Symbol:
Tacstd2
Name:
tumor-associated calcium signal transducer 2
RGD ID:
1359498
Description:
Predicted to be involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; and negative regulation of substrate adhesion-dependent cell spreading. Predicted to be located in basal plasma membrane and lateral plasma membrane. Predicted to be active in extracellular space and nucleus. Human ortholog(s) of this gene implicated in corneal dystrophy and gelatinous drop-like corneal dystrophy. Orthologous to human TACSTD2 (tumor associated calcium signal transducer 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
MGC72570; parturition-related protein 1; Prp1; Trop2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 98,037,620 - 98,039,320 (-) NCBI GRCr8 mRatBN7.2 4 96,707,950 - 96,709,650 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 96,707,951 - 96,709,650 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 101,963,680 - 101,965,380 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 97,738,651 - 97,740,351 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 96,165,839 - 96,167,539 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 98,341,187 - 98,342,887 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 98,341,188 - 98,342,887 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 163,126,801 - 163,128,501 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 97,803,151 - 97,804,851 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 98,047,632 - 98,049,313 (-) NCBI Celera 4 91,374,254 - 91,375,954 (-) NCBI Celera Cytogenetic Map 4 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tacstd2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TACSTD2 mRNA CTD PMID:22079256 Tacstd2 Rat 1,1-dichloroethene decreases expression ISO Tacstd2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of TACSTD2 mRNA CTD PMID:26682919 Tacstd2 Rat 1-nitropyrene decreases expression ISO TACSTD2 (Homo sapiens) 6480464 1-nitropyrene results in decreased expression of TACSTD2 mRNA CTD PMID:19041380 Tacstd2 Rat 17alpha-ethynylestradiol increases expression ISO Tacstd2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TACSTD2 mRNA CTD PMID:17942748 Tacstd2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of TACSTD2 mRNA CTD PMID:30387366 Tacstd2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TACSTD2 mRNA CTD PMID:15576828 and PMID:17557909 Tacstd2 Rat 17beta-estradiol affects expression ISO Tacstd2 (Mus musculus) 6480464 Estradiol affects the expression of TACSTD2 mRNA CTD PMID:15598610 Tacstd2 Rat 17beta-estradiol increases expression ISO TACSTD2 (Homo sapiens) 6480464 Estradiol results in increased expression of TACSTD2 mRNA CTD PMID:23019147 and PMID:24424067 Tacstd2 Rat 17beta-estradiol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TACSTD2 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of TACSTD2 mRNA CTD PMID:20660070 and PMID:30165855 Tacstd2 Rat 17beta-estradiol increases expression ISO Tacstd2 (Mus musculus) 6480464 Estradiol results in increased expression of TACSTD2 mRNA CTD PMID:15289156 Tacstd2 Rat 17beta-estradiol 3-benzoate decreases methylation EXP 6480464 estradiol 3-benzoate results in decreased methylation of TACSTD2 promoter CTD PMID:27415467 Tacstd2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tacstd2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tacstd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TACSTD2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TACSTD2 mRNA CTD PMID:12377990 Tacstd2 Rat 2,6-dimethoxyphenol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of TACSTD2 protein CTD PMID:38598786 Tacstd2 Rat 2-palmitoylglycerol increases expression ISO TACSTD2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TACSTD2 mRNA CTD PMID:37199045 Tacstd2 Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Tacstd2 (Mus musculus) 6480464 3 more ... CTD PMID:21826054 Tacstd2 Rat 4,4'-sulfonyldiphenol increases expression ISO Tacstd2 (Mus musculus) 6480464 bisphenol S results in increased expression of TACSTD2 mRNA CTD PMID:30951980 Tacstd2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of TACSTD2 mRNA CTD PMID:30951980 Tacstd2 Rat 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Am 580 results in decreased expression of TACSTD2 mRNA CTD PMID:16982809 Tacstd2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TACSTD2 mRNA CTD PMID:24780913 Tacstd2 Rat 9-cis-retinoic acid increases expression ISO TACSTD2 (Homo sapiens) 6480464 Alitretinoin results in increased expression of TACSTD2 mRNA CTD PMID:15982314 Tacstd2 Rat afimoxifene multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of TACSTD2 mRNA] CTD PMID:21233418 Tacstd2 Rat all-trans-retinoic acid increases expression ISO TACSTD2 (Homo sapiens) 6480464 Tretinoin metabolite results in increased expression of TACSTD2 mRNA and Tretinoin results in increased expression of TACSTD2 mRNA CTD PMID:15982314 and PMID:21934132 Tacstd2 Rat all-trans-retinoic acid multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TACSTD2 mRNA and [bisphenol S co-treated with Tretinoin] results in decreased expression of TACSTD2 mRNA CTD PMID:30951980 Tacstd2 Rat amphotericin B decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of TACSTD2 mRNA CTD PMID:28534445 Tacstd2 Rat arsenous acid decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TACSTD2 mRNA CTD PMID:19128835 Tacstd2 Rat belinostat multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat belinostat increases expression ISO TACSTD2 (Homo sapiens) 6480464 belinostat results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat benzo[a]pyrene decreases methylation ISO TACSTD2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TACSTD2 5' UTR more ... CTD PMID:27901495 Tacstd2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TACSTD2 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Tacstd2 Rat Benzo[k]fluoranthene decreases expression ISO Tacstd2 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of TACSTD2 mRNA CTD PMID:26377693 Tacstd2 Rat bis(2-ethylhexyl) phthalate increases expression ISO TACSTD2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of TACSTD2 mRNA CTD PMID:31163220 Tacstd2 Rat bisphenol A increases expression ISO TACSTD2 (Homo sapiens) 6480464 bisphenol A results in increased expression of TACSTD2 mRNA CTD PMID:23019147 and PMID:29718440 Tacstd2 Rat bisphenol A increases expression ISO Tacstd2 (Mus musculus) 6480464 bisphenol A results in increased expression of TACSTD2 mRNA CTD PMID:30951980 and PMID:32156529 Tacstd2 Rat bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of TACSTD2 promoter CTD PMID:27415467 Tacstd2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TACSTD2 mRNA CTD PMID:25181051 more ... Tacstd2 Rat bisphenol F multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of TACSTD2 mRNA CTD PMID:30951980 Tacstd2 Rat bisphenol F increases expression ISO Tacstd2 (Mus musculus) 6480464 bisphenol F results in increased expression of TACSTD2 mRNA CTD PMID:30951980 Tacstd2 Rat butan-1-ol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of TACSTD2 mRNA CTD PMID:29432896 Tacstd2 Rat cadmium dichloride increases expression ISO TACSTD2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TACSTD2 mRNA CTD PMID:38382870 Tacstd2 Rat cadmium dichloride decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TACSTD2 mRNA CTD PMID:38568856 Tacstd2 Rat calcitriol increases expression ISO TACSTD2 (Homo sapiens) 6480464 Calcitriol results in increased expression of TACSTD2 mRNA CTD PMID:16002434 and PMID:26485663 Tacstd2 Rat carbamazepine affects expression ISO TACSTD2 (Homo sapiens) 6480464 Carbamazepine affects the expression of TACSTD2 mRNA CTD PMID:25979313 Tacstd2 Rat carbon nanotube decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Nanotubes more ... CTD PMID:25102311 Tacstd2 Rat carbon nanotube increases expression ISO Tacstd2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Tacstd2 Rat chlordecone increases expression ISO Tacstd2 (Mus musculus) 6480464 Chlordecone results in increased expression of TACSTD2 mRNA CTD PMID:33711761 Tacstd2 Rat chloropicrin decreases expression ISO TACSTD2 (Homo sapiens) 6480464 chloropicrin results in decreased expression of TACSTD2 mRNA CTD PMID:26352163 Tacstd2 Rat chlorpyrifos increases expression ISO Tacstd2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TACSTD2 mRNA CTD PMID:37019170 Tacstd2 Rat choline multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TACSTD2 mRNA CTD PMID:20938992 Tacstd2 Rat chromium(6+) decreases expression ISO TACSTD2 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of TACSTD2 mRNA CTD PMID:30690063 Tacstd2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of TACSTD2 mRNA CTD PMID:30556269 Tacstd2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of TACSTD2 mRNA CTD PMID:30556269 Tacstd2 Rat copper(II) chloride decreases expression ISO TACSTD2 (Homo sapiens) 6480464 cupric chloride results in decreased expression of TACSTD2 mRNA CTD PMID:38568856 Tacstd2 Rat coumestrol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TACSTD2 mRNA CTD PMID:19167446 Tacstd2 Rat crocidolite asbestos increases expression ISO Tacstd2 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of TACSTD2 mRNA CTD PMID:19446018 Tacstd2 Rat cyclosporin A decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TACSTD2 mRNA CTD PMID:27989131 Tacstd2 Rat DDE decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TACSTD2 mRNA CTD PMID:38568856 Tacstd2 Rat diarsenic trioxide decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TACSTD2 mRNA CTD PMID:19128835 Tacstd2 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of TACSTD2 mRNA CTD PMID:32341500 Tacstd2 Rat diethylstilbestrol increases expression ISO Tacstd2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of TACSTD2 mRNA CTD PMID:15289156 Tacstd2 Rat dimethylarsinous acid decreases expression ISO TACSTD2 (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of TACSTD2 mRNA CTD PMID:23487506 Tacstd2 Rat dioxygen multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TACSTD2 mRNA CTD PMID:30529165 Tacstd2 Rat dorsomorphin multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tacstd2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TACSTD2 mRNA CTD PMID:29391264 Tacstd2 Rat Enterolactone multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of TACSTD2 mRNA CTD PMID:19167446 Tacstd2 Rat ethanol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of TACSTD2 mRNA CTD PMID:29432896 Tacstd2 Rat folic acid multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TACSTD2 mRNA CTD PMID:20938992 Tacstd2 Rat furan increases expression EXP 6480464 furan results in increased expression of TACSTD2 mRNA CTD PMID:27387713 Tacstd2 Rat furfural multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TACSTD2 protein CTD PMID:38598786 Tacstd2 Rat genistein increases expression ISO Tacstd2 (Mus musculus) 6480464 Genistein results in increased expression of TACSTD2 mRNA CTD PMID:15289156 Tacstd2 Rat genistein decreases expression ISO Tacstd2 (Mus musculus) 6480464 Genistein results in decreased expression of TACSTD2 mRNA CTD PMID:32186404 Tacstd2 Rat genistein increases expression ISO TACSTD2 (Homo sapiens) 6480464 Genistein results in increased expression of TACSTD2 mRNA CTD PMID:23019147 Tacstd2 Rat gold atom increases expression ISO TACSTD2 (Homo sapiens) 6480464 Gold results in increased expression of TACSTD2 mRNA CTD PMID:29705079 Tacstd2 Rat gold(0) increases expression ISO TACSTD2 (Homo sapiens) 6480464 Gold results in increased expression of TACSTD2 mRNA CTD PMID:29705079 Tacstd2 Rat hexane increases methylation EXP 6480464 n-hexane results in increased methylation of TACSTD2 promoter CTD PMID:23740543 Tacstd2 Rat hydrogen peroxide affects expression ISO TACSTD2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TACSTD2 mRNA CTD PMID:20044591 Tacstd2 Rat isobutanol multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of TACSTD2 mRNA CTD PMID:29432896 Tacstd2 Rat isotretinoin increases expression ISO TACSTD2 (Homo sapiens) 6480464 Isotretinoin results in increased expression of TACSTD2 mRNA CTD PMID:15982314 Tacstd2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of TACSTD2 mRNA CTD PMID:20080153 Tacstd2 Rat L-methionine multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TACSTD2 mRNA CTD PMID:20938992 Tacstd2 Rat Licochalcone B increases expression ISO TACSTD2 (Homo sapiens) 6480464 licochalcone B results in increased expression of TACSTD2 mRNA CTD PMID:33647349 Tacstd2 Rat mercury dibromide increases expression ISO TACSTD2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat mercury dibromide multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat methotrexate decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of TACSTD2 mRNA CTD PMID:24449571 Tacstd2 Rat methyl methanesulfonate decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of TACSTD2 mRNA CTD PMID:23649840 Tacstd2 Rat methylmercury chloride increases expression ISO TACSTD2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TACSTD2 mRNA CTD PMID:23179753 and PMID:26272509 Tacstd2 Rat methylseleninic acid decreases expression ISO TACSTD2 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of TACSTD2 mRNA CTD PMID:18548127 Tacstd2 Rat ozone multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TACSTD2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of TACSTD2 mRNA CTD PMID:34911549 Tacstd2 Rat p-chloromercuribenzoic acid increases expression ISO TACSTD2 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat p-chloromercuribenzoic acid multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat panobinostat multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat panobinostat increases expression ISO TACSTD2 (Homo sapiens) 6480464 panobinostat results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat PCB138 multiple interactions ISO Tacstd2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tacstd2 Rat perfluorohexanesulfonic acid increases expression ISO Tacstd2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of TACSTD2 mRNA CTD PMID:37995155 Tacstd2 Rat phenylmercury acetate increases expression ISO TACSTD2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat phenylmercury acetate multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat poly(I:C) multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of TACSTD2 mRNA CTD PMID:35688559 Tacstd2 Rat potassium chromate multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TACSTD2 mRNA CTD PMID:22079256 Tacstd2 Rat potassium chromate decreases expression ISO TACSTD2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TACSTD2 mRNA CTD PMID:22079256 and PMID:22714537 Tacstd2 Rat progesterone affects expression ISO Tacstd2 (Mus musculus) 6480464 Progesterone affects the expression of TACSTD2 mRNA CTD PMID:17251523 Tacstd2 Rat progesterone multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TACSTD2 mRNA CTD PMID:20660070 Tacstd2 Rat SB 431542 multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tacstd2 Rat silicon dioxide increases expression ISO TACSTD2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of TACSTD2 mRNA CTD PMID:25351596 Tacstd2 Rat sodium arsenite increases expression ISO TACSTD2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TACSTD2 mRNA CTD PMID:12377979 Tacstd2 Rat sodium arsenite decreases expression ISO TACSTD2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TACSTD2 mRNA CTD PMID:38568856 Tacstd2 Rat sodium chloride multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of TACSTD2 protein more ... CTD PMID:38598786 Tacstd2 Rat sulforaphane increases expression ISO Tacstd2 (Mus musculus) 6480464 sulforaphane results in increased expression of TACSTD2 mRNA CTD PMID:30529165 Tacstd2 Rat testosterone decreases expression ISO TACSTD2 (Homo sapiens) 6480464 Testosterone results in decreased expression of TACSTD2 mRNA CTD PMID:33359661 Tacstd2 Rat tetrathiomolybdate(2-) decreases expression ISO TACSTD2 (Homo sapiens) 6480464 tetrathiomolybdate results in decreased expression of TACSTD2 mRNA CTD PMID:37290678 Tacstd2 Rat titanium dioxide increases expression ISO Tacstd2 (Mus musculus) 6480464 titanium dioxide results in increased expression of TACSTD2 mRNA CTD PMID:27760801 Tacstd2 Rat titanium dioxide decreases methylation ISO Tacstd2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TACSTD2 gene CTD PMID:35295148 Tacstd2 Rat trichostatin A decreases expression ISO TACSTD2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TACSTD2 mRNA CTD PMID:28542535 Tacstd2 Rat trichostatin A multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat trichostatin A increases expression ISO TACSTD2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TACSTD2 mRNA CTD PMID:24935251 and PMID:26272509 Tacstd2 Rat valproic acid affects expression ISO TACSTD2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TACSTD2 mRNA CTD PMID:25979313 Tacstd2 Rat valproic acid increases expression ISO TACSTD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TACSTD2 mRNA CTD PMID:23179753 more ... Tacstd2 Rat valproic acid multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386 Tacstd2 Rat vancomycin decreases expression ISO Tacstd2 (Mus musculus) 6480464 Vancomycin results in decreased expression of TACSTD2 mRNA CTD PMID:18930951 Tacstd2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of TACSTD2 mRNA CTD PMID:19015723 Tacstd2 Rat vorinostat increases expression ISO TACSTD2 (Homo sapiens) 6480464 vorinostat results in increased expression of TACSTD2 mRNA CTD PMID:26272509 Tacstd2 Rat vorinostat multiple interactions ISO TACSTD2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TACSTD2 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) afimoxifene (ISO) all-trans-retinoic acid (ISO) amphotericin B (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlordecone (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) DDE (ISO) diarsenic trioxide (ISO) diethyl phthalate (EXP) diethylstilbestrol (ISO) dimethylarsinous acid (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) Enterolactone (ISO) ethanol (ISO) folic acid (ISO) furan (EXP) furfural (ISO) genistein (ISO) gold atom (ISO) gold(0) (ISO) hexane (EXP) hydrogen peroxide (ISO) isobutanol (ISO) isotretinoin (ISO) ketamine (EXP) L-methionine (ISO) Licochalcone B (ISO) mercury dibromide (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) phenylmercury acetate (ISO) poly(I:C) (ISO) potassium chromate (ISO) progesterone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulforaphane (ISO) testosterone (ISO) tetrathiomolybdate(2-) (ISO) titanium dioxide (ISO) trichostatin A (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
biological_process (ND) negative regulation of branching involved in ureteric bud morphogenesis (IEA,ISO,ISS) negative regulation of cell motility (IEA,ISO,ISS) negative regulation of epithelial cell migration (IEA,ISO,ISS) negative regulation of ruffle assembly (IEA,ISO,ISS) negative regulation of stress fiber assembly (IEA,ISO,ISS) negative regulation of substrate adhesion-dependent cell spreading (IEA,ISO,ISS) positive regulation of stem cell differentiation (IBA,IEA,ISO) regulation of epithelial cell proliferation (IEA,ISO) ureteric bud morphogenesis (IEA,ISO)
Cellular Component
basal plasma membrane (IEA,ISO,ISS) extracellular space (IBA,IEA,ISO) lateral plasma membrane (IEA,ISO,ISS) membrane (IEA,ISO) nucleus (IBA,IEA,ISO) plasma membrane (IEA,ISO)
Tacstd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 98,037,620 - 98,039,320 (-) NCBI GRCr8 mRatBN7.2 4 96,707,950 - 96,709,650 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 96,707,951 - 96,709,650 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 101,963,680 - 101,965,380 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 97,738,651 - 97,740,351 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 96,165,839 - 96,167,539 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 98,341,187 - 98,342,887 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 98,341,188 - 98,342,887 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 163,126,801 - 163,128,501 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 97,803,151 - 97,804,851 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 98,047,632 - 98,049,313 (-) NCBI Celera 4 91,374,254 - 91,375,954 (-) NCBI Celera Cytogenetic Map 4 q31 NCBI
TACSTD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 58,575,433 - 58,577,252 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 58,575,433 - 58,577,252 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 59,041,105 - 59,042,924 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 58,813,231 - 58,816,033 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 58,752,663 - 58,755,466 NCBI Celera 1 57,324,947 - 57,327,018 (-) NCBI Celera Cytogenetic Map 1 p32.1 NCBI HuRef 1 57,151,670 - 57,153,741 (-) NCBI HuRef CHM1_1 1 59,156,449 - 59,158,520 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 58,453,397 - 58,455,216 (-) NCBI T2T-CHM13v2.0
Tacstd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 67,511,043 - 67,512,806 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 67,511,046 - 67,512,780 (-) Ensembl GRCm39 Ensembl GRCm38 6 67,534,059 - 67,535,822 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 67,534,062 - 67,535,796 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 67,484,053 - 67,485,816 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 67,463,640 - 67,465,374 (-) NCBI MGSCv36 mm8 Celera 6 69,652,700 - 69,654,464 (-) NCBI Celera Cytogenetic Map 6 C1 NCBI cM Map 6 30.88 NCBI
Tacstd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955464 1,282,989 - 1,284,785 (+) NCBI ChiLan1.0 ChiLan1.0
TACSTD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 168,269,077 - 168,271,255 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 167,421,430 - 167,423,741 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 57,838,661 - 57,841,444 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 59,544,868 - 59,547,207 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 59,545,625 - 59,546,596 (-) Ensembl panpan1.1 panPan2
TACSTD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 51,122,469 - 51,123,753 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 51,187,934 - 51,189,787 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 51,303,042 - 51,304,084 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 5 51,252,727 - 51,254,573 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 51,198,006 - 51,199,866 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 51,481,572 - 51,483,437 (+) NCBI UU_Cfam_GSD_1.0
Tacstd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 72,207,616 - 72,209,632 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 3,206,957 - 3,207,919 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 3,206,826 - 3,208,675 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TACSTD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 153,859,482 - 153,861,492 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 153,859,488 - 153,861,508 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 141,453,653 - 141,455,459 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TACSTD2
Tacstd2
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 90 Interacting mature miRNAs: 95 Transcripts: ENSRNOT00000010156 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 2317587 Eae26 Experimental allergic encephalomyelitis QTL 26 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 4 88656681 103194984 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 61364 Iddm2 Insulin dependent diabetes mellitus QTL 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 78885890 102684881 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat
AI575674
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 96,708,041 - 96,708,228 (+) MAPPER mRatBN7.2 Rnor_6.0 4 98,341,279 - 98,341,465 NCBI Rnor6.0 Rnor_5.0 4 163,126,893 - 163,127,079 UniSTS Rnor5.0 RGSC_v3.4 4 97,803,243 - 97,803,429 UniSTS RGSC3.4 Celera 4 91,374,346 - 91,374,532 UniSTS RH 3.4 Map 4 607.7 UniSTS Cytogenetic Map 4 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
11
84
68
78
47
20
47
6
147
38
73
45
49
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010156 ⟹ ENSRNOP00000010156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 96,707,951 - 96,709,650 (-) Ensembl Rnor_6.0 Ensembl 4 98,341,188 - 98,342,887 (-) Ensembl
RefSeq Acc Id:
NM_001009540 ⟹ NP_001009540
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 98,037,620 - 98,039,320 (-) NCBI mRatBN7.2 4 96,707,950 - 96,709,650 (-) NCBI Rnor_6.0 4 98,341,187 - 98,342,887 (-) NCBI Rnor_5.0 4 163,126,801 - 163,128,501 (-) NCBI RGSC_v3.4 4 97,803,151 - 97,804,851 (-) RGD Celera 4 91,374,254 - 91,375,954 (-) RGD
Sequence:
AGTCGCCTGCAGTATCCTACCCAACCTGATCCTTCAGAATCCCTGCCCTTGGTCTGTAGTTGTAGGTCCGTTCTATTCTATACCACCATGGCGAGGGGCTTGGATCTAGCACCGCTGCTACTGCTACT
hide sequence
RefSeq Acc Id:
NP_001009540 ⟸ NM_001009540
- Peptide Label:
precursor
- UniProtKB:
Q6K0P4 (UniProtKB/Swiss-Prot), Q6P9Z6 (UniProtKB/Swiss-Prot), A0A0G2JSJ1 (UniProtKB/TrEMBL), A6KF53 (UniProtKB/TrEMBL)
- Sequence:
MARGLDLAPLLLLLLAMVAGFCTAQINCTCPTNKMTVCNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVR
hide sequence
Ensembl Acc Id:
ENSRNOP00000010156 ⟸ ENSRNOT00000010156
RGD ID: 13693104 Promoter ID: EPDNEW_R3628 Type: single initiation site Name: Tacstd2_1 Description: tumor-associated calcium signal transducer 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 98,342,887 - 98,342,947 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Tacstd2
tumor-associated calcium signal transducer 2
Symbol and Name status set to approved
1299863 APPROVED
2005-07-29
Tacstd2
tumor-associated calcium signal transducer 2
Symbol and Name status set to provisional
70820 PROVISIONAL
