Tacstd2 (tumor-associated calcium signal transducer 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tacstd2 (tumor-associated calcium signal transducer 2) Rattus norvegicus

Analyze

Symbol:

Tacstd2

Name:

tumor-associated calcium signal transducer 2

RGD ID:

1359498

Description:

Predicted to be involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; and negative regulation of substrate adhesion-dependent cell spreading. Predicted to act upstream of or within regulation of epithelial cell proliferation and ureteric bud morphogenesis. Predicted to be located in basal plasma membrane and lateral plasma membrane. Predicted to be active in extracellular space and nucleus. Human ortholog(s) of this gene implicated in corneal dystrophy and gelatinous drop-like corneal dystrophy. Orthologous to human TACSTD2 (tumor associated calcium signal transducer 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC72570; parturition-related protein 1; Prp1; Trop2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	101,963,680 - 101,965,380 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,738,651 - 97,740,351 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	96,165,839 - 96,167,539 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	98,047,632 - 98,049,313 (-)	NCBI
Celera	4	91,374,254 - 91,375,954 (-)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

corneal dystrophy (ISO)

endometriosis (ISO)

gelatinous drop-like corneal dystrophy (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

afimoxifene (ISO)

all-trans-retinoic acid (ISO)

arsenous acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloropicrin (ISO)

choline (ISO)

chromium(6+) (ISO)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

genistein (ISO)

gold atom (ISO)

gold(0) (ISO)

hexane (EXP)

hydrogen peroxide (ISO)

isobutanol (ISO)

isotretinoin (ISO)

ketamine (EXP)

L-methionine (ISO)

Licochalcone B (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

PCB138 (ISO)

phenylmercury acetate (ISO)

potassium chromate (ISO)

progesterone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

testosterone (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

negative regulation of branching involved in ureteric bud morphogenesis (IEA,ISO,ISS)

negative regulation of cell motility (ISO,ISS)

negative regulation of epithelial cell migration (IEA,ISO,ISS)

negative regulation of ruffle assembly (IEA,ISO,ISS)

negative regulation of stress fiber assembly (IEA,ISO,ISS)

negative regulation of substrate adhesion-dependent cell spreading (IEA,ISO,ISS)

positive regulation of stem cell differentiation (IBA,IEA,ISO)

regulation of epithelial cell proliferation (IEA,ISO)

ureteric bud morphogenesis (IEA,ISO)

Cellular Component

basal plasma membrane (IEA,ISO,ISS)

cellular_component (ND)

extracellular space (IBA,IEA,ISO)

lateral plasma membrane (IEA,ISO,ISS)

membrane (ISO)

nucleus (IBA,IEA,ISO)

plasma membrane (ISO)

Molecular Function

molecular_function (ND)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Identification of the gene responsible for gelatinous drop-like corneal dystrophy.	Tsujikawa M, etal., Nat Genet. 1999 Apr;21(4):420-3.

Additional References at PubMed

PMID:9462726	PMID:19199708	PMID:21743029	PMID:22194864	PMID:23070813	PMID:23376485

Genomics

Comparative Map Data

Tacstd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	101,963,680 - 101,965,380 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,738,651 - 97,740,351 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	96,165,839 - 96,167,539 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	98,047,632 - 98,049,313 (-)	NCBI
Celera	4	91,374,254 - 91,375,954 (-)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

TACSTD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	58,575,433 - 58,577,252 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	58,575,433 - 58,577,252 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	59,041,105 - 59,042,924 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	58,813,231 - 58,816,033 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	58,752,663 - 58,755,466	NCBI
Celera	1	57,324,947 - 57,327,018 (-)	NCBI		Celera
Cytogenetic Map	1	p32.1	NCBI
HuRef	1	57,151,670 - 57,153,741 (-)	NCBI		HuRef
CHM1_1	1	59,156,449 - 59,158,520 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	58,453,397 - 58,455,216 (-)	NCBI		T2T-CHM13v2.0

Tacstd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	67,511,043 - 67,512,806 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	67,511,046 - 67,512,780 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	67,534,059 - 67,535,822 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	67,534,062 - 67,535,796 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	67,484,053 - 67,485,816 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	67,463,640 - 67,465,374 (-)	NCBI		MGSCv36	mm8
Celera	6	69,652,700 - 69,654,464 (-)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI

Tacstd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955464	1,282,989 - 1,284,785 (+)	NCBI	ChiLan1.0	ChiLan1.0

TACSTD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	59,544,868 - 59,547,207 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	59,545,625 - 59,546,596 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	57,838,661 - 57,841,444 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

TACSTD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	51,122,469 - 51,123,753 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	51,187,934 - 51,189,787 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	51,303,042 - 51,304,084 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	5	51,252,727 - 51,254,573 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	51,198,006 - 51,199,866 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	51,481,572 - 51,483,437 (+)	NCBI		UU_Cfam_GSD_1.0

Tacstd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	72,207,616 - 72,209,632 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	3,206,957 - 3,207,919 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936522	3,206,826 - 3,208,675 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TACSTD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	153,859,482 - 153,861,492 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	153,859,488 - 153,861,508 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	141,453,653 - 141,455,459 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TACSTD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	74,403,547 - 74,406,756 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	42,956,630 - 42,959,787 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tacstd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624862	1,721,030 - 1,722,780 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tacstd2
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	90
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000010156
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	102114432	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78885890	102684881	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
2317587	Eae26	Experimental allergic encephalomyelitis QTL 26			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	88656681	103194984	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat

Markers in Region

AI575674

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	96,708,041 - 96,708,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	98,341,279 - 98,341,465	NCBI	Rnor6.0
Rnor_5.0	4	163,126,893 - 163,127,079	UniSTS	Rnor5.0
RGSC_v3.4	4	97,803,243 - 97,803,429	UniSTS	RGSC3.4
Celera	4	91,374,346 - 91,374,532	UniSTS
RH 3.4 Map	4	607.7	UniSTS
Cytogenetic Map	4	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium										8	4	11
Low	3	2	8		7		1	1	25	27	27		1
Below cutoff		5	35	32	7	32	7	8	33		5		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY185508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010156 ⟹ ENSRNOP00000010156

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl

RefSeq Acc Id:

NM_001009540 ⟹ NP_001009540

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	RGD
Celera	4	91,374,254 - 91,375,954 (-)	RGD

Sequence:

show sequence

AGTCGCCTGCAGTATCCTACCCAACCTGATCCTTCAGAATCCCTGCCCTTGGTCTGTAGTTGTA
GGTCCGTTCTATTCTATACCACCATGGCGAGGGGCTTGGATCTAGCACCGCTGCTACTGCTACT
GCTGGCGATGGTGGCCGGCTTTTGCACGGCCCAGATCAACTGCACATGCCCTACCAACAAGATG
ACCGTCTGCAACTCTAATGGCCCAGGTGGGGTCTGCCAATGTCGGGCAATCGGCTCGCAGGTGT
TGGTCGACTGCTCCACGCTAACTTCCAAGTGCCTGCTACTCAAGGCGCGCATGAGCGCCCGAAA
GAGCAGCCGCAGACTGGTGAATCCGAGCGAGCACGCGATCTTGGACAACGATGGCCTCTACGAC
CCGGAGTGTGACGACAAGGGCCGCTTCAAGGCGCGCCAGTGCAACCAGACCTCGGTGTGCTGGT
GCGTAAACTCGGTGGGCGTGCGCCGAACGGACAAGGGAGACCAGAGCCTGCGCTGCGACGAAGT
GGTGCGAACCCACCACATCCTCATTGAGTTGCGCCACCGCCCGACAGACCGAGCCTTCAACCAC
TCTGACCTAGACTCCGAGCTGCGGCGGCTCTTCAAGGAACGCTACAAGCTGCACCCCAGCTTCC
TGGCCGCGGTGCACTACGAAGAGCCCACCATCCAGATCGAGCTGCAGCAGAACGCGTCACAGAA
GGGCCTGAGAGACGTGGACATCGCTGACGCCGCCTACTACTTCGAAAGGGACATCAAAGGCGAG
TCACTGTTCGTGGGCCGTCGCGGCCTGGACGTGCAGGTGCGTGGGGAGCCCCTGCATGTGGAGC
GGACTCTCATCTACTACCTGGACGAGAAGCCCCCCCAGTTCTCCATGAAGCGCCTCACCACCGG
CCTCATTGCCGTCATCGCTGTCGTCGCGGTGGCACTAGTGGCCGGTGTGGTGGTCTTGGTGGTC
ACCAACCGGAGGAAATCAGGAAAATACAAAAAGGTGGAGCTTAAGGAGCTAGGGGAGATGAGAA
GCGAACCTAGCTTGTAGATTTCCCCGGGCTTCCTTGGCACCTCAGACCAAATGTGTTGGCCTGT
TGATTCTTAGCCAGGAGGTAATTTTCCTCCCAGCTGTGACCTCTTCCTTCTCTCTCCACAAACA
AGTTCCCTAGATGCTGAGCTCAGGTCACCTCCTCGCCCTTGATTTTGAAGGACGCATTTCTGAA
ATTCCTTATCCAGTCTCTCAAAACCTGACCCGGAGGGTTAAGCAAAGACTGGCTTGTGCCAGGC
AGCCCAGTCGTTTCCCAGAGACGTGAATCTACCCAAAGACTTAAAAAACGGTTTGAAATGGGAA
CGCAGCTCTTTTGCTGTCCTGGGTTGTTGGCGAACCATTCACTCCCTGCCTCACAACCTTCAGG
AAAGGAAGAACTAACTGATCCTGTGCAGTGTTCCTCTGCCATCGTTCATATGGAATAAAAGGCG
TGTCCGACGTCTGCAGTCATTTTAAATGGCTTTGTTGGACTGCATCTATTTTTCTGCCTGCCCC
TGATGTAGCTGATACTAGAAAGTTTTCTTTTGTAAAGTGTTTGTACAGATGCGTCTTTGATAAT
GCTGCTGGTTTTTTTAAAGCAACAACTCAAGTTTAATAAAATATGGGAAAGGCACACCTAAAAA
GATAGGCTGTGTAAATATTCCCTCCAGATTTATATCAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009540	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60519	(Get FASTA)	NCBI Sequence Viewer
	AAO67351	(Get FASTA)	NCBI Sequence Viewer
	EDL91571	(Get FASTA)	NCBI Sequence Viewer
	Q6P9Z6	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001009540 ⟸ NM_001009540
- Peptide Label:	precursor
- UniProtKB:	Q6P9Z6 (UniProtKB/Swiss-Prot), A0A0G2JSJ1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARGLDLAPLLLLLLAMVAGFCTAQINCTCPTNKMTVCNSNGPGGVCQCRAIGSQVLVDCSTLT SKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVR RTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEE PTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLD EKPPQFSMKRLTTGLIAVIAVVAVALVAGVVVLVVTNRRKSGKYKKVELKELGEMRSEPSL hide sequence

RefSeq Acc Id:

ENSRNOP00000010156 ⟸ ENSRNOT00000010156

Protein Domains

Thyroglobulin type-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P9Z6-F1-model_v2	AlphaFold	Q6P9Z6	1-317	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693104

Promoter ID:

EPDNEW_R3628

Type:

single initiation site

Name:

Tacstd2_1

Description:

tumor-associated calcium signal transducer 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	98,342,887 - 98,342,947	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359498	AgrOrtholog
BioCyc Gene	G2FUF-44558	BioCyc
Ensembl Genes	ENSRNOG00000007740	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000010156	ENTREZGENE
	ENSRNOP00000010156.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010156	ENTREZGENE
	ENSRNOT00000010156.6	UniProtKB/TrEMBL
Gene3D-CATH	4.10.800.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5597863	IMAGE-MGC_LOAD
InterPro	EPCAM/Trop-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thyroglobulin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thyroglobulin_1_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:494343	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72570	IMAGE-MGC_LOAD
NCBI Gene	494343	ENTREZGENE
PANTHER	PTHR14168	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TUMOR-ASSOCIATED CALCIUM SIGNAL TRANSDUCER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Thyroglobulin_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tacstd2	PhenoGen
PROSITE	THYROGLOBULIN_1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	THYROGLOBULIN_1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00211	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF57610	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JSJ1	ENTREZGENE, UniProtKB/TrEMBL
	Q6P9Z6	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q6K0P4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Tacstd2	tumor-associated calcium signal transducer 2			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Tacstd2	tumor-associated calcium signal transducer 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM