Symbol:
Dscc1
Name:
DNA replication and sister chromatid cohesion 1
RGD ID:
1561749
Description:
Predicted to contribute to DNA clamp loader activity and single-stranded DNA helicase activity. Predicted to be involved in maintenance of mitotic sister chromatid cohesion; post-translational protein acetylation; and regulation of DNA metabolic process. Predicted to be located in nucleoplasm. Predicted to be part of Ctf18 RFC-like complex. Predicted to be active in chromatin and chromosome, centromeric region. Orthologous to human DSCC1 (DNA replication and sister chromatid cohesion 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
defective in sister chromatid cohesion 1 homolog; defective in sister chromatid cohesion 1 homolog (S. cerevisiae); LOC299933; RGD1561749; similar to hypothetical protein MGC5528; sister chromatid cohesion protein DCC1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 88,372,349 - 88,390,815 (-) NCBI GRCr8 mRatBN7.2 7 86,482,588 - 86,498,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 86,482,588 - 86,498,212 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 88,365,742 - 88,381,402 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 90,566,951 - 90,582,603 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 90,372,417 - 90,388,069 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 94,759,076 - 94,774,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 94,758,800 - 94,774,569 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 95,399,906 - 95,415,618 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 91,602,671 - 91,618,122 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 83,276,534 - 83,292,120 (-) NCBI Celera Cytogenetic Map 7 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dscc1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of DSCC1 mRNA CTD PMID:22079256 Dscc1 Rat 1,1-dichloroethene increases expression ISO Dscc1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of DSCC1 mRNA CTD PMID:26682919 Dscc1 Rat 17beta-estradiol increases expression ISO DSCC1 (Homo sapiens) 6480464 Estradiol results in increased expression of DSCC1 mRNA CTD PMID:19167446 Dscc1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Dscc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Dscc1 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Dscc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Dscc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dscc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DSCC1 mRNA CTD PMID:21570461 Dscc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DSCC1 mRNA CTD PMID:33387578 Dscc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO DSCC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of DSCC1 mRNA CTD PMID:22574217 Dscc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DSCC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DSCC1 mRNA CTD PMID:20106945 and PMID:21632981 Dscc1 Rat 2-palmitoylglycerol increases expression ISO DSCC1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of DSCC1 mRNA CTD PMID:37199045 Dscc1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DSCC1 mRNA CTD PMID:24780913 and PMID:30047161 Dscc1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DSCC1 mRNA CTD PMID:31881176 Dscc1 Rat aflatoxin B1 affects expression ISO DSCC1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of DSCC1 protein CTD PMID:20106945 Dscc1 Rat aflatoxin B1 increases methylation ISO DSCC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DSCC1 gene CTD PMID:27153756 Dscc1 Rat aflatoxin B1 increases expression ISO DSCC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DSCC1 mRNA CTD PMID:22100608 Dscc1 Rat all-trans-retinoic acid decreases expression ISO DSCC1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DSCC1 mRNA CTD PMID:33167477 Dscc1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DSCC1 mRNA CTD PMID:30047161 Dscc1 Rat antirheumatic drug increases expression ISO DSCC1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DSCC1 mRNA CTD PMID:24449571 Dscc1 Rat atorvastatin calcium affects response to substance ISO DSCC1 (Homo sapiens) 6480464 DSCC1 protein affects the susceptibility to Atorvastatin CTD PMID:35926565 Dscc1 Rat atrazine decreases expression ISO DSCC1 (Homo sapiens) 6480464 Atrazine results in decreased expression of DSCC1 mRNA CTD PMID:22378314 Dscc1 Rat azathioprine decreases expression ISO DSCC1 (Homo sapiens) 6480464 Azathioprine results in decreased expression of DSCC1 mRNA CTD PMID:22623647 Dscc1 Rat benzo[a]pyrene affects methylation ISO DSCC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DSCC1 intron and Benzo(a)pyrene affects the methylation of DSCC1 promoter CTD PMID:27901495 and PMID:30157460 Dscc1 Rat benzo[a]pyrene increases expression ISO DSCC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DSCC1 mRNA CTD PMID:32234424 Dscc1 Rat bis(2-chloroethyl) sulfide decreases expression ISO DSCC1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of DSCC1 mRNA CTD PMID:25102026 Dscc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DSCC1 mRNA CTD PMID:25181051 more ... Dscc1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DSCC1 mRNA CTD PMID:32145629 Dscc1 Rat bisphenol A decreases expression ISO DSCC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DSCC1 mRNA CTD PMID:29275510 Dscc1 Rat calcitriol decreases expression ISO DSCC1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of DSCC1 mRNA CTD PMID:21592394 Dscc1 Rat calcitriol multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of DSCC1 mRNA CTD PMID:21592394 Dscc1 Rat cannabidiol decreases expression ISO DSCC1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of DSCC1 mRNA CTD PMID:33244087 Dscc1 Rat carbon nanotube increases expression ISO Dscc1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Dscc1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of DSCC1 mRNA CTD PMID:18500788 Dscc1 Rat CGP 52608 multiple interactions ISO DSCC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DSCC1 gene] CTD PMID:28238834 Dscc1 Rat chlorpyrifos decreases expression ISO Dscc1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DSCC1 mRNA CTD PMID:37019170 Dscc1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of DSCC1 mRNA CTD PMID:22023808 Dscc1 Rat cisplatin increases expression ISO DSCC1 (Homo sapiens) 6480464 Cisplatin results in increased expression of DSCC1 mRNA CTD PMID:27594783 Dscc1 Rat copper atom multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DSCC1 mRNA CTD PMID:20971185 Dscc1 Rat copper(0) multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of DSCC1 mRNA CTD PMID:20971185 Dscc1 Rat copper(II) sulfate decreases expression ISO DSCC1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DSCC1 mRNA CTD PMID:19549813 Dscc1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of DSCC1 mRNA CTD PMID:18480146 Dscc1 Rat coumestrol multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Dscc1 Rat coumestrol increases expression ISO DSCC1 (Homo sapiens) 6480464 Coumestrol results in increased expression of DSCC1 mRNA CTD PMID:19167446 Dscc1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of DSCC1 mRNA CTD PMID:26577399 Dscc1 Rat cyclosporin A decreases expression ISO DSCC1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DSCC1 mRNA CTD PMID:20106945 more ... Dscc1 Rat DDE increases expression ISO DSCC1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of DSCC1 mRNA CTD PMID:38568856 Dscc1 Rat Dibutyl phosphate affects expression ISO DSCC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DSCC1 mRNA CTD PMID:37042841 Dscc1 Rat dibutyl phthalate decreases expression ISO Dscc1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of DSCC1 mRNA CTD PMID:21266533 Dscc1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DSCC1 mRNA CTD PMID:21266533 Dscc1 Rat dioxygen decreases expression ISO DSCC1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of DSCC1 mRNA CTD PMID:26516004 Dscc1 Rat doxorubicin affects response to substance ISO DSCC1 (Homo sapiens) 6480464 DSCC1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Dscc1 Rat Enterolactone multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of DSCC1 mRNA CTD PMID:19167446 Dscc1 Rat epoxiconazole increases expression ISO Dscc1 (Mus musculus) 6480464 epoxiconazole results in increased expression of DSCC1 mRNA CTD PMID:35436446 Dscc1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of DSCC1 mRNA CTD PMID:34044035 Dscc1 Rat hydralazine multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of DSCC1 mRNA CTD PMID:17183730 Dscc1 Rat Lasiocarpine increases expression ISO DSCC1 (Homo sapiens) 6480464 lasiocarpine results in increased expression of DSCC1 mRNA CTD PMID:32234424 Dscc1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of DSCC1 mRNA CTD PMID:35283115 Dscc1 Rat lipopolysaccharide multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of DSCC1 mRNA CTD PMID:35811015 Dscc1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DSCC1 mRNA CTD PMID:30047161 Dscc1 Rat methyl methanesulfonate increases expression ISO DSCC1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of DSCC1 mRNA CTD PMID:23649840 Dscc1 Rat N-methyl-4-phenylpyridinium decreases expression ISO DSCC1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DSCC1 mRNA CTD PMID:24810058 Dscc1 Rat niclosamide multiple interactions ISO DSCC1 (Homo sapiens) 6480464 Niclosamide inhibits the reaction [PIK3CA protein modified form results in increased expression of DSCC1 mRNA] CTD PMID:27542212 Dscc1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DSCC1 mRNA CTD PMID:25729387 Dscc1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of DSCC1 mRNA CTD PMID:25729387 Dscc1 Rat ozone multiple interactions ISO Dscc1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of DSCC1 mRNA more ... CTD PMID:25658374 more ... Dscc1 Rat paracetamol increases expression ISO DSCC1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DSCC1 mRNA CTD PMID:22230336 Dscc1 Rat PCB138 multiple interactions ISO Dscc1 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Dscc1 Rat pirinixic acid multiple interactions ISO Dscc1 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of DSCC1 mRNA CTD PMID:20813756 Dscc1 Rat pirinixic acid increases expression ISO Dscc1 (Mus musculus) 6480464 pirinixic acid results in increased expression of DSCC1 mRNA CTD PMID:20813756 Dscc1 Rat potassium chromate multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of DSCC1 mRNA CTD PMID:22079256 Dscc1 Rat potassium chromate decreases expression ISO DSCC1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of DSCC1 mRNA CTD PMID:22079256 Dscc1 Rat propanal decreases expression ISO DSCC1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of DSCC1 mRNA CTD PMID:26079696 Dscc1 Rat pyrvinium multiple interactions ISO DSCC1 (Homo sapiens) 6480464 pyrvinium inhibits the reaction [PIK3CA protein modified form results in increased expression of DSCC1 mRNA] CTD PMID:27542212 Dscc1 Rat quercetin affects expression ISO DSCC1 (Homo sapiens) 6480464 Quercetin affects the expression of DSCC1 mRNA CTD PMID:21632981 Dscc1 Rat resveratrol multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of DSCC1 mRNA CTD PMID:19167446 Dscc1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of DSCC1 mRNA CTD PMID:35811015 Dscc1 Rat silicon dioxide increases expression ISO DSCC1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DSCC1 mRNA CTD PMID:25895662 Dscc1 Rat sodium arsenite increases expression ISO DSCC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DSCC1 mRNA CTD PMID:29301061 and PMID:34032870 Dscc1 Rat sodium arsenite decreases expression ISO DSCC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DSCC1 mRNA CTD PMID:38568856 Dscc1 Rat succimer multiple interactions ISO Dscc1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of DSCC1 mRNA CTD PMID:21641980 Dscc1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DSCC1 mRNA CTD PMID:30047161 Dscc1 Rat sunitinib decreases expression ISO DSCC1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DSCC1 mRNA CTD PMID:31533062 Dscc1 Rat temozolomide increases expression ISO DSCC1 (Homo sapiens) 6480464 Temozolomide results in increased expression of DSCC1 mRNA CTD PMID:31758290 Dscc1 Rat testosterone multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of DSCC1 mRNA CTD PMID:21592394 Dscc1 Rat testosterone decreases expression ISO DSCC1 (Homo sapiens) 6480464 Testosterone results in decreased expression of DSCC1 mRNA CTD PMID:21592394 and PMID:33359661 Dscc1 Rat tetrachloromethane affects expression ISO Dscc1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of DSCC1 mRNA CTD PMID:17484886 Dscc1 Rat tetrachloromethane increases expression ISO Dscc1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DSCC1 mRNA CTD PMID:31919559 Dscc1 Rat thapsigargin decreases expression ISO DSCC1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of DSCC1 mRNA CTD PMID:22378314 Dscc1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DSCC1 mRNA CTD PMID:23411599 Dscc1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of DSCC1 mRNA CTD PMID:34492290 Dscc1 Rat titanium dioxide increases expression ISO Dscc1 (Mus musculus) 6480464 titanium dioxide results in increased expression of DSCC1 mRNA CTD PMID:23557971 Dscc1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of DSCC1 mRNA CTD PMID:30012374 Dscc1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DSCC1 mRNA CTD PMID:25729387 Dscc1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of DSCC1 mRNA CTD PMID:25729387 Dscc1 Rat trimellitic anhydride increases expression ISO Dscc1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DSCC1 mRNA CTD PMID:19042947 Dscc1 Rat triphenyl phosphate affects expression ISO DSCC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DSCC1 mRNA CTD PMID:37042841 Dscc1 Rat triptonide decreases expression ISO Dscc1 (Mus musculus) 6480464 triptonide results in decreased expression of DSCC1 mRNA CTD PMID:33045310 Dscc1 Rat trovafloxacin decreases expression ISO Dscc1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of DSCC1 mRNA CTD PMID:35537566 Dscc1 Rat tungsten increases expression ISO Dscc1 (Mus musculus) 6480464 Tungsten results in increased expression of DSCC1 mRNA CTD PMID:30912803 Dscc1 Rat valproic acid affects expression ISO DSCC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DSCC1 mRNA CTD PMID:25979313 Dscc1 Rat valproic acid multiple interactions ISO DSCC1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of DSCC1 mRNA CTD PMID:17183730 Dscc1 Rat vincaleukoblastine affects response to substance ISO DSCC1 (Homo sapiens) 6480464 DSCC1 protein affects the susceptibility to Vinblastine CTD PMID:16217747
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) antirheumatic drug (ISO) atorvastatin calcium (ISO) atrazine (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (EXP) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) doxorubicin (ISO) Enterolactone (ISO) epoxiconazole (ISO) fipronil (EXP) hydralazine (ISO) Lasiocarpine (ISO) lidocaine (EXP) lipopolysaccharide (ISO) methimazole (EXP) methyl methanesulfonate (ISO) N-methyl-4-phenylpyridinium (ISO) niclosamide (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) PCB138 (ISO) pirinixic acid (ISO) potassium chromate (ISO) propanal (ISO) pyrvinium (ISO) quercetin (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) succimer (ISO) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (EXP,ISO) topotecan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) vincaleukoblastine (ISO)
Dscc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 88,372,349 - 88,390,815 (-) NCBI GRCr8 mRatBN7.2 7 86,482,588 - 86,498,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 86,482,588 - 86,498,212 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 88,365,742 - 88,381,402 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 90,566,951 - 90,582,603 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 90,372,417 - 90,388,069 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 94,759,076 - 94,774,787 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 94,758,800 - 94,774,569 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 95,399,906 - 95,415,618 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 91,602,671 - 91,618,122 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 83,276,534 - 83,292,120 (-) NCBI Celera Cytogenetic Map 7 q32 NCBI
DSCC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 119,833,976 - 119,855,894 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 119,833,976 - 119,855,894 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 120,846,216 - 120,868,134 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 120,915,397 - 120,937,330 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 117,035,242 - 117,057,287 (-) NCBI Celera Cytogenetic Map 8 q24.12 NCBI HuRef 8 116,167,062 - 116,189,042 (-) NCBI HuRef CHM1_1 8 120,887,012 - 120,908,997 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 120,962,843 - 120,984,743 (-) NCBI T2T-CHM13v2.0
Dscc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 54,939,497 - 54,953,887 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 54,939,495 - 54,953,887 (-) Ensembl GRCm39 Ensembl GRCm38 15 55,076,101 - 55,090,491 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 55,076,099 - 55,090,491 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 54,907,656 - 54,922,033 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 54,906,184 - 54,920,561 (-) NCBI MGSCv36 mm8 Celera 15 56,614,624 - 56,628,975 (-) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 21.96 NCBI
Dscc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955417 25,519,341 - 25,527,168 (-) NCBI ChiLan1.0 ChiLan1.0
DSCC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 137,259,612 - 137,284,164 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 112,771,509 - 112,793,572 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 116,524,249 - 116,546,178 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 119,272,490 - 119,294,342 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 119,272,490 - 119,294,342 (-) Ensembl panpan1.1 panPan2
DSCC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 18,825,522 - 18,841,905 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 18,825,844 - 18,841,873 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 18,838,548 - 18,854,898 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 19,154,668 - 19,171,101 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 19,154,990 - 19,171,749 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 18,881,784 - 18,898,141 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 18,981,280 - 18,997,700 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 19,212,008 - 19,228,492 (-) NCBI UU_Cfam_GSD_1.0
Dscc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 19,423,427 - 19,442,974 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 26,849,569 - 26,869,043 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 26,849,541 - 26,869,040 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DSCC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 19,161,226 - 19,178,568 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 19,161,063 - 19,180,002 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 20,185,806 - 20,200,160 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DSCC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 114,396,295 - 114,418,371 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 114,397,251 - 114,418,227 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 25,869,186 - 25,891,106 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dscc1
.
Predicted Target Of
Count of predictions: 10 Count of miRNA genes: 10 Interacting mature miRNAs: 10 Transcripts: ENSRNOT00000036399 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 1641908 Teswt1 Testicular weight QTL 1 3.28 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 7 80221299 94811326 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 724537 Niddm52 Non-insulin dependent diabetes mellitus QTL 52 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 80221299 93595843 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000036399 ⟹ ENSRNOP00000038101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 86,482,588 - 86,498,212 (-) Ensembl Rnor_6.0 Ensembl 7 94,758,800 - 94,774,569 (-) Ensembl
RefSeq Acc Id:
NM_001305236 ⟹ NP_001292165
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,372,349 - 88,387,973 (-) NCBI mRatBN7.2 7 86,482,588 - 86,498,212 (-) NCBI Rnor_6.0 7 94,759,076 - 94,774,787 (-) NCBI Celera 7 83,276,534 - 83,292,120 (-) NCBI
Sequence:
TTGGTCCCGCAGGGACACAGAATTGCTAACACAACCTTTCTGGTCTCCTCCGGGAAACCGTGCTTTCCCCTAAGCAATCTAGGGCTTGCACATTATGAGCAAACTGCTTTGGGACACGGGAGTCTGGA
hide sequence
RefSeq Acc Id:
XM_039078786 ⟹ XP_038934714
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,374,661 - 88,390,815 (-) NCBI mRatBN7.2 7 86,484,900 - 86,498,207 (-) NCBI
RefSeq Acc Id:
XM_039078787 ⟹ XP_038934715
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,372,478 - 88,390,815 (-) NCBI mRatBN7.2 7 86,482,588 - 86,498,207 (-) NCBI
RefSeq Acc Id:
XM_039078788 ⟹ XP_038934716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,380,666 - 88,390,815 (-) NCBI mRatBN7.2 7 86,490,902 - 86,498,207 (-) NCBI
RefSeq Acc Id:
XM_063263252 ⟹ XP_063119322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 88,372,349 - 88,387,333 (-) NCBI
RefSeq Acc Id:
NP_001292165 ⟸ NM_001305236
- UniProtKB:
D4ACA3 (UniProtKB/TrEMBL)
- Sequence:
MPGPTAPRRTREEVDATLQVAKLNAAELLPTVHCLSFGSGTSGAATGDFCLLELEPALCQQLEAGDSFVIRGDKDEQAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKGEETQSNIVHTEIFGFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000038101 ⟸ ENSRNOT00000036399
RefSeq Acc Id:
XP_038934715 ⟸ XM_039078787
- Peptide Label:
isoform X3
- UniProtKB:
A6HRG8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934714 ⟸ XM_039078786
- Peptide Label:
isoform X1
- UniProtKB:
A6HRG8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934716 ⟸ XM_039078788
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063119322 ⟸ XM_063263252
- Peptide Label:
isoform X2
- UniProtKB:
D4ACA3 (UniProtKB/TrEMBL)
RGD ID: 13695335 Promoter ID: EPDNEW_R5858 Type: initiation region Name: Dscc1_1 Description: DNA replication and sister chromatid cohesion 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 94,774,582 - 94,774,642 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-06-05
Dscc1
DNA replication and sister chromatid cohesion 1
Dscc1
defective in sister chromatid cohesion 1 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-29
Dscc1
defective in sister chromatid cohesion 1 homolog (S. cerevisiae)
RGD1561749_predicted
similar to hypothetical protein MGC5528 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1561749_predicted
similar to hypothetical protein MGC5528 (predicted)
LOC299933
similar to hypothetical protein MGC5528
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC299933
similar to hypothetical protein MGC5528
Symbol and Name status set to provisional
70820 PROVISIONAL
