Symbol:
Cd59b
Name:
CD59b molecule
RGD ID:
2311
Description:
Enables complement binding activity. Involved in several processes, including negative regulation of activation of membrane attack complex; negative regulation of complement-dependent cytotoxicity; and positive regulation of T cell proliferation. Located in compact myelin; extracellular space; and sarcolemma. Used to study anterior uveitis; colorectal carcinoma; glomerulonephritis; nephrosis; and neuromyelitis optica. Biomarker of acute necrotizing pancreatitis; diabetic retinopathy; and myocardial infarction. Human ortholog(s) of this gene implicated in colorectal carcinoma and ovarian cancer. Orthologous to human CD59 (CD59 molecule (CD59 blood group)); PARTICIPATES IN coagulation cascade pathway; complement system pathway; INTERACTS WITH (+)-schisandrin B; 1,3-Propane sultone; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Cb59b molecule; Cd59; CD59 antigen; CD59 glycoprotein; CD59 molecule, complement regulatory protein; Cd59a; CD59b moleucle, complement regulatory protein; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; membrane attack complex inhibition factor; protectin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Cd59em1Ask
Genetic Models:
SD-Cd59em1Ask -/-
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 110,914,008 - 110,932,489 (+) NCBI GRCr8 mRatBN7.2 3 90,459,085 - 90,477,571 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 90,459,162 - 90,478,847 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 93,952,281 - 93,970,470 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 102,551,356 - 102,569,545 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 100,381,722 - 100,399,939 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 94,010,481 - 94,028,660 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 94,010,475 - 94,028,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 100,650,411 - 100,668,036 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 89,243,600 - 89,245,129 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 89,318,629 - 89,333,534 (-) NCBI Celera 3 89,520,423 - 89,538,310 (+) NCBI Celera Cytogenetic Map 3 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd59b Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CD59 mRNA] CTD PMID:31150632 Cd59b Rat (-)-alpha-phellandrene decreases expression ISO CD59 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of CD59A mRNA CTD PMID:25075043 Cd59b Rat (S)-colchicine increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Colchicine results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat (S)-nicotine increases expression ISO CD59 (Homo sapiens) 6480464 Nicotine results in increased expression of CD59 mRNA CTD PMID:18247414 Cd59b Rat 1,3-Propane sultone decreases lipidation EXP 6480464 1 and 3-propane sultone results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CD59 mRNA CTD PMID:17557909 Cd59b Rat 17beta-estradiol multiple interactions ISO CD59 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of CD59 mRNA CTD PMID:30165855 Cd59b Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CD59 (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Cd59b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cd59b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CD59B mRNA CTD PMID:21570461 Cd59b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CD59 mRNA CTD PMID:34747641 Cd59b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CD59 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CD59 mRNA CTD PMID:22574217 Cd59b Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO CD59 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Cd59b Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO CD59 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of CD59 protein CTD PMID:32044396 Cd59b Rat 2-hydroxypropanoic acid decreases expression ISO CD59 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CD59 mRNA CTD PMID:30851411 Cd59b Rat 2-naphthylamine increases expression ISO CD59 (Homo sapiens) 6480464 2-Naphthylamine results in increased expression of CD59 mRNA CTD PMID:18247414 Cd59b Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cd59b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CD59B mRNA CTD PMID:26251327 Cd59b Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Cd59b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of CD59B promoter CTD PMID:26251327 Cd59b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CD59 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CD59 mRNA CTD PMID:28628672 Cd59b Rat 3-methylcholanthrene increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Methylcholanthrene results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat 4,4'-sulfonyldiphenol multiple interactions ISO CD59 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CD59 mRNA CTD PMID:28628672 Cd59b Rat 4-nitroquinoline N-oxide multiple interactions EXP 6480464 [4-Nitroquinoline-1-oxide results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein and [4-Nitroquinoline-1-oxide results in increased mutagenesis of PIGA gene] which results in decreased expression of CD59 protein CTD PMID:19965957 and PMID:20202993 Cd59b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CD59 mRNA CTD PMID:24780913 Cd59b Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:19965957 and PMID:20202993 Cd59b Rat aflatoxin B1 affects expression ISO CD59 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CD59 protein CTD PMID:20106945 Cd59b Rat all-trans-retinoic acid increases expression ISO CD59 (Homo sapiens) 6480464 Tretinoin results in increased expression of CD59 mRNA CTD PMID:33167477 Cd59b Rat alpha-phellandrene decreases expression ISO CD59 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of CD59A mRNA CTD PMID:25075043 Cd59b Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CD59 mRNA CTD PMID:35163327 Cd59b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD59 mRNA CTD PMID:16483693 Cd59b Rat aristolochic acid A decreases expression ISO CD59 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CD59 mRNA CTD PMID:33212167 Cd59b Rat aristolochic acids decreases lipidation EXP 6480464 Aristolochic Acids results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat arsane affects methylation ISO CD59 (Homo sapiens) 6480464 Arsenic affects the methylation of CD59 gene CTD PMID:25304211 Cd59b Rat arsenic atom affects methylation ISO CD59 (Homo sapiens) 6480464 Arsenic affects the methylation of CD59 gene CTD PMID:25304211 Cd59b Rat benzene increases expression ISO CD59 (Homo sapiens) 6480464 Benzene results in increased expression of CD59 mRNA CTD PMID:16188091 Cd59b Rat benzo[a]pyrene increases expression ISO CD59 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CD59 mRNA CTD PMID:18247414 Cd59b Rat benzo[a]pyrene affects methylation ISO CD59 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CD59 3' UTR and Benzo(a)pyrene affects the methylation of CD59 5' UTR CTD PMID:27901495 and PMID:30157460 Cd59b Rat benzo[a]pyrene increases methylation ISO CD59 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CD59 promoter CTD PMID:27901495 Cd59b Rat benzo[a]pyrene decreases lipidation EXP 6480464 Benzo(a)pyrene results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat benzo[a]pyrene increases expression ISO Cd59b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CD59B mRNA CTD PMID:22228805 Cd59b Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein and [Benzo(a)pyrene results in increased mutagenesis of PIGA gene] which results in decreased expression of CD59 protein CTD PMID:19965957 and PMID:20202993 Cd59b Rat benzo[a]pyrene increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat benzo[a]pyrene diol epoxide I increases expression ISO CD59 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Cd59b Rat beta-lapachone increases expression ISO CD59 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CD59 mRNA CTD PMID:38218311 Cd59b Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cd59b (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CD59B mRNA CTD PMID:34319233 Cd59b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CD59 mRNA CTD PMID:26496021 Cd59b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD59 mRNA CTD PMID:34947998 Cd59b Rat bisphenol A decreases expression ISO CD59 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CD59 mRNA CTD PMID:29275510 Cd59b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CD59 mRNA CTD PMID:25181051 more ... Cd59b Rat bisphenol AF increases expression ISO CD59 (Homo sapiens) 6480464 bisphenol AF results in increased expression of CD59 protein CTD PMID:34186270 Cd59b Rat Bisphenol B increases expression ISO CD59 (Homo sapiens) 6480464 bisphenol B results in increased expression of CD59 protein CTD PMID:34186270 Cd59b Rat bisphenol F increases expression ISO CD59 (Homo sapiens) 6480464 bisphenol F results in increased expression of CD59 protein CTD PMID:34186270 Cd59b Rat butanal decreases expression ISO CD59 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CD59 mRNA CTD PMID:26079696 Cd59b Rat cadmium atom multiple interactions ISO CD59 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CD59 mRNA CTD PMID:35301059 Cd59b Rat cadmium dichloride multiple interactions ISO CD59 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CD59 mRNA CTD PMID:35301059 Cd59b Rat caffeine increases expression ISO CD59 (Homo sapiens) 6480464 Caffeine results in increased expression of CD59 protein CTD PMID:31195006 Cd59b Rat calcitriol increases expression ISO CD59 (Homo sapiens) 6480464 Calcitriol results in increased expression of CD59 mRNA CTD PMID:21592394 Cd59b Rat calcitriol multiple interactions ISO CD59 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CD59 mRNA CTD PMID:21592394 Cd59b Rat cannabidiol decreases expression ISO CD59 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of CD59 mRNA CTD PMID:27932991 Cd59b Rat carbon nanotube decreases expression ISO Cd59b (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of CD59B mRNA CTD PMID:25620056 Cd59b Rat CGP 52608 multiple interactions ISO CD59 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CD59 gene] CTD PMID:28238834 Cd59b Rat chlorambucil decreases lipidation EXP 6480464 Chlorambucil results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat choline multiple interactions ISO Cd59b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of CD59B mRNA CTD PMID:20938992 Cd59b Rat cisplatin multiple interactions ISO CD59 (Homo sapiens) 6480464 [Cisplatin co-treated with Etoposide] results in decreased expression of CD59 protein and [Cisplatin co-treated with jinfukang] results in decreased expression of CD59 mRNA CTD PMID:21826740 and PMID:27392435 Cd59b Rat cisplatin decreases expression ISO CD59 (Homo sapiens) 6480464 Cisplatin results in decreased expression of CD59 protein CTD PMID:24798381 Cd59b Rat cisplatin decreases lipidation EXP 6480464 Cisplatin results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of CD59 mRNA CTD PMID:24386269 Cd59b Rat copper(II) sulfate increases expression ISO CD59 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CD59 mRNA CTD PMID:19549813 Cd59b Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of CD59 mRNA CTD PMID:15755911 Cd59b Rat coumestrol multiple interactions ISO CD59 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of CD59 mRNA CTD PMID:19167446 Cd59b Rat crocidolite asbestos increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased mutagenesis of CD59 gene CTD PMID:12361925 and PMID:15033018 Cd59b Rat crocidolite asbestos multiple interactions ISO CD59 (Homo sapiens) 6480464 CAT protein inhibits the reaction [Asbestos more ... CTD PMID:12361925 and PMID:15033018 Cd59b Rat cyclosporin A decreases expression ISO CD59 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CD59 mRNA CTD PMID:20106945 more ... Cd59b Rat dexamethasone multiple interactions ISO CD59 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CD59 mRNA CTD PMID:28628672 Cd59b Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CD59 mRNA CTD PMID:21266533 Cd59b Rat dicrotophos decreases expression ISO CD59 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CD59 mRNA CTD PMID:28302478 Cd59b Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of CD59 mRNA CTD PMID:32341500 Cd59b Rat dimethyl sulfoxide multiple interactions ISO CD59 (Homo sapiens) 6480464 Dimethyl Sulfoxide inhibits the reaction [Asbestos more ... CTD PMID:12361925 and PMID:15033018 Cd59b Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CD59 mRNA CTD PMID:21551480 Cd59b Rat dorsomorphin multiple interactions ISO CD59 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CD59 mRNA CTD PMID:27188386 Cd59b Rat doxorubicin increases response to substance ISO Cd59b (Mus musculus) 6480464 CD59 gene mutant form results in increased susceptibility to Doxorubicin CTD PMID:16951374 Cd59b Rat doxorubicin decreases expression ISO CD59 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CD59 mRNA CTD PMID:29803840 Cd59b Rat doxorubicin affects expression ISO CD59 (Homo sapiens) 6480464 Doxorubicin affects the expression of CD59 protein CTD PMID:29385562 Cd59b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CD59 mRNA CTD PMID:29391264 Cd59b Rat Enterolactone multiple interactions ISO CD59 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of CD59 mRNA CTD PMID:19167446 Cd59b Rat ethidium increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Ethidium results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat ethyl methanesulfonate increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat ethyl methanesulfonate decreases lipidation EXP 6480464 Ethyl Methanesulfonate results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat etoposide multiple interactions ISO CD59 (Homo sapiens) 6480464 [Cisplatin co-treated with Etoposide] results in decreased expression of CD59 protein CTD PMID:21826740 Cd59b Rat fenthion increases expression ISO Cd59b (Mus musculus) 6480464 Fenthion results in increased expression of CD59B mRNA CTD PMID:34813904 Cd59b Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of CD59 mRNA CTD PMID:23962444 Cd59b Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CD59 mRNA CTD PMID:18035473 Cd59b Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CD59 mRNA CTD PMID:24136188 Cd59b Rat folic acid multiple interactions ISO Cd59b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of CD59B mRNA CTD PMID:20938992 Cd59b Rat gallic acid decreases expression ISO CD59 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of CD59 mRNA CTD PMID:34408198 Cd59b Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of CD59 mRNA CTD PMID:24136188 Cd59b Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of CD59 mRNA CTD PMID:26302742 Cd59b Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of CD59 mRNA CTD PMID:15159207 Cd59b Rat hydrogen peroxide increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased mutagenesis of CD59 gene and Hydrogen Peroxide results in increased mutagenesis of CD59 protein CTD PMID:12361925 and PMID:17045307 Cd59b Rat hydrogen peroxide multiple interactions ISO CD59 (Homo sapiens) 6480464 CAT protein inhibits the reaction [Hydrogen Peroxide results in increased mutagenesis of CD59 gene] and Dimethyl Sulfoxide inhibits the reaction [Hydrogen Peroxide results in increased mutagenesis of CD59 gene] CTD PMID:12361925 Cd59b Rat indometacin multiple interactions ISO CD59 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CD59 mRNA CTD PMID:28628672 Cd59b Rat ivermectin decreases expression ISO CD59 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CD59 protein CTD PMID:32959892 Cd59b Rat L-methionine multiple interactions ISO Cd59b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of CD59B mRNA CTD PMID:20938992 Cd59b Rat lead diacetate increases mutagenesis ISO CD59 (Homo sapiens) 6480464 lead acetate results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat lead(0) affects expression ISO CD59 (Homo sapiens) 6480464 Lead affects the expression of CD59 mRNA CTD PMID:28903495 Cd59b Rat melphalan decreases lipidation EXP 6480464 Melphalan results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat methidathion decreases expression ISO Cd59b (Mus musculus) 6480464 methidathion results in decreased expression of CD59B mRNA CTD PMID:34813904 Cd59b Rat methyl methanesulfonate decreases expression ISO CD59 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of CD59 mRNA CTD PMID:23649840 Cd59b Rat mitomycin C increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Mitomycin results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of CD59 mRNA CTD PMID:38113427 Cd59b Rat N-ethyl-N-nitrosourea increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Ethylnitrosourea results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat N-ethyl-N-nitrosourea decreases lipidation EXP 6480464 Ethylnitrosourea results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat N-ethyl-N-nitrosourea multiple interactions EXP 6480464 [Ethylnitrosourea results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein and [Ethylnitrosourea results in increased mutagenesis of PIGA gene] which results in decreased expression of CD59 protein CTD PMID:19965957 and PMID:20202993 Cd59b Rat N-methyl-N'-nitro-N-nitrosoguanidine increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat N-methyl-N-nitrosourea multiple interactions EXP 6480464 [Methylnitrosourea results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein and [Methylnitrosourea results in increased mutagenesis of PIGA gene] which results in decreased expression of CD59 protein CTD PMID:19965957 and PMID:20202993 Cd59b Rat N-methyl-N-nitrosourea decreases lipidation EXP 6480464 Methylnitrosourea results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat nicotine increases expression ISO CD59 (Homo sapiens) 6480464 Nicotine results in increased expression of CD59 mRNA CTD PMID:18247414 Cd59b Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of CD59 mRNA CTD PMID:24136188 Cd59b Rat ozone multiple interactions ISO CD59 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CD59 mRNA CTD PMID:35430440 Cd59b Rat paracetamol increases expression ISO CD59 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CD59 mRNA CTD PMID:22230336 Cd59b Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CD59 mRNA CTD PMID:19162173 Cd59b Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CD59 mRNA CTD PMID:35163327 Cd59b Rat phenylmercury acetate increases expression ISO CD59 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CD59 mRNA CTD PMID:26272509 Cd59b Rat phenylmercury acetate multiple interactions ISO CD59 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CD59 mRNA CTD PMID:27188386 Cd59b Rat quercetin increases expression ISO CD59 (Homo sapiens) 6480464 Quercetin results in increased expression of CD59 mRNA CTD PMID:21632981 Cd59b Rat rac-lactic acid decreases expression ISO CD59 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CD59 mRNA CTD PMID:30851411 Cd59b Rat rotenone decreases expression ISO CD59 (Homo sapiens) 6480464 Rotenone results in decreased expression of CD59 mRNA CTD PMID:29955902 Cd59b Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Buthionine Sulfoximine results in increased mutagenesis of CD59 gene CTD PMID:15033018 Cd59b Rat SB 431542 multiple interactions ISO CD59 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Cd59b Rat SB 431542 increases expression ISO CD59 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of CD59 protein CTD PMID:25670856 Cd59b Rat serpentine asbestos increases mutagenesis ISO CD59 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat sodium arsenite decreases expression ISO CD59 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CD59 mRNA CTD PMID:25879800 Cd59b Rat sodium arsenite increases expression ISO Cd59b (Mus musculus) 6480464 sodium arsenite results in increased expression of CD59B mRNA CTD PMID:37682722 Cd59b Rat sodium arsenite increases mutagenesis ISO CD59 (Homo sapiens) 6480464 sodium arsenite results in increased mutagenesis of CD59 protein CTD PMID:17045307 Cd59b Rat sulfasalazine decreases expression EXP 6480464 Sulfasalazine results in decreased expression of CD59 mRNA and Sulfasalazine results in decreased expression of CD59 protein CTD PMID:15625186 and PMID:17166698 Cd59b Rat temozolomide decreases lipidation EXP 6480464 temozolomide results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat temozolomide decreases expression ISO CD59 (Homo sapiens) 6480464 Temozolomide results in decreased expression of CD59 mRNA CTD PMID:31758290 Cd59b Rat testosterone multiple interactions ISO CD59 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CD59 mRNA CTD PMID:21592394 Cd59b Rat testosterone decreases expression ISO Cd59b (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of CD59B mRNA CTD PMID:33848595 Cd59b Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of CD59 mRNA CTD PMID:26496021 Cd59b Rat testosterone increases expression ISO CD59 (Homo sapiens) 6480464 Testosterone results in increased expression of CD59 mRNA CTD PMID:21592394 Cd59b Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CD59 mRNA CTD PMID:31150632 Cd59b Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CD59 mRNA] CTD PMID:31150632 Cd59b Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CD59 mRNA CTD PMID:34492290 Cd59b Rat Thiotepa decreases lipidation EXP 6480464 Thiotepa results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat trichloroethene multiple interactions ISO Cd59b (Mus musculus) 6480464 CD59 protein inhibits the reaction [Trichloroethylene results in decreased expression of CUBN mRNA] more ... CTD PMID:31618666 Cd59b Rat triphenyl phosphate affects expression ISO CD59 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CD59 mRNA CTD PMID:37042841 Cd59b Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of CD59 protein CTD PMID:32519852 Cd59b Rat triptonide increases expression ISO Cd59b (Mus musculus) 6480464 triptonide results in increased expression of CD59B mRNA CTD PMID:33045310 Cd59b Rat urethane decreases lipidation EXP 6480464 Urethane results in decreased lipidation of CD59 protein CTD PMID:27931811 Cd59b Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CD59 mRNA CTD PMID:23665938 Cd59b Rat valproic acid decreases expression ISO CD59 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CD59 mRNA CTD PMID:29154799 Cd59b Rat valproic acid increases expression ISO CD59 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CD59 mRNA CTD PMID:23179753 and PMID:27188386 Cd59b Rat zoledronic acid increases expression ISO CD59 (Homo sapiens) 6480464 zoledronic acid results in increased expression of CD59 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-alpha-phellandrene (ISO) (S)-colchicine (ISO) (S)-nicotine (ISO) 1,3-Propane sultone (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-hydroxypropanoic acid (ISO) 2-naphthylamine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-nitroquinoline N-oxide (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) aristolochic acids (EXP) arsane (ISO) arsenic atom (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorambucil (EXP) choline (ISO) cisplatin (EXP,ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) corticosterone (EXP) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethyl phthalate (EXP) dimethyl sulfoxide (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) ethidium (ISO) ethyl methanesulfonate (EXP,ISO) etoposide (ISO) fenthion (ISO) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) gallic acid (ISO) glafenine (EXP) glyphosate (EXP) hexachlorobenzene (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) melphalan (EXP) methidathion (ISO) methyl methanesulfonate (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (EXP) N-ethyl-N-nitrosourea (EXP,ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-methyl-N-nitrosourea (EXP) nicotine (ISO) nimesulide (EXP) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) quercetin (ISO) rac-lactic acid (ISO) rotenone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sulfasalazine (EXP) temozolomide (EXP,ISO) testosterone (EXP,ISO) tetrachloromethane (EXP) thioacetamide (EXP) Thiotepa (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (ISO) urethane (EXP) valproic acid (EXP,ISO) zoledronic acid (ISO)
1.
Ascitic complement system in ovarian cancer.
Bjorge L, etal., Br J Cancer. 2005 Mar 14;92(5):895-905.
2.
Rafts in adult peripheral nerve myelin contain major structural myelin proteins and myelin and lymphocyte protein (MAL) and CD59 as specific markers.
Erne B, etal., J Neurochem 2002 Aug;82(3):550-62.
3.
Generation of a recombinant, membrane-targeted form of the complement regulator CD59: activity in vitro and in vivo.
Fraser DA, etal., J Biol Chem. 2003 Dec 5;278(49):48921-7. Epub 2003 Sep 30.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Membrane-bound complement regulatory proteins inhibit complement activation by an immunotherapeutic mAb in a syngeneic rat colorectal cancer model.
Gelderman KA, etal., Mol Immunol. 2003 Sep;40(1):13-23.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Complement inhibitors targeted to the proximal tubule prevent injury in experimental nephrotic syndrome and demonstrate a key role for C5b-9.
He C, etal., J Immunol. 2005 May 1;174(9):5750-7.
8.
C5b-9 membrane attack complex mediates endothelial cell apoptosis in experimental glomerulonephritis.
Hughes J, etal., Am J Physiol Renal Physiol. 2000 May;278(5):F747-57.
9.
Isolation and characterization of a membrane protein from rat erythrocytes which inhibits lysis by the membrane attack complex of rat complement.
Hughes TR, etal., Biochem J. 1992 May 15;284 ( Pt 1):169-76.
10.
Role of complement regulatory membrane proteins in ischaemia-reperfusion injury of rat gastric mucosa.
Iwata F, etal., J Gastroenterol Hepatol. 1999 Oct;14(10):967-72.
11.
Activation of complement components and reduced regulator expression in alcohol-induced liver injury in the rat.
Jarvelainen HA, etal., Clin Immunol. 2002 Oct;105(1):57-63.
12.
Suppression of complement regulatory proteins (CRPs) exacerbates experimental autoimmune anterior uveitis (EAAU).
Jha P, etal., J Immunol. 2006 Jun 15;176(12):7221-31.
13.
Binding of human and rat CD59 to the terminal complement complexes.
Lehto T, etal., Immunology. 1997 Jan;90(1):121-8.
14.
CD59 and CD48 expressed by rat retinal pigment epithelial cells are major ligands for the CD2-mediated alternative pathway of T cell activation.
Liversidge J, etal., J Immunol. 1996 May 15;156(10):3696-703.
15.
Loss of CD59 expression in breast tumours correlates with poor survival.
Madjd Z, etal., J Pathol. 2003 Aug;200(5):633-9.
16.
Role of CD59 in experimental glomerulonephritis in rats.
Matsuo S, etal., Kidney Int. 1994 Jul;46(1):191-200.
17.
Complement activation and CD59 expression in the motor facial nucleus following intracranial transection of the facial nerve in the adult rat.
Mattsson P, etal., J Neuroimmunol. 1998 Nov 2;91(1-2):180-9.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Expression of complement regulatory proteins-CD 35, CD 46, CD 55, and CD 59-in benign and malignant endometrial tissue.
Murray KP, etal., Gynecol Oncol. 2000 Feb;76(2):176-82.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
22.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
23.
GOA pipeline
RGD automated data pipeline
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Molecular cloning of the rat analogue of human CD59: structural comparison with human CD59 and identification of a putative active site.
Rushmere NK, etal., Biochem J 1994 Dec 1;304 ( Pt 2):595-601.
27.
PSMD11, PTPRM and PTPRB as novel biomarkers of pancreatic cancer progression.
Sahni S, etal., Biochim Biophys Acta Gen Subj. 2020 Nov;1864(11):129682. doi: 10.1016/j.bbagen.2020.129682. Epub 2020 Jul 12.
28.
CD59 silencing via retrovirus-mediated RNA interference enhanced complement-mediated cell damage in ovary cancer.
Shi XX, etal., Cell Mol Immunol. 2009 Feb;6(1):61-6.
29.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
30.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
31.
Time course of complement activation and inhibitor expression after ischemic injury of rat myocardium.
Vakeva A, etal., Am J Pathol. 1994 Jun;144(6):1357-68.
32.
The expression of CD59 in experimental allergic neuritis.
Vedeler CA, etal., J Neurol Sci. 1999 Jun 1;165(2):154-9.
33.
Complement regulatory protein CD59 involves c-SRC related tyrosine phosphorylation of the creatine transporter in skeletal muscle during sepsis.
Wang W, etal., Surgery 2002 Aug;132(2):334-40.
34.
Marked central nervous system pathology in CD59 knockout rats following passive transfer of Neuromyelitis optica immunoglobulin G.
Yao X and Verkman AS, Acta Neuropathol Commun. 2017 Feb 17;5(1):15. doi: 10.1186/s40478-017-0417-9.
35.
Effect of IL-4 on altered expression of complement activation regulators in rat pancreatic cells during severe acute pancreatitis.
Zhang C, etal., World J Gastroenterol. 2005 Nov 21;11(43):6770-4.
36.
Early complement activation and decreased levels of glycosylphosphatidylinositol-anchored complement inhibitors in human and experimental diabetic retinopathy.
Zhang J, etal., Diabetes. 2002 Dec;51(12):3499-504.
Cd59b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 110,914,008 - 110,932,489 (+) NCBI GRCr8 mRatBN7.2 3 90,459,085 - 90,477,571 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 90,459,162 - 90,478,847 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 93,952,281 - 93,970,470 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 102,551,356 - 102,569,545 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 100,381,722 - 100,399,939 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 94,010,481 - 94,028,660 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 94,010,475 - 94,028,621 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 100,650,411 - 100,668,036 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 89,243,600 - 89,245,129 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 89,318,629 - 89,333,534 (-) NCBI Celera 3 89,520,423 - 89,538,310 (+) NCBI Celera Cytogenetic Map 3 q32 NCBI
CD59 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 33,703,010 - 33,736,479 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 33,703,010 - 33,736,479 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 33,724,556 - 33,758,025 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 33,681,132 - 33,714,600 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 33,681,133 - 33,714,600 NCBI Celera 11 33,872,059 - 33,905,528 (-) NCBI Celera Cytogenetic Map 11 p13 NCBI HuRef 11 33,421,201 - 33,454,193 (-) NCBI HuRef CHM1_1 11 33,724,069 - 33,757,538 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 33,840,023 - 33,873,492 (-) NCBI T2T-CHM13v2.0
Cd59b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 103,900,127 - 103,920,619 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 103,896,142 - 103,921,534 (+) Ensembl GRCm39 Ensembl GRCm38 2 104,069,781 - 104,085,790 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 104,069,849 - 104,091,187 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 103,911,167 - 103,925,114 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 103,871,849 - 103,885,796 (+) NCBI MGSCv36 mm8 Cytogenetic Map 2 E2 NCBI cM Map 2 54.51 NCBI
Cd59 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955422 12,500,572 - 12,528,738 (+) NCBI ChiLan1.0 ChiLan1.0
CD59 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 35,924,653 - 35,961,425 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 35,929,328 - 35,965,188 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 33,680,580 - 33,708,479 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 33,558,898 - 33,590,156 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 33,552,164 - 33,590,157 (-) Ensembl panpan1.1 panPan2
CD59 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 33,977,433 - 33,999,145 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 33,977,480 - 33,998,329 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 33,582,994 - 33,604,719 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 34,588,535 - 34,610,237 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 34,588,574 - 34,610,237 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 34,147,266 - 34,158,335 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 33,740,409 - 33,762,219 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 34,376,094 - 34,397,903 (+) NCBI UU_Cfam_GSD_1.0
Cd59
CD59
CD59 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 31,547,876 - 31,571,720 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 31,547,937 - 31,570,835 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 128,644,490 - 128,668,102 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 177 Count of miRNA genes: 134 Interacting mature miRNAs: 146 Transcripts: ENSRNOT00000067085 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 731180 Bp152 Blood pressure QTL 152 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 53781112 91609953 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
D3Wox16
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 90,477,202 - 90,477,342 (+) MAPPER mRatBN7.2 Rnor_6.0 3 94,028,502 - 94,028,641 NCBI Rnor6.0 Rnor_5.0 3 100,667,666 - 100,667,805 UniSTS Rnor5.0 RGSC_v3.4 3 89,244,971 - 89,245,110 UniSTS RGSC3.4 Celera 3 89,538,152 - 89,538,291 UniSTS Cytogenetic Map 3 q32 UniSTS
RH127373
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 90,477,243 - 90,477,436 (+) MAPPER mRatBN7.2 Rnor_6.0 3 94,028,543 - 94,028,735 NCBI Rnor6.0 Rnor_5.0 3 100,667,707 - 100,667,899 UniSTS Rnor5.0 RGSC_v3.4 3 89,245,012 - 89,245,204 UniSTS RGSC3.4 Celera 3 89,538,193 - 89,538,385 UniSTS RH 3.4 Map 3 720.8 UniSTS Cytogenetic Map 3 q32 UniSTS
BF403416
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 90,477,605 - 90,477,756 (+) MAPPER mRatBN7.2 Rnor_6.0 3 94,028,905 - 94,029,055 NCBI Rnor6.0 Rnor_5.0 3 100,668,069 - 100,668,219 UniSTS Rnor5.0 RGSC_v3.4 3 89,245,374 - 89,245,524 UniSTS RGSC3.4 Celera 3 89,538,555 - 89,538,705 UniSTS RH 3.4 Map 3 718.91 UniSTS Cytogenetic Map 3 q32 UniSTS
This gene Cd59b is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067085 ⟹ ENSRNOP00000060967
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 90,459,212 - 90,478,847 (+) Ensembl Rnor_6.0 Ensembl 3 94,010,475 - 94,028,621 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103453 ⟹ ENSRNOP00000092965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 90,460,264 - 90,478,847 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105770 ⟹ ENSRNOP00000092232
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 90,459,162 - 90,476,321 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111042 ⟹ ENSRNOP00000082990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 90,466,705 - 90,478,847 (+) Ensembl
RefSeq Acc Id:
NM_012925 ⟹ NP_037057
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 110,914,097 - 110,932,281 (+) NCBI mRatBN7.2 3 90,459,175 - 90,477,361 (+) NCBI Rnor_6.0 3 94,010,481 - 94,028,660 (+) NCBI Rnor_5.0 3 100,650,411 - 100,668,036 (+) NCBI RGSC_v3.4 3 89,243,600 - 89,245,129 (+) RGD Celera 3 89,520,423 - 89,538,310 (+) RGD
Sequence:
GGCACGAGGGAGCCCGAAACTGGCGCAGGCAAGAAGAACCTCTAGCACAGATCTAGCTGACTGCGAGGTTGCAGATTTGGTGGACCAGCACAATGAGAGCTCGGAGGGGATTCATCTTACTCCTGCTT
hide sequence
RefSeq Acc Id:
XM_039104370 ⟹ XP_038960298
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 110,915,225 - 110,932,489 (+) NCBI mRatBN7.2 3 90,460,422 - 90,477,571 (+) NCBI
RefSeq Acc Id:
XM_039104371 ⟹ XP_038960299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 110,914,008 - 110,932,489 (+) NCBI mRatBN7.2 3 90,459,085 - 90,477,571 (+) NCBI
RefSeq Acc Id:
NP_037057 ⟸ NM_012925
- Peptide Label:
precursor
- UniProtKB:
P27274 (UniProtKB/Swiss-Prot), A6HNT4 (UniProtKB/TrEMBL), A0A8I6AF42 (UniProtKB/TrEMBL)
- Sequence:
MRARRGFILLLLLAVLCSTGVSLRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPNNGAISLLGKTALLVTSVLAAILKPCF
hide sequence
Ensembl Acc Id:
ENSRNOP00000060967 ⟸ ENSRNOT00000067085
RefSeq Acc Id:
XP_038960299 ⟸ XM_039104371
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038960298 ⟸ XM_039104370
- Peptide Label:
isoform X1
- UniProtKB:
P27274 (UniProtKB/Swiss-Prot), A6HNT4 (UniProtKB/TrEMBL), A0A8I6AF42 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092965 ⟸ ENSRNOT00000103453
Ensembl Acc Id:
ENSRNOP00000092232 ⟸ ENSRNOT00000105770
Ensembl Acc Id:
ENSRNOP00000082990 ⟸ ENSRNOT00000111042
RGD ID: 13692258 Promoter ID: EPDNEW_R2783 Type: initiation region Name: Cd59_1 Description: CD59 molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 94,010,470 - 94,010,530 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-02-28
Cd59b
CD59b molecule
Cd59
CD59 molecule
Name and Symbol changed
629549 APPROVED
2016-01-13
Cd59
CD59 molecule
Cd59
CD59 molecule, complement regulatory protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-11
Cd59
CD59 molecule, complement regulatory protein
Cd59
Cd59 molecule
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-15
Cd59
Cd59 molecule
Cd59
Cb59b molecule
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-29
Cd59
Cb59b molecule
Cd59b
CD59b moleucle, complement regulatory protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-27
Cd59b
CD59b moleucle, complement regulatory protein
Cd59
CD59 antigen
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Cd59
CD59 antigen
Symbol and Name status set to approved
70586 APPROVED
