-030131-3805\|ZFIN:ZDB-GENE-040808-32\|ZFIN:ZDB-GENE-070821-4\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	excitatory postsynaptic potential	involved_in	IEA	GO:0022848	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Chrnb1	Rat	membrane depolarization	involved_in	IBA	MGI:87891\|PANTHER:PTN001450431	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	monoatomic cation transport		IDA		8549758		RGD
Chrnb1	Rat	monoatomic cation transport	involved_in	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	monoatomic cation transport	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrnb1	Rat	monoatomic ion transmembrane transport	involved_in	IBA	FB:FBgn0000036\|FB:FBgn0000039\|PANTHER:PTN000434994\|RGD:2348\|UniProtKB:P36544\|UniProtKB:Q401N2\|WB:WBGene00000042\|WB:WBGene00000043\|WB:WBGene00000051\|WB:WBGene00000055\|WB:WBGene00002974\|WB:WBGene00006774\|WB:WBGene00006797	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	monoatomic ion transmembrane transport	involved_in	IEA	InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrnb1	Rat	monoatomic ion transport	involved_in	IEA	InterPro:IPR002394\|InterPro:IPR006029\|InterPro:IPR006202\|InterPro:IPR036719\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	muscle cell development	involved_in	ISO	RGD:733898	1624291	PMID:8651643	RGD	PMID:8651643
Chrnb1	Rat	muscle cell development	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	muscle contraction	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	muscle contraction	involved_in	ISO	RGD:733898	1624291	PMID:8651643	RGD	PMID:8651643
Chrnb1	Rat	nervous system process	involved_in	ISO	RGD:733898	1624291	PMID:11104662	RGD	PMID:11104662
Chrnb1	Rat	nervous system process	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	neuromuscular synaptic transmission	involved_in	ISO	RGD:733898	1624291	PMID:8651643	RGD	PMID:8651643
Chrnb1	Rat	neuromuscular synaptic transmission	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	postsynaptic membrane organization	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	postsynaptic membrane organization	involved_in	ISO	RGD:733898	1624291	PMID:8651643	RGD	PMID:8651643
Chrnb1	Rat	regulation of membrane potential	acts_upstream_of_or_within	ISO	RGD:10358	1624291	MGI:87885\|MGI:87893\|MGI:87894\|MGI:87895 PMID:2383398, PMID:8798466	RGD	PMID:2383398\|PMID:8798466
Chrnb1	Rat	regulation of membrane potential	acts_upstream_of_or_within	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	regulation of postsynaptic membrane potential	involved_in	IEA	GO:0022848	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Chrnb1	Rat	regulation of postsynaptic membrane potential	involved_in	IEA	GO:1904315	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Chrnb1	Rat	signal transduction	involved_in	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	signal transduction	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	skeletal muscle contraction		IDA		8549758		RGD
Chrnb1	Rat	synaptic transmission, cholinergic	involved_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	synaptic transmission, cholinergic	involved_in	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	acetylcholine-gated channel complex		IDA		8549758		RGD
Chrnb1	Rat	acetylcholine-gated channel complex	part_of	ISO	RGD:10358	1624291	PMID:8798466	RGD	PMID:8798466
Chrnb1	Rat	acetylcholine-gated channel complex	part_of	IBA	FB:FBgn0000036\|FB:FBgn0000039\|FB:FBgn0015519\|FB:FBgn0266347\|MGI:106213\|MGI:87885\|MGI:87887\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87893\|MGI:87895\|PANTHER:PTN000435923\|RGD:2345\|RGD:2346\|RGD:2347\|RGD:2349\|RGD:2350\|RGD:2351\|RGD:2352\|RGD:2353\|RGD:2354\|RGD:621544\|RGD:69277\|UniProtKB:P11230\|UniProtKB:P17787\|UniProtKB:P30926\|UniProtKB:P32297\|UniProtKB:P43681\|UniProtKB:Q15822\|ZFIN:ZDB-GENE-030131-3805\|ZFIN:ZDB-GENE-040108-2\|ZFIN:ZDB-GENE-040808-32\|ZFIN:ZDB-GENE-060811-1\|ZFIN:ZDB-GENE-070821-4\|ZFIN:ZDB-GENE-090505-3\|ZFIN:ZDB-GENE-120809-1\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	acetylcholine-gated channel complex	part_of	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	acetylcholine-gated channel complex	part_of	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	acetylcholine-gated channel complex	part_of	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrnb1	Rat	membrane	located_in	IEA	InterPro:IPR002394\|InterPro:IPR006029\|InterPro:IPR006201\|InterPro:IPR006202\|InterPro:IPR036719\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	neuromuscular junction	is_active_in	ISO	RGD:733898	1624291	PMID:7531341	RGD	PMID:7531341
Chrnb1	Rat	neuromuscular junction	is_active_in	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	neuromuscular junction	is_active_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	neuromuscular junction	is_active_in	ISO	RGD:10358	1624291	PMID:4781450	RGD	PMID:4781450
Chrnb1	Rat	neuron projection	is_active_in	IBA	FB:FBgn0086778\|MGI:99779\|PANTHER:PTN000434994\|RGD:2345\|RGD:2346\|RGD:2347\|RGD:2348\|RGD:61818\|RGD:61820\|RGD:620142\|RGD:621533\|UniProtKB:P09484\|UniProtKB:P22770\|UniProtKB:Q03481\|WB:WBGene00000042\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrnb1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Chrnb1	Rat	plasma membrane	located_in	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	plasma membrane	located_in	ISO	RGD:10358	1624291	PMID:12388596	RGD	PMID:12388596
Chrnb1	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0000036\|FB:FBgn0000038\|FB:FBgn0000039\|FB:FBgn0015519\|FB:FBgn0028875\|FB:FBgn0032151\|FB:FBgn0086778\|FB:FBgn0266347\|MGI:106213\|MGI:1861899\|MGI:87885\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87892\|MGI:87894\|MGI:87895\|MGI:96282\|MGI:99779\|PANTHER:PTN000434994\|RGD:2346\|RGD:2347\|RGD:2349\|RGD:2350\|RGD:2351\|RGD:2354\|RGD:61818\|RGD:620142\|RGD:621534\|RGD:621544\|RGD:69281\|UniProtKB:A5X5Y0\|UniProtKB:O95264\|UniProtKB:P02708\|UniProtKB:P11230\|UniProtKB:P17787\|UniProtKB:P30926\|UniProtKB:P32297\|UniProtKB:P36544\|UniProtKB:P43681\|UniProtKB:P46098\|UniProtKB:Q07001\|UniProtKB:Q15822\|UniProtKB:Q401N2\|UniProtKB:Q70Z44\|UniProtKB:Q866A2\|UniProtKB:Q8WXA8\|UniProtKB:Q9UGM1\|WB:WBGene00000955\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774\|WB:WBGene00006797\|ZFIN:ZDB-GENE-030131-3805\|ZFIN:ZDB-GENE-030131-6665\|ZFIN:ZDB-GENE-040108-3\|ZFIN:ZDB-GENE-040808-32\|ZFIN:ZDB-GENE-060811-1\|ZFIN:ZDB-GENE-070821-4\|ZFIN:ZDB-GENE-090505-3\|ZFIN:ZDB-GENE-120809-1\|ZFIN:ZDB-GENE-980526-137	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0219	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Chrnb1	Rat	postsynaptic membrane	located_in	IEA	InterPro:IPR002394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	postsynaptic membrane	located_in	IEA	UniProtKB-KW:KW-0628	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Chrnb1	Rat	postsynaptic specialization membrane	is_active_in	ISO	RGD:10358	1624291	PMID:4781450	RGD	PMID:4781450
Chrnb1	Rat	postsynaptic specialization membrane	is_active_in	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	synapse	located_in	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	synapse	located_in	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	synapse	is_active_in	IBA	FB:FBgn0000038\|FB:FBgn0086778\|MGI:106212\|MGI:106213\|MGI:87885\|MGI:87887\|MGI:87888\|MGI:87889\|MGI:87890\|MGI:87891\|MGI:87892\|MGI:87893\|MGI:87894\|MGI:87895\|MGI:99779\|PANTHER:PTN000434994\|RGD:2345\|RGD:2346\|RGD:2348\|RGD:2350\|RGD:61818\|RGD:620142\|RGD:621534\|RGD:69281\|UniProtKB:P02708\|UniProtKB:P02715\|UniProtKB:P11230\|UniProtKB:P13536\|UniProtKB:P36544\|UniProtKB:Q04844\|UniProtKB:Q07001\|UniProtKB:Q866A2\|WB:WBGene00000051\|WB:WBGene00001133\|WB:WBGene00002974\|WB:WBGene00006765\|WB:WBGene00006774\|WB:WBGene00006797	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	acetylcholine binding	enables	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	acetylcholine binding	enables	ISO	RGD:10358	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	acetylcholine receptor activity	contributes_to	ISO	RGD:733898	1624291	PMID:8651643, PMID:8872460	RGD	PMID:8651643\|PMID:8872460
Chrnb1	Rat	acetylcholine receptor activity	contributes_to	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	acetylcholine receptor activity	enables	IBA	PANTHER:PTN001450431\|UniProtKB:P17787\|UniProtKB:P30926	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity		IDA		68734		RGD
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity	contributes_to	ISO	RGD:10358	1624291	MGI:87885\|MGI:87893\|MGI:87894\|MGI:87895 PMID:2383398	RGD	PMID:2383398
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity	contributes_to	IEA	UniProtKB:P09690\|ensembl:ENSMUSP00000047270	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	ISO	RGD:10358	1624291	MGI:87893\|MGI:87895 PMID:8798466	RGD	PMID:8798466
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	IBA	MGI:87891\|MGI:87895\|PANTHER:PTN002707650\|RGD:2349\|RGD:2350\|RGD:2352\|RGD:2353\|RGD:2354\|UniProtKB:P17787\|UniProtKB:P30926\|ZFIN:ZDB-GENE-030131-6665	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity	enables	IEA	InterPro:IPR002394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	acetylcholine-gated monoatomic cation-selective channel activity		IDA		8549758		RGD
Chrnb1	Rat	channel activity	enables	ISO	RGD:733898	1624291	PMID:8872460	RGD	PMID:8872460
Chrnb1	Rat	channel activity	enables	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Chrnb1	Rat	extracellular ligand-gated monoatomic ion channel activity	enables	IEA	InterPro:IPR006202\|InterPro:IPR036734	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	ligand-gated monoatomic ion channel activity		IDA		68734		RGD
Chrnb1	Rat	monoatomic ion channel activity	enables	IEA	InterPro:IPR002394\|InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	protein binding	enables	ISO	RGD:733898	1624291	UniProtKB:Q9NWX5 PMID:32296183	RGD	PMID:32296183
Chrnb1	Rat	protein binding	enables	ISO	RGD:10358	1624291	PR:P02716\|PR:P04760\|PR:P35564 PMID:8798466	RGD	PMID:8798466
Chrnb1	Rat	transmembrane signaling receptor activity	enables	IEA	InterPro:IPR006201	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Chrnb1	Rat	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	enables	ISO	RGD:733898	1624291	PMID:7531341	RGD	PMID:7531341
Chrnb1	Rat	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	enables	IEA	UniProtKB:P11230\|ensembl:ENSP00000304290	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Chrnb1	Rat	acetylcholine signaling pathway via nicotinic acetylcholine receptor		ISO	RGD:10358	8549508		RGD
Chrnb1	Rat	acetylcholine signaling pathway via nicotinic acetylcholine receptor		ISO	RGD:733898	8549510		RGD

#	Reference Title	Reference Citation
1.	Multiple inhibitory actions of lidocaine on Torpedo nicotinic acetylcholine receptors transplanted to Xenopus oocytes.	Alberola-Die A, etal., J Neurochem. 2011 Jun;117(6):1009-19. doi: 10.1111/j.1471-4159.2011.07271.x. Epub 2011 May 10.
2.	Mammalian nicotinic acetylcholine receptors: from structure to function.	Albuquerque EX, etal., Physiol Rev. 2009 Jan;89(1):73-120. doi: 10.1152/physrev.00015.2008.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
9.	A novel mode-of-action mediated by the fetal muscle nicotinic acetylcholine receptor resulting in developmental toxicity in rats.	Rasoulpour RJ, etal., Toxicol Sci. 2012 Jun;127(2):522-34. doi: 10.1093/toxsci/kfs118. Epub 2012 Mar 29.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.	Refined structure of the nicotinic acetylcholine receptor at 4A resolution.	Unwin N, J Mol Biol. 2005 Mar 4;346(4):967-89. doi: 10.1016/j.jmb.2004.12.031. Epub 2005 Jan 25.
15.	Primary structure and functional expression of the alpha-, beta-, gamma-, delta- and epsilon-subunits of the acetylcholine receptor from rat muscle.	Witzemann V, etal., Eur J Biochem 1990 Dec 12;194(2):437-48.
16.	The neuromuscular junction: selective remodeling of synaptic regulators at the nerve/muscle interface.	Witzemann V, etal., Mech Dev. 2013 Jun-Aug;130(6-8):402-11. doi: 10.1016/j.mod.2012.09.004. Epub 2012 Sep 29.

PMID:2383398	PMID:4781450	PMID:7531341	PMID:8651643	PMID:8798466	PMID:8872460	PMID:11104662	PMID:12388596	PMID:16874522	PMID:31172341

Chrnb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,999,943 - 55,015,137 (-)	NCBI		GRCr8
mRatBN7.2	10	54,501,096 - 54,516,418 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,501,093 - 54,516,345 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,166,354 - 59,178,879 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,654,919 - 58,667,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,162,545 - 54,175,096 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,390,671 - 56,403,255 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,390,671 - 56,403,188 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,135,720 - 56,148,237 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,604,907 - 56,617,423 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,618,529 - 56,631,046 (-)	NCBI
Celera	10	53,658,103 - 53,670,628 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

CHRNB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,445,061 - 7,457,710 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,445,061 - 7,457,710 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,348,380 - 7,361,029 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,289,130 - 7,301,656 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	7,289,129 - 7,301,656	NCBI
Celera	17	7,374,294 - 7,386,883 (+)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,242,351 - 7,254,625 (+)	NCBI		HuRef
CHM1_1	17	7,357,504 - 7,370,035 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,349,120 - 7,361,750 (+)	NCBI		T2T-CHM13v2.0

Chrnb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,674,862 - 69,686,742 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,674,862 - 69,686,769 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,784,036 - 69,795,966 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,784,036 - 69,795,943 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,597,538 - 69,609,439 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,600,232 - 69,612,138 (-)	NCBI		MGSCv36	mm8
MGSCv36	11	70,368,144 - 70,380,050 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.87	NCBI

Chrnb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	9,471,962 - 9,482,370 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	9,471,962 - 9,482,370 (-)	NCBI	ChiLan1.0	ChiLan1.0

CHRNB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	15,041,812 - 15,053,022 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	17,007,603 - 17,018,838 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,479,056 - 7,490,314 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,465,229 - 7,476,099 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,465,229 - 7,476,099 (+)	Ensembl	panpan1.1		panPan2

CHRNB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,375,152 - 32,383,517 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,375,215 - 32,382,929 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,513,277 - 32,521,649 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,480,862 - 32,489,239 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,480,903 - 32,489,017 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,446,084 - 32,454,448 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,404,809 - 32,413,162 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,582,085 - 32,590,461 (+)	NCBI		UU_Cfam_GSD_1.0

Chrnb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,253,704 - 47,261,819 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	727,980 - 735,783 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	727,907 - 735,783 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHRNB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	52,749,473 - 52,758,488 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	52,749,422 - 52,774,642 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,977,614 - 55,002,976 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHRNB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	6,821,842 - 6,832,758 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	6,822,065 - 6,833,768 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	14,575,541 - 14,586,609 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chrnb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	10,056,478 - 10,065,735 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	10,056,458 - 10,065,768 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Chrnb1
55 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	248
Count of miRNA genes:	163
Interacting mature miRNAs:	184
Transcripts:	ENSRNOT00000019947
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

D10M11Mit224

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	54,514,258 - 54,514,389 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	56,401,064 - 56,401,194	NCBI	Rnor6.0
Rnor_5.0	10	56,146,113 - 56,146,243	UniSTS	Rnor5.0
RGSC_v3.4	10	56,615,300 - 56,615,430	UniSTS	RGSC3.4
Celera	10	53,668,505 - 53,668,635	UniSTS
Cytogenetic Map	10	q24	UniSTS

AU048763

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	10	56,137,738 - 56,137,993	UniSTS	Rnor5.0
Cytogenetic Map	10	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001395118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429879	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_012528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X73887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019947 ⟹ ENSRNOP00000019947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,503,851 - 54,516,332 (-)	Ensembl
Rnor_6.0 Ensembl	10	56,390,671 - 56,403,188 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110050 ⟹ ENSRNOP00000089285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,501,093 - 54,516,345 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111731 ⟹ ENSRNOP00000094079

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,503,871 - 54,516,329 (-)	Ensembl

RefSeq Acc Id:

NM_001395118 ⟹ NP_001382047

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,002,577 - 55,015,107 (-)	NCBI
mRatBN7.2	10	54,503,854 - 54,516,383 (-)	NCBI

RefSeq Acc Id:

NM_012528 ⟹ NP_036660

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,002,577 - 55,015,107 (-)	NCBI
mRatBN7.2	10	54,503,854 - 54,516,383 (-)	NCBI
Rnor_6.0	10	56,390,671 - 56,403,188 (-)	NCBI
Rnor_5.0	10	56,135,720 - 56,148,237 (-)	NCBI
RGSC_v3.4	10	56,604,907 - 56,617,423 (-)	RGD
Celera	10	53,658,103 - 53,670,628 (-)	RGD

Sequence:

show sequence

CGTCACTTCCCCTGGCCTGGCGGCCTCGGCCGCACTTCGGACAAACCCACTGAGCGAAATCGGCAGGGCCATGGCCTTAGGGGCGCTGCTTCTGATTCTGGGGATACTCGGGACGCCCCTCGCCCCAG
GAGCCCGCGGGTCGGAAGCCGAAGGCCAACTGCTTAAGAAACTTTTCTCGGATTATGATAGCTCAGTAAGGCCGGCGCAGGAGGTGGGAGACCGCGTCGGGGTCAGCATCGGCCTCACCCTGGCGCAA
CTCATCAGCCTGAACGAGAAGGATGAAGAAATGAGCACAAAGGTGTACTTAGACCTGGAGTGGACCGACTACAGGTTAAGCTGGGACCCCGCAGAACACGATGGCATCGAGTCTCTCCGTGTCACTGC
TGAATCTGTTTGGCTCCCGGACGTGGTGCTGCTGAACAACAATGATGGAAACTTTGACGTTGCCCTGGACATTAATGTCGTGGTGTCCTTTGAGGGCTCTGTGCGCTGGCAACCCCCTGGCCTGTATC
GCAGCAGCTGCAGCATCCAGGTCACCTACTTCCCCTTTGACTGGCAGAATTGCACCATGGTGTTTAGTTCCTACAGCTATGACAGCTCTGAGGTCAGCCTGAAGACAGGCCCAGATCCTGATGGACAG
GAGAGGCAGGAAATCTACATCCATGAAGGGACCTTCATCGAGAATGGTCAATGGGAGATTATCCACAAACCCTCTAGGTTAATCCACCTTCCAGGGGATCGAAGAGGAGGGAAGGAAGGACATCGTGA
GGAAGTTATCTTCTATCTCATTATTCGGAGGAAGCCTCTCTTCTACCTGGTCAATGTCATTGCCCCGTGCATCCTCATCACCCTCCTGGCCATCTTTGTTTTCTACCTTCCACCAGATGCAGGAGAGA
AGATGGGGCTCTCCATCTTTGCCCTGCTGACCCTCACTGTGTTCTTGCTGCTGCTGGCCGACAAAGTGCCTGAGACCTCCCTGGCGGTCCCCATCATCATCAAGTATCTCATGTTTACCATGATCCTT
GTCACCTTCTCAGTTATCCTTAGCGTTGTGGTCCTCAACTTGCACCATCGCTCACCCCACACCCACCAAATGCCCTTTTGGGTCCGCCAGATCTTCATTCACAAGCTCCCTCCATACCTGGGTCTGAA
GAGGCCCAAACCCGAGAGAGACCAACTACCCGAACCACATCACTCCTTCTCCCCAAGGAGTGGCTGGGGCCGAGGAACTGATGAATATTTCATACGGAAGCCTCCATGTGATTTTCTTTTCCCTAAAC
TTAACAGGTTTCAGCCTGAATCACCTGCTCCGGACCTGAGACGATTTATCGATGGTCCACCCCGGGCTGTAGGTCTGCCTCAGGAGCTACGCGAGGTCATTTCTTCCATCAGCTACATGGCCCGACAA
CTTCAGGAACAGGAGGACCACGATGCACTGAAGGAGGACTGGCAGTTTGTCGCCATGGTTGTGGACCGTCTTTTTCTGTGGACATTCATCGTTTTCACAAGCGTCGGGACGCTAGTCATTTTCCTAGA
TGCCACGTACCATTTGCCCCCTCCTGAACCTTTTCCTTGAGGACCCTCCGGTCATTTTTGCCAAGTGCTGCAGGTACTCTCACGCTGTATAGCGCTTGGCTCCTGTAAGAATCTTGTTCTTGTTTCTG
GGAAGACGTTGAAGTGGGACTTGGGGGGGTGAGCAGGGTGCCTTGGACTTCAACAAATGTCCTTCAACCCATTAGTTTTGTTCTTCTGCAGCTTTGTTTTTGTTGGTTTTTTTTTGTTGTTGTTTTTT
TGTCGTCCCCCCCCCCCCCCCCCCCCGGCTGGGGAGCGAACCCAGGATCTTGCGCTTCCTAGGTAGAAGCGCTCTACCACTGAGCCAAATCCCCAACCCCGTTTTTGTTGTTTTTGAGACAGAGTCTC
ACTCTGTGTCCCAGGCTAGCCTGGAACTATGAAGTCCAGGCTGGCCTCAAACTCCCAGCAGTGTTACTTCCTTAGCTTACCAAATGTTGGAATGGCAGGTCTGGTAAGCCAGCGCACTTGGATTTTGT
TTCTTGAAACTACACAGAATGTCACAACTTAGATATCTAGTGAAAGAGAATTATAAGCAACTAGTAGCTTGAAAGCCTTTGGAGGACAGGAAATCTGTTGGCTACTGTAAGGTCCCCAGCAATGCGCA
CAGGTCCTACCCCATAAGTGCTTAACATTTGTTGAAGAGGGAAAAAAATCCGGAAGGAAATACAAAATAATACTGCCTACAATTGCATGTATTGAAATTAAAATGTA

hide sequence

RefSeq Acc Id:

XM_039085172 ⟹ XP_038941100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,999,943 - 55,015,137 (-)	NCBI
mRatBN7.2	10	54,501,096 - 54,516,418 (-)	NCBI

RefSeq Acc Id:

XM_039085173 ⟹ XP_038941101

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,009,221 - 55,015,137 (-)	NCBI
mRatBN7.2	10	54,510,499 - 54,516,418 (-)	NCBI

RefSeq Acc Id:

XM_039085174 ⟹ XP_038941102

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,009,221 - 55,015,137 (-)	NCBI
mRatBN7.2	10	54,510,499 - 54,516,418 (-)	NCBI


Protein RefSeqs	NP_001382047	(Get FASTA)	NCBI Sequence Viewer
	NP_001416807	(Get FASTA)	NCBI Sequence Viewer
	NP_001416808	(Get FASTA)	NCBI Sequence Viewer
	NP_036660	(Get FASTA)	NCBI Sequence Viewer
	XP_038941100	(Get FASTA)	NCBI Sequence Viewer
	XP_038941101	(Get FASTA)	NCBI Sequence Viewer
	XP_038941102	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA52093	(Get FASTA)	NCBI Sequence Viewer
	CAA52827	(Get FASTA)	NCBI Sequence Viewer
	EDM04893	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000089285
	ENSRNOP00000089285.1
GenBank Protein	P25109	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036660 ⟸ NM_012528
- Peptide Label:	isoform 2 precursor
- UniProtKB:	P25109 (UniProtKB/Swiss-Prot), A6HFT8 (UniProtKB/TrEMBL), A0A8I6AYT8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALGALLLILGILGTPLAPGARGSEAEGQLLKKLFSDYDSSVRPAQEVGDRVGVSIGLTLAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIESLRVTAESVWLPDVVLLNNNDGNFDVALD INVVVSFEGSVRWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLKTGPDPDGQERQEIYIHEGTFIENGQWEIIHKPSRLIHLPGDRRGGKEGHREEVIFYLIIRRKPLFYLVNVIAPC ILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLAVPIIIKYLMFTMILVTFSVILSVVVLNLHHRSPHTHQMPFWVRQIFIHKLPPYLGLKRPKPERDQLPEPHHSFSPRSGWG RGTDEYFIRKPPCDFLFPKLNRFQPESPAPDLRRFIDGPPRAVGLPQELREVISSISYMARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIVFTSVGTLVIFLDATYHLPPPEPFP hide sequence

Ensembl Acc Id:

ENSRNOP00000019947 ⟸ ENSRNOT00000019947

RefSeq Acc Id:	XP_038941100 ⟸ XM_039085172
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2UJI2 (UniProtKB/TrEMBL), A0A8I6AYT8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941102 ⟸ XM_039085174
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038941101 ⟸ XM_039085173
- Peptide Label:	isoform X2

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P25109-F1-model_v2	AlphaFold	P25109	1-501	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24517	BioCyc
Ensembl Genes	ENSRNOG00000014698	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000110050	ENTREZGENE
	ENSRNOT00000110050.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
	Nicotinic_acetylcholine_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:24261	UniProtKB/Swiss-Prot
NCBI Gene	24261	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Chrnb1	PhenoGen
PRINTS	NICOTINICR	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014698	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
TIGR	TC235926
UniProt	A0A8I6AYT8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UJI2	ENTREZGENE, UniProtKB/TrEMBL
	A6HFT8	ENTREZGENE, UniProtKB/TrEMBL
	ACHB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Chrnb1	cholinergic receptor nicotinic beta 1 subunit	Chrnb1	cholinergic receptor, nicotinic beta 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-12-16	Chrnb1	cholinergic receptor, nicotinic beta 1	Chrnb1	cholinergic receptor, nicotinic, beta 1 (muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Chrnb1	cholinergic receptor, nicotinic, beta 1 (muscle)	Chrnb1	cholinergic receptor, nicotinic, beta polypeptide 1 (muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Chrnb1	cholinergic receptor, nicotinic, beta polypeptide 1 (muscle)		cholinergic receptor, nicotinic, beta polypeptide 1	Name updated	1299863	APPROVED
2002-06-10	Chrnb1	cholinergic receptor, nicotinic, beta polypeptide 1			Symbol and Name status set to approved	70586	APPROVED
2001-07-23	Chrnb1	Acetylcholine receptor beta			Name withdrawn	67952	WITHDRAWN
2001-07-23	Chrnb1	cholinergic receptor, nicotinic, beta polypeptide 1(muscle)			Name updated to reflect Human and Mouse nomenclature	67952	APPROVED

Note Type	Note	Reference
gene_expression	expressed in muscle	68734

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations