Symbol:
Ogdh
Name:
oxoglutarate dehydrogenase
RGD ID:
1561359
Description:
Enables heat shock protein binding activity; oxoglutarate dehydrogenase (succinyl-transferring) activity; and protein-folding chaperone binding activity. Involved in 2-oxoglutarate metabolic process; nucleoside phosphate metabolic process; and tricarboxylic acid cycle. Part of oxoglutarate dehydrogenase complex. Human ortholog(s) of this gene implicated in oxoglutarate dehydrogenase deficiency. Orthologous to human OGDH (oxoglutarate dehydrogenase); PARTICIPATES IN citric acid cycle pathway; fumaric aciduria pathway; mitochondrial complex II deficiency pathway; INTERACTS WITH (R,R,R)-alpha-tocopherol; (S)-nicotine; 1,1'-azobis(N,N-dimethylformamide).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2-oxoglutarate dehydrogenase complex component E1; 2-oxoglutarate dehydrogenase E1 component, mitochondrial; 2-oxoglutarate dehydrogenase, mitochondrial; 2-oxoglutarate dehydrogenase, mitochondrial-like; alpha-ketoglutarate dehydrogenase; alpha-KGDH-E1; E1o; LOC103693780; LOC360975; OGDC-E1; OGDH-E1; oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide); oxoglutarate dehydrogenase (lipoamide); similar to oxoglutarate dehydrogenase (lipoamide); thiamine diphosphate (ThDP)-dependent 2-oxoglutarate dehydrogenase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Ogdhem1Yuyi
Genetic Models:
SD-Ogdhem1Yuyi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 85,363,949 - 85,431,405 (+) NCBI GRCr8 mRatBN7.2 14 81,150,021 - 81,217,479 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 85,551,494 - 85,617,817 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 86,791,580 - 86,857,903 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 83,240,905 - 83,307,226 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 86,414,924 - 86,481,903 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 86,414,949 - 86,613,327 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 87,376,110 - 87,442,862 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 87,022,994 - 87,090,768 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 80,033,036 - 80,099,636 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ogdh Rat (+)-dexrazoxane multiple interactions ISO Ogdh (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of OGDH mRNA CTD PMID:26873546 Ogdh Rat (-)-epigallocatechin 3-gallate multiple interactions ISO OGDH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of OGDH mRNA CTD PMID:22079256 Ogdh Rat (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 alpha-Tocopherol inhibits the reaction [sodium arsenite results in decreased activity of OGDH protein] CTD PMID:12915223 Ogdh Rat (S)-nicotine decreases activity EXP 6480464 Nicotine results in decreased activity of OGDH protein CTD PMID:29972271 Ogdh Rat (S)-nicotine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [Nicotine results in decreased activity of OGDH protein] CTD PMID:29972271 Ogdh Rat 1,1'-azobis(N,N-dimethylformamide) multiple interactions EXP 6480464 Glutathione promotes the reaction [Diamide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat 1,2-dimethylhydrazine multiple interactions ISO Ogdh (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of OGDH mRNA CTD PMID:22206623 Ogdh Rat 1,2-dimethylhydrazine increases expression ISO Ogdh (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of OGDH mRNA CTD PMID:22206623 Ogdh Rat 1,4-dithiothreitol multiple interactions EXP 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in decreased activity of OGDH protein] and Dithiothreitol inhibits the reaction [tert-Butylhydroperoxide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one affects splicing ISO OGDH (Homo sapiens) 6480464 Metribolone affects the splicing of OGDH mRNA CTD PMID:17010196 Ogdh Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO OGDH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ogdh Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of OGDH protein] CTD PMID:19634143 Ogdh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ogdh (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of OGDH mRNA CTD PMID:21570461 Ogdh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of OGDH mRNA CTD PMID:32109520 Ogdh Rat 2,4,6-tribromophenol increases expression ISO OGDH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Ogdh Rat 2-hydroxypropanoic acid decreases expression ISO OGDH (Homo sapiens) 6480464 Lactic Acid results in decreased expression of OGDH mRNA CTD PMID:30851411 Ogdh Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO OGDH (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of OGDH protein CTD PMID:31675489 Ogdh Rat 3,4-methylenedioxymethamphetamine increases expression ISO Ogdh (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of OGDH mRNA CTD PMID:26251327 Ogdh Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ogdh (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of OGDH mRNA CTD PMID:23428407 Ogdh Rat 4,4'-sulfonyldiphenol increases expression ISO OGDH (Homo sapiens) 6480464 bisphenol S results in increased expression of OGDH mRNA CTD PMID:31121516 Ogdh Rat 4-hydroxyphenyl retinamide increases expression ISO Ogdh (Mus musculus) 6480464 Fenretinide results in increased expression of OGDH mRNA CTD PMID:28973697 Ogdh Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid decreases expression ISO OGDH (Homo sapiens) 6480464 acipimox results in decreased expression of OGDH mRNA CTD PMID:25352640 Ogdh Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of OGDH mRNA CTD PMID:31881176 Ogdh Rat acrolein decreases activity EXP 6480464 Acrolein results in decreased activity of OGDH protein CTD PMID:16725382 and PMID:34238125 Ogdh Rat acrolein multiple interactions EXP 6480464 Linoleic Acids and Conjugated inhibits the reaction [Acrolein results in decreased activity of OGDH protein] CTD PMID:34238125 Ogdh Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of OGDH mRNA CTD PMID:28959563 Ogdh Rat acrylamide decreases expression ISO OGDH (Homo sapiens) 6480464 Acrylamide results in decreased expression of OGDH mRNA CTD PMID:32763439 Ogdh Rat all-trans-retinoic acid increases expression ISO OGDH (Homo sapiens) 6480464 Tretinoin results in increased expression of OGDH mRNA CTD PMID:16054129 Ogdh Rat aluminium atom multiple interactions ISO OGDH (Homo sapiens) 6480464 Aluminum results in decreased expression of and results in decreased activity of OGDH protein CTD PMID:16906525 Ogdh Rat aluminium atom increases activity EXP 6480464 Aluminum results in increased activity of OGDH protein CTD PMID:10806405 Ogdh Rat aluminium(0) multiple interactions ISO OGDH (Homo sapiens) 6480464 Aluminum results in decreased expression of and results in decreased activity of OGDH protein CTD PMID:16906525 Ogdh Rat aluminium(0) increases activity EXP 6480464 Aluminum results in increased activity of OGDH protein CTD PMID:10806405 Ogdh Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat aristolochic acid A increases expression ISO OGDH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of OGDH mRNA and aristolochic acid I results in increased expression of OGDH protein CTD PMID:33212167 Ogdh Rat arsane multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Arsenic results in decreased activity of OGDH protein] and diallyl trisulfide inhibits the reaction [Arsenic results in decreased activity of OGDH protein] CTD PMID:24295472 Ogdh Rat arsane decreases activity EXP 6480464 Arsenic results in decreased activity of OGDH protein CTD PMID:24295472 Ogdh Rat arsenic atom multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Arsenic results in decreased activity of OGDH protein] and diallyl trisulfide inhibits the reaction [Arsenic results in decreased activity of OGDH protein] CTD PMID:24295472 Ogdh Rat arsenic atom decreases activity EXP 6480464 Arsenic results in decreased activity of OGDH protein CTD PMID:24295472 Ogdh Rat arsenite(3-) multiple interactions ISO OGDH (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to OGDH protein] CTD PMID:32406909 Ogdh Rat benzatropine decreases expression ISO OGDH (Homo sapiens) 6480464 Benztropine results in decreased expression of OGDH protein CTD PMID:34122009 Ogdh Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat benzo[a]pyrene multiple interactions ISO Ogdh (Mus musculus) 6480464 Capsaicin inhibits the reaction [Benzo(a)pyrene results in decreased expression of OGDH] CTD PMID:18023135 Ogdh Rat benzo[a]pyrene decreases expression ISO Ogdh (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of OGDH CTD PMID:18023135 Ogdh Rat benzo[a]pyrene diol epoxide I decreases expression ISO OGDH (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ogdh Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OGDH mRNA CTD PMID:22946080 more ... Ogdh Rat bisphenol A increases expression ISO OGDH (Homo sapiens) 6480464 bisphenol A results in increased expression of OGDH protein CTD PMID:37567409 Ogdh Rat bisphenol A decreases expression ISO OGDH (Homo sapiens) 6480464 bisphenol A results in decreased expression of OGDH protein CTD PMID:31675489 and PMID:34186270 Ogdh Rat bisphenol A multiple interactions EXP 6480464 bisphenol A promotes the reaction [NG-Nitroarginine Methyl Ester results in decreased activity of OGDH protein] CTD PMID:37718616 and PMID:38029875 Ogdh Rat bisphenol A increases expression ISO Ogdh (Mus musculus) 6480464 bisphenol A results in increased expression of OGDH mRNA CTD PMID:29161229 Ogdh Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OGDH mRNA CTD PMID:25181051 Ogdh Rat bisphenol AF increases expression ISO OGDH (Homo sapiens) 6480464 bisphenol AF results in increased expression of OGDH protein CTD PMID:34186270 Ogdh Rat Bisphenol B increases expression ISO OGDH (Homo sapiens) 6480464 bisphenol B results in increased expression of OGDH protein CTD PMID:34186270 Ogdh Rat bisphenol F increases expression ISO OGDH (Homo sapiens) 6480464 bisphenol F results in increased expression of OGDH protein CTD PMID:34186270 Ogdh Rat bortezomib decreases expression ISO OGDH (Homo sapiens) 6480464 Bortezomib results in decreased expression of OGDH mRNA CTD PMID:20977926 Ogdh Rat capsaicin multiple interactions ISO Ogdh (Mus musculus) 6480464 Capsaicin inhibits the reaction [Benzo(a)pyrene results in decreased expression of OGDH] CTD PMID:18023135 Ogdh Rat carbon nanotube increases expression ISO Ogdh (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of OGDH mRNA CTD PMID:25554681 Ogdh Rat celastrol increases expression ISO Ogdh (Mus musculus) 6480464 celastrol results in increased expression of OGDH mRNA CTD PMID:35679966 Ogdh Rat celastrol multiple interactions ISO Ogdh (Mus musculus) 6480464 celastrol inhibits the reaction [Dietary Fats results in decreased expression of OGDH mRNA] CTD PMID:35679966 Ogdh Rat choline multiple interactions ISO Ogdh (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of OGDH gene CTD PMID:20938992 Ogdh Rat chromium(6+) multiple interactions ISO OGDH (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of OGDH mRNA CTD PMID:38479592 Ogdh Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat clofibrate increases activity EXP 6480464 Clofibrate results in increased activity of OGDH protein CTD PMID:8468521 Ogdh Rat cobalt dichloride decreases expression ISO OGDH (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of OGDH mRNA CTD PMID:19376846 Ogdh Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of OGDH mRNA CTD PMID:24386269 Ogdh Rat conjugated linoleic acid multiple interactions EXP 6480464 Linoleic Acids and Conjugated inhibits the reaction [Acrolein results in decreased activity of OGDH protein] CTD PMID:34238125 Ogdh Rat conjugated linoleic acid increases activity EXP 6480464 Linoleic Acids and Conjugated results in increased activity of OGDH protein CTD PMID:34238125 Ogdh Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of OGDH mRNA CTD PMID:22465980 Ogdh Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of OGDH mRNA CTD PMID:22465980 Ogdh Rat decabromodiphenyl ether increases expression ISO OGDH (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of OGDH protein CTD PMID:31675489 Ogdh Rat dexamethasone multiple interactions ISO Ogdh (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of OGDH mRNA CTD PMID:23428407 Ogdh Rat diallyl trisulfide multiple interactions EXP 6480464 diallyl trisulfide inhibits the reaction [Arsenic results in decreased activity of OGDH protein] CTD PMID:24295472 Ogdh Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of OGDH mRNA CTD PMID:21266533 Ogdh Rat dicrotophos increases expression ISO OGDH (Homo sapiens) 6480464 dicrotophos results in increased expression of OGDH mRNA CTD PMID:28302478 Ogdh Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of OGDH mRNA CTD PMID:21551480 Ogdh Rat doxorubicin decreases expression ISO Ogdh (Mus musculus) 6480464 Doxorubicin results in decreased expression of OGDH mRNA CTD PMID:26873546 Ogdh Rat doxorubicin affects expression ISO OGDH (Homo sapiens) 6480464 Doxorubicin affects the expression of OGDH protein CTD PMID:29385562 Ogdh Rat doxorubicin multiple interactions ISO Ogdh (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of OGDH mRNA CTD PMID:26873546 Ogdh Rat epoxiconazole decreases expression ISO Ogdh (Mus musculus) 6480464 epoxiconazole results in decreased expression of OGDH mRNA CTD PMID:35436446 Ogdh Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of OGDH protein CTD PMID:19609968 Ogdh Rat ethanol affects splicing ISO Ogdh (Mus musculus) 6480464 Ethanol affects the splicing of OGDH mRNA CTD PMID:30319688 Ogdh Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of OGDH mRNA CTD PMID:34044035 Ogdh Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of OGDH mRNA CTD PMID:24793618 Ogdh Rat folic acid multiple interactions ISO Ogdh (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Ogdh Rat folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [Nicotine results in decreased activity of OGDH protein] CTD PMID:29972271 Ogdh Rat fulvestrant increases methylation ISO OGDH (Homo sapiens) 6480464 Fulvestrant results in increased methylation of OGDH gene CTD PMID:31601247 Ogdh Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of OGDH mRNA CTD PMID:22061828 Ogdh Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of OGDH mRNA CTD PMID:33387578 Ogdh Rat glutathione multiple interactions EXP 6480464 [GLRX protein co-treated with Glutathione] inhibits the reaction [tert-Butylhydroperoxide results in decreased activity of OGDH protein] and Glutathione promotes the reaction [Diamide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat gold atom multiple interactions ISO OGDH (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of OGDH mRNA CTD PMID:28433809 Ogdh Rat gold(0) multiple interactions ISO OGDH (Homo sapiens) 6480464 [Polyethyleneimine binds to Gold] which results in decreased expression of OGDH mRNA CTD PMID:28433809 Ogdh Rat hydrogen peroxide multiple interactions EXP 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat hydrogen peroxide multiple interactions ISO OGDH (Homo sapiens) 6480464 kahweol inhibits the reaction [Hydrogen Peroxide results in decreased activity of OGDH protein] CTD PMID:31306736 Ogdh Rat hydrogen peroxide decreases activity ISO OGDH (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased activity of OGDH protein CTD PMID:31306736 Ogdh Rat hydrogen peroxide decreases activity EXP 6480464 Hydrogen Peroxide results in decreased activity of OGDH protein CTD PMID:12680778 Ogdh Rat hydroquinone O-beta-D-glucopyranoside multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] CTD PMID:32757845 Ogdh Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of OGDH mRNA CTD PMID:36868495 Ogdh Rat inulin multiple interactions ISO Ogdh (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of OGDH mRNA CTD PMID:36331819 Ogdh Rat iodide salt increases expression EXP 6480464 Iodides deficiency results in increased expression of OGDH protein CTD PMID:26795019 Ogdh Rat isoniazide affects expression ISO Ogdh (Mus musculus) 6480464 Isoniazid affects the expression of OGDH mRNA CTD PMID:24848797 Ogdh Rat isoprenaline decreases expression EXP 6480464 Isoproterenol results in decreased expression of OGDH mRNA CTD PMID:17182065 Ogdh Rat isoprenaline decreases activity EXP 6480464 Isoproterenol results in decreased activity of OGDH protein CTD PMID:17994577 more ... Ogdh Rat isoprenaline multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] more ... CTD PMID:17182065 more ... Ogdh Rat ivermectin decreases expression ISO OGDH (Homo sapiens) 6480464 Ivermectin results in decreased expression of OGDH protein CTD PMID:32959892 Ogdh Rat kahweol multiple interactions ISO OGDH (Homo sapiens) 6480464 kahweol inhibits the reaction [Hydrogen Peroxide results in decreased activity of OGDH protein] CTD PMID:31306736 Ogdh Rat L-1,4-dithiothreitol multiple interactions EXP 6480464 Dithiothreitol inhibits the reaction [Hydrogen Peroxide results in decreased activity of OGDH protein] and Dithiothreitol inhibits the reaction [tert-Butylhydroperoxide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Arsenic results in decreased activity of OGDH protein] and Ascorbic Acid inhibits the reaction [sodium arsenite results in decreased activity of OGDH protein] CTD PMID:12915223 and PMID:24295472 Ogdh Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat L-methionine multiple interactions ISO Ogdh (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of OGDH gene CTD PMID:20938992 Ogdh Rat lipopolysaccharide multiple interactions ISO OGDH (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of OGDH mRNA CTD PMID:35877022 Ogdh Rat methotrexate increases expression ISO OGDH (Homo sapiens) 6480464 Methotrexate results in increased expression of OGDH mRNA CTD PMID:21678067 and PMID:24449571 Ogdh Rat methyl methanesulfonate decreases expression ISO OGDH (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of OGDH mRNA CTD PMID:23649840 Ogdh Rat myrtenal multiple interactions EXP 6480464 myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in decreased activity of OGDH protein] CTD PMID:22436021 Ogdh Rat N(4)-hydroxycytidine decreases expression ISO Ogdh (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of OGDH mRNA CTD PMID:37748715 Ogdh Rat N(gamma)-nitro-L-arginine methyl ester decreases activity EXP 6480464 NG-Nitroarginine Methyl Ester results in decreased activity of OGDH protein CTD PMID:37718616 and PMID:38029875 Ogdh Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions EXP 6480464 bisphenol A promotes the reaction [NG-Nitroarginine Methyl Ester results in decreased activity of OGDH protein] CTD PMID:37718616 and PMID:38029875 Ogdh Rat N-methyl-4-phenylpyridinium decreases activity ISO OGDH (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased activity of OGDH protein CTD PMID:18381761 Ogdh Rat N-methyl-4-phenylpyridinium multiple interactions ISO OGDH (Homo sapiens) 6480464 Niacinamide inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased activity of OGDH protein] CTD PMID:18381761 Ogdh Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in decreased activity of OGDH protein and myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in decreased activity of OGDH protein] CTD PMID:22436021 Ogdh Rat naringin multiple interactions EXP 6480464 naringin inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] CTD PMID:17994577 Ogdh Rat nickel atom decreases expression ISO OGDH (Homo sapiens) 6480464 Nickel results in decreased expression of OGDH mRNA CTD PMID:23195993 Ogdh Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of OGDH mRNA CTD PMID:22110744 Ogdh Rat nickel sulfate increases expression ISO OGDH (Homo sapiens) 6480464 nickel sulfate results in increased expression of OGDH mRNA CTD PMID:18651567 Ogdh Rat nicotinamide multiple interactions ISO OGDH (Homo sapiens) 6480464 Niacinamide inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased activity of OGDH protein] CTD PMID:18381761 Ogdh Rat nicotine decreases activity EXP 6480464 Nicotine results in decreased activity of OGDH protein CTD PMID:29972271 Ogdh Rat nicotine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [Nicotine results in decreased activity of OGDH protein] CTD PMID:29972271 Ogdh Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of OGDH mRNA CTD PMID:22946080 Ogdh Rat ochratoxin A decreases expression ISO OGDH (Homo sapiens) 6480464 ochratoxin A results in decreased expression of OGDH protein CTD PMID:32835834 Ogdh Rat ochratoxin A decreases methylation EXP 6480464 ochratoxin A results in decreased methylation of OGDH gene CTD PMID:26431795 Ogdh Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat oxybenzone decreases expression EXP 6480464 oxybenzone results in decreased expression of OGDH mRNA CTD PMID:30316929 Ogdh Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of OGDH mRNA CTD PMID:30316929 Ogdh Rat paracetamol increases expression ISO OGDH (Homo sapiens) 6480464 Acetaminophen results in increased expression of OGDH mRNA CTD PMID:25704631 Ogdh Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ogdh (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of OGDH mRNA CTD PMID:36331819 Ogdh Rat perfluorooctanoic acid increases expression ISO Ogdh (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of OGDH mRNA CTD PMID:28947262 Ogdh Rat perfluorooctanoic acid increases expression ISO OGDH (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of OGDH protein CTD PMID:26879310 Ogdh Rat phenobarbital multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in decreased activity of OGDH protein and myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in decreased activity of OGDH protein] CTD PMID:22436021 Ogdh Rat phenobarbital increases expression ISO OGDH (Homo sapiens) 6480464 Phenobarbital results in increased expression of OGDH protein CTD PMID:35881160 Ogdh Rat phenobarbital decreases expression ISO Ogdh (Mus musculus) 6480464 Phenobarbital results in decreased expression of OGDH protein CTD PMID:35881160 Ogdh Rat phlorizin decreases expression ISO Ogdh (Mus musculus) 6480464 Phlorhizin results in decreased expression of OGDH mRNA CTD PMID:22538082 Ogdh Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat pirinixic acid increases expression ISO Ogdh (Mus musculus) 6480464 pirinixic acid results in increased expression of OGDH mRNA CTD PMID:23811191 Ogdh Rat potassium chromate multiple interactions ISO OGDH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of OGDH mRNA CTD PMID:22079256 Ogdh Rat potassium chromate decreases expression ISO OGDH (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of OGDH mRNA CTD PMID:22079256 Ogdh Rat rac-lactic acid decreases expression ISO OGDH (Homo sapiens) 6480464 Lactic Acid results in decreased expression of OGDH mRNA CTD PMID:30851411 Ogdh Rat resveratrol increases expression ISO Ogdh (Mus musculus) 6480464 resveratrol results in increased expression of OGDH protein CTD PMID:25505154 Ogdh Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of OGDH protein CTD PMID:35544339 Ogdh Rat S-allylcysteine multiple interactions EXP 6480464 S-allylcysteine inhibits the reaction [Isoproterenol results in decreased expression of OGDH mRNA] CTD PMID:17182065 Ogdh Rat silicon dioxide increases expression ISO OGDH (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of OGDH mRNA CTD PMID:25351596 Ogdh Rat sinapic acid multiple interactions EXP 6480464 sinapinic acid inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] CTD PMID:32627257 Ogdh Rat sodium arsenite multiple interactions EXP 6480464 alpha-Tocopherol inhibits the reaction [sodium arsenite results in decreased activity of OGDH protein] and Ascorbic Acid inhibits the reaction [sodium arsenite results in decreased activity of OGDH protein] CTD PMID:12915223 Ogdh Rat sodium arsenite increases expression ISO OGDH (Homo sapiens) 6480464 sodium arsenite results in increased expression of OGDH mRNA CTD PMID:34032870 Ogdh Rat sodium arsenite decreases expression ISO OGDH (Homo sapiens) 6480464 sodium arsenite results in decreased expression of OGDH mRNA CTD PMID:38568856 Ogdh Rat sodium arsenite decreases activity EXP 6480464 sodium arsenite results in decreased activity of OGDH protein CTD PMID:12915223 Ogdh Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of OGDH mRNA CTD PMID:19281266 Ogdh Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of OGDH protein] CTD PMID:19634143 Ogdh Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of OGDH protein CTD PMID:19634143 Ogdh Rat sunitinib decreases expression ISO OGDH (Homo sapiens) 6480464 Sunitinib results in decreased expression of OGDH mRNA CTD PMID:31533062 Ogdh Rat tert-butyl hydroperoxide multiple interactions EXP 6480464 [GLRX protein co-treated with Glutathione] inhibits the reaction [tert-Butylhydroperoxide results in decreased activity of OGDH protein] and Dithiothreitol inhibits the reaction [tert-Butylhydroperoxide results in decreased activity of OGDH protein] CTD PMID:12680778 Ogdh Rat tert-butyl hydroperoxide decreases activity EXP 6480464 tert-Butylhydroperoxide results in decreased activity of OGDH protein CTD PMID:12680778 Ogdh Rat testosterone enanthate affects expression ISO OGDH (Homo sapiens) 6480464 testosterone enanthate affects the expression of OGDH mRNA CTD PMID:17440010 Ogdh Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of OGDH mRNA CTD PMID:19483382 Ogdh Rat thymol multiple interactions EXP 6480464 Thymol inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] CTD PMID:26721194 Ogdh Rat thymol sulfate(1-) multiple interactions EXP 6480464 Thymol inhibits the reaction [Isoproterenol results in decreased activity of OGDH protein] CTD PMID:26721194 Ogdh Rat titanium dioxide decreases methylation ISO Ogdh (Mus musculus) 6480464 titanium dioxide results in decreased methylation of OGDH gene and titanium dioxide results in decreased methylation of OGDH promoter CTD PMID:35295148 Ogdh Rat tributylstannane increases expression ISO Ogdh (Mus musculus) 6480464 tributyltin results in increased expression of OGDH mRNA CTD PMID:23428407 Ogdh Rat triphenyl phosphate affects expression ISO OGDH (Homo sapiens) 6480464 triphenyl phosphate affects the expression of OGDH mRNA CTD PMID:37042841 Ogdh Rat triptonide increases expression ISO Ogdh (Mus musculus) 6480464 triptonide results in increased expression of OGDH mRNA CTD PMID:33045310 Ogdh Rat troglitazone decreases expression ISO Ogdh (Mus musculus) 6480464 troglitazone results in decreased expression of OGDH mRNA CTD PMID:28973697 Ogdh Rat tunicamycin decreases expression ISO Ogdh (Mus musculus) 6480464 Tunicamycin results in decreased expression of OGDH mRNA CTD PMID:17127020 Ogdh Rat valproic acid increases expression ISO OGDH (Homo sapiens) 6480464 Valproic Acid results in increased expression of OGDH protein CTD PMID:29501571 Ogdh Rat valproic acid decreases expression ISO OGDH (Homo sapiens) 6480464 Valproic Acid results in decreased expression of OGDH mRNA CTD PMID:29501571 Ogdh Rat zinc atom decreases activity ISO OGDH (Homo sapiens) 6480464 Zinc results in decreased activity of OGDH protein CTD PMID:17582580 Ogdh Rat zinc(0) decreases activity ISO OGDH (Homo sapiens) 6480464 Zinc results in decreased activity of OGDH protein CTD PMID:17582580
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) (-)-epigallocatechin 3-gallate (ISO) (R,R,R)-alpha-tocopherol (EXP) (S)-nicotine (EXP) 1,1'-azobis(N,N-dimethylformamide) (EXP) 1,2-dimethylhydrazine (ISO) 1,4-dithiothreitol (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrolein (EXP) acrylamide (EXP,ISO) all-trans-retinoic acid (ISO) aluminium atom (EXP,ISO) aluminium(0) (EXP,ISO) amiodarone (EXP) aristolochic acid A (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) benzatropine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) capsaicin (ISO) carbon nanotube (ISO) celastrol (ISO) choline (ISO) chromium(6+) (ISO) clofibrate (EXP) cobalt dichloride (EXP,ISO) conjugated linoleic acid (EXP) copper atom (EXP) copper(0) (EXP) decabromodiphenyl ether (ISO) dexamethasone (ISO) diallyl trisulfide (EXP) dibutyl phthalate (EXP) dicrotophos (ISO) diuron (EXP) doxorubicin (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) fipronil (EXP) flutamide (EXP) folic acid (EXP,ISO) fulvestrant (ISO) gentamycin (EXP) glutathione (EXP) gold atom (ISO) gold(0) (ISO) hydrogen peroxide (EXP,ISO) hydroquinone O-beta-D-glucopyranoside (EXP) indometacin (EXP) inulin (ISO) iodide salt (EXP) isoniazide (ISO) isoprenaline (EXP) ivermectin (ISO) kahweol (ISO) L-1,4-dithiothreitol (EXP) L-ascorbic acid (EXP) L-ethionine (EXP) L-methionine (ISO) lipopolysaccharide (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) myrtenal (EXP) N(4)-hydroxycytidine (ISO) N(gamma)-nitro-L-arginine methyl ester (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) naringin (EXP) nickel atom (ISO) nickel dichloride (EXP) nickel sulfate (ISO) nicotinamide (ISO) nicotine (EXP) Nonylphenol (EXP) ochratoxin A (EXP,ISO) omeprazole (EXP) oxybenzone (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phlorizin (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) S-allylcysteine (EXP) silicon dioxide (ISO) sinapic acid (EXP) sodium arsenite (EXP,ISO) Soman (EXP) streptozocin (EXP) sunitinib (ISO) tert-butyl hydroperoxide (EXP) testosterone enanthate (ISO) thioacetamide (EXP) thymol (EXP) thymol sulfate(1-) (EXP) titanium dioxide (ISO) tributylstannane (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
2-oxoglutarate metabolic process (IDA,IEA,ISO) cerebellar cortex development (IEA,ISO) generation of precursor metabolites and energy (ISS) glycolytic process (IEA) hippocampus development (IEA,ISO) NADH metabolic process (IDA) olfactory bulb mitral cell layer development (IEA,ISO) pyramidal neuron development (IEA,ISO) striatum development (IEA,ISO) succinyl-CoA metabolic process (IDA,IEA,ISO) tangential migration from the subventricular zone to the olfactory bulb (IEA,ISO) thalamus development (IEA,ISO) tricarboxylic acid cycle (IBA,IDA)
1.
Inactivation of aconitase and oxoglutarate dehydrogenase in skeletal muscle in vitro by superoxide anions and/or nitric oxide.
Andersson U, etal., Biochem Biophys Res Commun. 1998 Aug 19;249(2):512-6.
2.
Mitochondrial stress protein recognition of inactivated dehydrogenases during mammalian cell death.
Bruschi SA, etal., Proc Natl Acad Sci U S A. 1998 Nov 10;95(23):13413-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
5.
Purification, resolution, and reconstitution of rat liver branched-chain alpha-keto acid dehydrogenase complex.
Ono K, etal., J Biochem. 1987 Jan;101(1):19-27.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
The alpha-ketoglutarate dehydrogenase complex.
Sheu KF and Blass JP, Ann N Y Acad Sci. 1999;893:61-78.
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Ogdh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 85,363,949 - 85,431,405 (+) NCBI GRCr8 mRatBN7.2 14 81,150,021 - 81,217,479 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 85,551,494 - 85,617,817 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 86,791,580 - 86,857,903 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 83,240,905 - 83,307,226 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 86,414,924 - 86,481,903 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 86,414,949 - 86,613,327 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 87,376,110 - 87,442,862 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 87,022,994 - 87,090,768 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 14 80,033,036 - 80,099,636 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
OGDH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 44,606,627 - 44,709,066 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 44,606,572 - 44,709,066 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 44,646,226 - 44,748,665 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 44,612,696 - 44,715,194 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 44,419,410 - 44,521,908 NCBI Celera 7 44,744,966 - 44,847,513 (+) NCBI Celera Cytogenetic Map 7 p13 NCBI HuRef 7 44,530,268 - 44,633,659 (+) NCBI HuRef CHM1_1 7 44,650,491 - 44,752,987 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 44,766,778 - 44,869,231 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 44,685,639 - 44,788,190 (+) NCBI
Ogdh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 6,241,597 - 6,309,094 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 6,241,633 - 6,306,642 (+) Ensembl GRCm39 Ensembl GRCm38 11 6,291,597 - 6,359,094 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 6,291,633 - 6,356,642 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 6,191,600 - 6,259,096 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 6,191,600 - 6,268,605 (+) NCBI MGSCv36 mm8 Celera 11 6,773,507 - 6,842,010 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 3.94 NCBI
Ogdh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 7,415,589 - 7,485,515 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 7,416,343 - 7,484,889 (-) NCBI ChiLan1.0 ChiLan1.0
OGDH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 49,519,160 - 49,621,977 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 97,843,898 - 97,946,715 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 45,321,559 - 45,422,515 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 45,390,679 - 45,492,000 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 45,409,148 - 45,491,636 (+) Ensembl panpan1.1 panPan2
OGDH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 16 2,363,764 - 2,432,958 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 14,428,589 - 14,497,803 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 14,428,589 - 14,497,757 (-) Ensembl ROS_Cfam_1.0 Ensembl UNSW_CanFamBas_1.0 16 14,059,830 - 14,129,291 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 14,040,718 - 14,109,906 (-) NCBI UU_Cfam_GSD_1.0
Ogdh Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 100,295,062 - 100,372,678 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 19,506,154 - 19,583,364 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 19,506,845 - 19,584,411 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OGDH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 50,609,418 - 50,684,964 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 50,609,415 - 50,684,990 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 55,497,953 - 55,588,004 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OGDH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 13,975,825 - 14,070,216 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 13,973,845 - 14,070,731 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666062 8,465,981 - 8,560,428 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ogdh
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 91 Interacting mature miRNAs: 109 Transcripts: ENSRNOT00000057199 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 1582236 Gluco22 Glucose level QTL 22 3.3 0.0164 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 631213 Bw60 Body weight QTL60 4.51 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 79950921 95876975 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 70153 Bp59 Blood pressure QTL 59 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 14 68757796 83368335 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 1582197 Gluco27 Glucose level QTL 27 3.4 0.0006 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 73415323 92554092 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 1582255 Gluco29 Glucose level QTL 29 3.1 0.0025 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 14 73415323 92554092 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 1582209 Gluco20 Glucose level QTL 20 3.8 0.0005 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
D14Rat20
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 81,204,751 - 81,204,906 (+) MAPPER mRatBN7.2 Rnor_6.0 14 86,468,309 - 86,468,463 NCBI Rnor6.0 Rnor_6.0 14 86,601,370 - 86,601,524 NCBI Rnor6.0 Rnor_5.0 14 87,430,137 - 87,430,291 UniSTS Rnor5.0 RGSC_v3.4 14 87,078,650 - 87,079,096 RGD RGSC3.4 RGSC_v3.4 14 87,078,921 - 87,079,075 UniSTS RGSC3.4 RGSC_v3.1 14 87,098,066 - 87,098,220 RGD Celera 14 80,087,790 - 80,087,944 UniSTS RH 3.4 Map 14 584.8 RGD RH 3.4 Map 14 584.8 UniSTS RH 2.0 Map 14 716.2 RGD SHRSP x BN Map 14 44.91 RGD Cytogenetic Map 14 q21 UniSTS
RH133330
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 81,217,185 - 81,217,370 (+) MAPPER mRatBN7.2 Rnor_6.0 14 86,613,801 - 86,613,985 NCBI Rnor6.0 Rnor_6.0 14 86,480,741 - 86,480,925 NCBI Rnor6.0 Rnor_5.0 14 87,442,569 - 87,442,753 UniSTS Rnor5.0 RGSC_v3.4 14 87,091,353 - 87,091,537 UniSTS RGSC3.4 Celera 14 80,100,221 - 80,100,405 UniSTS RH 3.4 Map 14 582.5 UniSTS Cytogenetic Map 14 q21 UniSTS
BF387217
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 81,170,945 - 81,171,116 (+) MAPPER mRatBN7.2 Rnor_6.0 14 86,435,231 - 86,435,401 NCBI Rnor6.0 Rnor_5.0 14 87,397,059 - 87,397,229 UniSTS Rnor5.0 RGSC_v3.4 14 87,043,964 - 87,044,134 UniSTS RGSC3.4 Celera 14 80,053,820 - 80,053,990 UniSTS RH 3.4 Map 14 578.0 UniSTS Cytogenetic Map 14 q21 UniSTS
RH135290
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 81,157,499 - 81,157,705 (+) MAPPER mRatBN7.2 Rnor_6.0 14 86,421,714 - 86,421,919 NCBI Rnor6.0 Rnor_5.0 14 87,383,542 - 87,383,747 UniSTS Rnor5.0 RGSC_v3.4 14 87,030,611 - 87,030,816 UniSTS RGSC3.4 Celera 14 80,040,436 - 80,040,641 UniSTS RH 3.4 Map 14 576.1 UniSTS Cytogenetic Map 14 q21 UniSTS
MARC_4335-4336:996679558:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 81,215,864 - 81,216,450 (+) MAPPER mRatBN7.2 Rnor_6.0 14 86,612,480 - 86,613,065 NCBI Rnor6.0 Rnor_6.0 14 86,479,420 - 86,480,005 NCBI Rnor6.0 Rnor_5.0 14 87,441,248 - 87,441,833 UniSTS Rnor5.0 RGSC_v3.4 14 87,090,032 - 87,090,617 UniSTS RGSC3.4 Celera 14 80,098,900 - 80,099,485 UniSTS Cytogenetic Map 14 q21 UniSTS
This gene Ogdh is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
6
31
34
30
18
6
18
6
58
24
19
10
19
12
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057199 ⟹ ENSRNOP00000054026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl Rnor_6.0 Ensembl 14 86,414,976 - 86,480,156 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083394 ⟹ ENSRNOP00000068674
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl Rnor_6.0 Ensembl 14 86,414,949 - 86,613,327 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095078 ⟹ ENSRNOP00000086308
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101150 ⟹ ENSRNOP00000091120
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 81,150,091 - 81,217,479 (+) Ensembl
RefSeq Acc Id:
NM_001017461 ⟹ NP_001017461
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,364,031 - 85,430,527 (+) NCBI mRatBN7.2 14 81,150,101 - 81,216,601 (+) NCBI Rnor_6.0 14 86,414,976 - 86,480,156 (+) NCBI Rnor_5.0 14 87,376,110 - 87,442,862 (+) NCBI RGSC_v3.4 14 87,022,994 - 87,090,768 (+) RGD Celera 14 80,033,036 - 80,099,636 (+) RGD
Sequence:
GCCCGGAGTGGGGTGTCGGCGCCTCACTCGGGTGGAGCTGAACAGGAGACAGGTATTTGTGGAAGGCTTCAGGACAAAATGTTTCATTTAAGGACTTGTGCTGCTAAGTTAAGGCCATTGACAGCCTC
hide sequence
RefSeq Acc Id:
XM_006251446 ⟹ XP_006251508
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,364,019 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,116 - 81,217,479 (+) NCBI Rnor_6.0 14 86,414,937 - 86,481,903 (+) NCBI Rnor_5.0 14 87,376,110 - 87,442,862 (+) NCBI
Sequence:
CGTTGACGCCACACGCCGGGGCGGGGCCGAGAGTTTGGAGCCCGGAGTGGGGTGTCGGCGCCTCACTCGGGTGGAGCTGAACAGGAGACAGGTAACCTTGTGCGGCAGACGGGCTCCGTCCAGTGCTG
hide sequence
RefSeq Acc Id:
XM_006251448 ⟹ XP_006251510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,949 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,021 - 81,217,479 (+) NCBI Rnor_6.0 14 86,414,924 - 86,481,903 (+) NCBI Rnor_5.0 14 87,376,110 - 87,442,862 (+) NCBI
Sequence:
GGGCCGGGCTACGCGTTGACGCCACACGCCGGGGCGGGGCCGAGAGTTTGGAGCCCGGAGTGGGGTGTCGGCGCCTCACTCGGGTGGAGCTGAACAGGAGACAGGTATTTGTGGAAGGCTTCAGGACA
hide sequence
RefSeq Acc Id:
XM_039092218 ⟹ XP_038948146
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,949 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,021 - 81,217,479 (+) NCBI
RefSeq Acc Id:
XM_039092219 ⟹ XP_038948147
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,438 - 81,217,479 (+) NCBI
RefSeq Acc Id:
XM_039092220 ⟹ XP_038948148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,364,027 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,114 - 81,217,479 (+) NCBI
RefSeq Acc Id:
XM_039092222 ⟹ XP_038948150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,949 - 85,431,405 (+) NCBI mRatBN7.2 14 81,150,021 - 81,217,479 (+) NCBI
RefSeq Acc Id:
XM_063273392 ⟹ XP_063129462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273393 ⟹ XP_063129463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273394 ⟹ XP_063129464
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273395 ⟹ XP_063129465
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273396 ⟹ XP_063129466
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273397 ⟹ XP_063129467
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,364,061 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273398 ⟹ XP_063129468
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
XM_063273399 ⟹ XP_063129469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 85,363,966 - 85,431,405 (+) NCBI
RefSeq Acc Id:
NP_001017461 ⟸ NM_001017461
- Peptide Label:
precursor
- UniProtKB:
Q5XI78 (UniProtKB/Swiss-Prot), A6IKS7 (UniProtKB/TrEMBL)
- Sequence:
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHL
hide sequence
RefSeq Acc Id:
XP_006251510 ⟸ XM_006251448
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AF05 (UniProtKB/TrEMBL)
- Sequence:
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHL
hide sequence
RefSeq Acc Id:
XP_006251508 ⟸ XM_006251446
- Peptide Label:
isoform X3
- UniProtKB:
Q5XI78 (UniProtKB/Swiss-Prot), A6IKS7 (UniProtKB/TrEMBL)
- Sequence:
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHL
hide sequence
Ensembl Acc Id:
ENSRNOP00000054026 ⟸ ENSRNOT00000057199
Ensembl Acc Id:
ENSRNOP00000068674 ⟸ ENSRNOT00000083394
RefSeq Acc Id:
XP_038948150 ⟸ XM_039092222
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A1Y1 (UniProtKB/TrEMBL), A6IKS6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948146 ⟸ XM_039092218
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R156 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948148 ⟸ XM_039092220
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R156 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948147 ⟸ XM_039092219
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R156 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091120 ⟸ ENSRNOT00000101150
Ensembl Acc Id:
ENSRNOP00000086308 ⟸ ENSRNOT00000095078
RefSeq Acc Id:
XP_063129466 ⟸ XM_063273396
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A1Y1 (UniProtKB/TrEMBL), A6IKS6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129464 ⟸ XM_063273394
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AF05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129462 ⟸ XM_063273392
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R156 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129469 ⟸ XM_063273399
- Peptide Label:
isoform X3
- UniProtKB:
Q5XI78 (UniProtKB/Swiss-Prot), A6IKS7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129463 ⟸ XM_063273393
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A1Y1 (UniProtKB/TrEMBL), A6IKS6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129465 ⟸ XM_063273395
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AF05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129468 ⟸ XM_063273398
- Peptide Label:
isoform X3
- UniProtKB:
Q5XI78 (UniProtKB/Swiss-Prot), A6IKS7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129467 ⟸ XM_063273397
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A1Y1 (UniProtKB/TrEMBL), A6IKS6 (UniProtKB/TrEMBL)
RGD ID: 13699472 Promoter ID: EPDNEW_R9996 Type: initiation region Name: LOC103693780_1 Description: 2-oxoglutarate dehydrogenase, mitochondrial-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 86,415,001 - 86,415,061 EPDNEW
BioCyc Gene G2FUF-15094 BioCyc
BioCyc Pathway LYSINE-DEG1-PWY [L-lysine degradation XI (mammalian)] BioCyc
PWY-5084 [2-oxoglutarate decarboxylation to succinyl-CoA] BioCyc
PWY-5652 [2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA] BioCyc
PWY-5690 [TCA cycle II (plants and fungi)] BioCyc
BioCyc Pathway Image LYSINE-DEG1-PWY BioCyc
PWY-5084 BioCyc
PWY-5652 BioCyc
PWY-5690 BioCyc
Ensembl Genes ENSRNOG00000005130 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000057199.5 UniProtKB/Swiss-Prot
ENSRNOT00000083394.2 UniProtKB/TrEMBL
ENSRNOT00000095078.1 UniProtKB/TrEMBL
ENSRNOT00000101150.1 UniProtKB/TrEMBL
Gene3D-CATH 3.40.50.11610 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.40.50.12470 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.40.50.970 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TPP helical domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7110182 IMAGE-MGC_LOAD
InterPro 2-oxogl_dehyd_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2oxoglutarate_DH_E1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
DH_E1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KGD_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KGD_C_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
THDP-binding UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transketolase-like_Pyr-bd UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:360975 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:94869 IMAGE-MGC_LOAD
NCBI Gene 360975 ENTREZGENE
PANTHER 2-OXOGLUTARATE DEHYDROGENASE, MITOCHONDRIAL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR23152 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam 2-oxogl_dehyd_N UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
E1_dh UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
OxoGdeHyase_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transket_pyr UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Ogdh PhenoGen
PIRSF Oxoglu_dh_E1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000005130 RatGTEx
SMART Transket_pyr UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF52518 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8I6A1Y1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AF05 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2R156 ENTREZGENE, UniProtKB/TrEMBL
A6IKS6 ENTREZGENE, UniProtKB/TrEMBL
A6IKS7 ENTREZGENE, UniProtKB/TrEMBL
ODO1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ogdh
oxoglutarate dehydrogenase
LOC103693780
2-oxoglutarate dehydrogenase, mitochondrial-like
Data merged from RGD:9122992
737654 PROVISIONAL
2016-03-22
Ogdh
oxoglutarate dehydrogenase
Ogdh
oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-08-25
LOC103693780
2-oxoglutarate dehydrogenase, mitochondrial-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-25
Ogdh
oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
Ogdh
oxoglutarate dehydrogenase (lipoamide)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-05
Ogdh
oxoglutarate dehydrogenase (lipoamide)
LOC360975
similar to oxoglutarate dehydrogenase (lipoamide)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC360975
similar to oxoglutarate dehydrogenase (lipoamide)
Symbol and Name status set to provisional
70820 PROVISIONAL
