Symbol:
R3hdm2
Name:
R3H domain containing 2
RGD ID:
1310066
Description:
Predicted to enable nucleic acid binding activity. Orthologous to human R3HDM2 (R3H domain containing 2); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362894; R3H domain-containing protein 2; RGD1310066; similar to mKIAA1002 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 65,097,685 - 65,225,863 (+) NCBI GRCr8 mRatBN7.2 7 63,212,519 - 63,340,574 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 65,121,615 - 65,229,838 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,324,036 - 67,432,265 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 67,125,283 - 67,233,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,677,226 - 70,805,255 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,697,050 - 70,805,221 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,850,447 - 70,978,640 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,364,886 - 67,475,880 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 67,442,533 - 67,496,606 (+) NCBI Celera 7 60,371,508 - 60,479,475 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
R3hdm2 Rat 1,2-dimethylhydrazine decreases expression ISO R3hdm2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of R3HDM2 mRNA CTD PMID:22206623 R3hdm2 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of R3HDM2 mRNA CTD PMID:25380136 R3hdm2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 R3hdm2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO R3hdm2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 R3hdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of R3HDM2 mRNA CTD PMID:21215274 R3hdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of R3HDM2 mRNA CTD PMID:33387578 R3hdm2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO R3hdm2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of R3HDM2 mRNA CTD PMID:21570461 R3hdm2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO R3hdm2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of R3HDM2 mRNA CTD PMID:20188158 R3hdm2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of R3HDM2 mRNA CTD PMID:28628672 R3hdm2 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of R3HDM2 mRNA CTD PMID:25380136 R3hdm2 Rat 4,4'-sulfonyldiphenol decreases expression ISO R3hdm2 (Mus musculus) 6480464 bisphenol S results in decreased expression of R3HDM2 mRNA CTD PMID:39298647 R3hdm2 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of R3HDM2 mRNA CTD PMID:22484513 R3hdm2 Rat 5-fluorouracil affects expression ISO R3HDM2 (Homo sapiens) 6480464 Fluorouracil affects the expression of R3HDM2 mRNA CTD PMID:16584549 R3hdm2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of R3HDM2 mRNA CTD PMID:30047161 R3hdm2 Rat acrolein multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of R3HDM2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of R3HDM2 mRNA CTD PMID:32699268 R3hdm2 Rat aflatoxin B1 affects expression ISO R3HDM2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of R3HDM2 protein CTD PMID:20106945 R3hdm2 Rat aflatoxin B1 decreases methylation ISO R3HDM2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of R3HDM2 exon CTD PMID:30157460 R3hdm2 Rat alpha-pinene multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of R3HDM2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of R3HDM2 mRNA CTD PMID:32699268 R3hdm2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of R3HDM2 mRNA CTD PMID:30047161 R3hdm2 Rat aristolochic acid A decreases expression ISO R3HDM2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of R3HDM2 mRNA CTD PMID:33212167 R3hdm2 Rat arsane affects methylation ISO R3HDM2 (Homo sapiens) 6480464 Arsenic affects the methylation of R3HDM2 gene CTD PMID:25304211 R3hdm2 Rat arsenic atom affects methylation ISO R3HDM2 (Homo sapiens) 6480464 Arsenic affects the methylation of R3HDM2 gene CTD PMID:25304211 R3hdm2 Rat arsenous acid decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of R3HDM2 mRNA CTD PMID:27829220 R3hdm2 Rat atrazine decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Atrazine results in decreased expression of R3HDM2 mRNA CTD PMID:22378314 R3hdm2 Rat benzo[a]pyrene increases expression ISO R3hdm2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of R3HDM2 mRNA CTD PMID:22228805 R3hdm2 Rat benzo[a]pyrene decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of R3HDM2 mRNA CTD PMID:21632981 more ... R3hdm2 Rat benzo[b]fluoranthene decreases expression ISO R3hdm2 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of R3HDM2 mRNA CTD PMID:26377693 R3hdm2 Rat benzo[e]pyrene decreases methylation ISO R3HDM2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of R3HDM2 exon CTD PMID:30157460 R3hdm2 Rat beta-lapachone decreases expression ISO R3HDM2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of R3HDM2 mRNA CTD PMID:38218311 R3hdm2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO R3hdm2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of R3HDM2 mRNA CTD PMID:33754040 R3hdm2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of R3HDM2 protein CTD PMID:32145629 R3hdm2 Rat bisphenol A decreases expression ISO R3hdm2 (Mus musculus) 6480464 bisphenol A results in decreased expression of R3HDM2 mRNA CTD PMID:33221593 R3hdm2 Rat bisphenol F multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of R3HDM2 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of R3HDM2 mRNA CTD PMID:28628672 and PMID:31601247 R3hdm2 Rat bisphenol F decreases methylation ISO R3HDM2 (Homo sapiens) 6480464 bisphenol F results in decreased methylation of R3HDM2 gene CTD PMID:31601247 R3hdm2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of R3HDM2 mRNA CTD PMID:24136188 R3hdm2 Rat cadmium atom multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of R3HDM2 mRNA CTD PMID:35301059 R3hdm2 Rat cadmium dichloride multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of R3HDM2 mRNA CTD PMID:35301059 R3hdm2 Rat caffeine affects phosphorylation ISO R3HDM2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of R3HDM2 protein CTD PMID:35688186 R3hdm2 Rat carbon nanotube decreases expression ISO R3hdm2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 R3hdm2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of R3HDM2 mRNA CTD PMID:20187946 R3hdm2 Rat coumarin decreases expression EXP 6480464 coumarin results in decreased expression of R3HDM2 mRNA CTD PMID:18480146 R3hdm2 Rat coumestrol decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of R3HDM2 mRNA CTD PMID:19167446 R3hdm2 Rat dexamethasone multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of R3HDM2 mRNA CTD PMID:28628672 R3hdm2 Rat diarsenic trioxide decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of R3HDM2 mRNA CTD PMID:27829220 R3hdm2 Rat Dibutyl phosphate affects expression ISO R3HDM2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of R3HDM2 mRNA CTD PMID:37042841 R3hdm2 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of R3HDM2 mRNA CTD PMID:30934153 R3hdm2 Rat dicrotophos increases expression ISO R3HDM2 (Homo sapiens) 6480464 dicrotophos results in increased expression of R3HDM2 mRNA CTD PMID:28302478 R3hdm2 Rat dorsomorphin multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of R3HDM2 mRNA CTD PMID:27188386 R3hdm2 Rat doxorubicin decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of R3HDM2 mRNA CTD PMID:29803840 R3hdm2 Rat enzyme inhibitor multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of R3HDM2 protein CTD PMID:23301498 R3hdm2 Rat ethanol multiple interactions ISO R3hdm2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of R3HDM2 mRNA CTD PMID:30319688 R3hdm2 Rat FR900359 affects phosphorylation ISO R3HDM2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of R3HDM2 protein CTD PMID:37730182 R3hdm2 Rat fulvestrant multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of R3HDM2 gene CTD PMID:31601247 R3hdm2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of R3HDM2 mRNA CTD PMID:26194646 R3hdm2 Rat hydrogen peroxide affects expression ISO R3HDM2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of R3HDM2 mRNA CTD PMID:20044591 R3hdm2 Rat indometacin multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of R3HDM2 mRNA CTD PMID:28628672 R3hdm2 Rat lead(0) affects expression ISO R3HDM2 (Homo sapiens) 6480464 Lead affects the expression of R3HDM2 mRNA CTD PMID:28903495 R3hdm2 Rat lead(0) affects splicing ISO R3HDM2 (Homo sapiens) 6480464 Lead affects the splicing of R3HDM2 mRNA CTD PMID:28903495 R3hdm2 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of R3HDM2 mRNA CTD PMID:24136188 R3hdm2 Rat menadione affects expression ISO R3HDM2 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of R3HDM2 mRNA CTD PMID:20044591 R3hdm2 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of R3HDM2 mRNA CTD PMID:22484513 R3hdm2 Rat methapyrilene decreases methylation ISO R3HDM2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of R3HDM2 exon CTD PMID:30157460 R3hdm2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of R3HDM2 mRNA CTD PMID:30047161 R3hdm2 Rat N-methyl-4-phenylpyridinium increases expression ISO R3HDM2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of R3HDM2 mRNA CTD PMID:24810058 R3hdm2 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of R3HDM2 mRNA CTD PMID:25380136 R3hdm2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of R3HDM2 mRNA CTD PMID:24136188 R3hdm2 Rat niclosamide increases expression ISO R3HDM2 (Homo sapiens) 6480464 Niclosamide results in increased expression of R3HDM2 mRNA CTD PMID:36318118 R3hdm2 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of R3HDM2 mRNA CTD PMID:24136188 R3hdm2 Rat nitrates multiple interactions ISO R3hdm2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of R3HDM2 mRNA CTD PMID:35964746 R3hdm2 Rat ozone multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of R3HDM2 mRNA more ... CTD PMID:32699268 R3hdm2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of R3HDM2 mRNA CTD PMID:30047161 R3hdm2 Rat rotenone increases expression ISO R3HDM2 (Homo sapiens) 6480464 Rotenone results in increased expression of R3HDM2 mRNA CTD PMID:29955902 R3hdm2 Rat SB 431542 multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of R3HDM2 mRNA CTD PMID:27188386 R3hdm2 Rat silicon dioxide decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of R3HDM2 mRNA CTD PMID:23806026 R3hdm2 Rat sodium arsenite decreases expression ISO R3HDM2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of R3HDM2 mRNA CTD PMID:38568856 R3hdm2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of R3HDM2 mRNA CTD PMID:30047161 R3hdm2 Rat sunitinib increases expression ISO R3HDM2 (Homo sapiens) 6480464 Sunitinib results in increased expression of R3HDM2 mRNA CTD PMID:31533062 R3hdm2 Rat tert-butyl hydroperoxide decreases expression ISO R3HDM2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of R3HDM2 mRNA CTD PMID:15336504 R3hdm2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of R3HDM2 mRNA CTD PMID:31150632 R3hdm2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of R3HDM2 mRNA CTD PMID:34492290 R3hdm2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of R3HDM2 mRNA CTD PMID:33387578 R3hdm2 Rat triphenyl phosphate affects expression ISO R3HDM2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of R3HDM2 mRNA CTD PMID:37042841 R3hdm2 Rat triptonide decreases expression ISO R3hdm2 (Mus musculus) 6480464 triptonide results in decreased expression of R3HDM2 mRNA CTD PMID:33045310 R3hdm2 Rat triptonide affects expression ISO R3hdm2 (Mus musculus) 6480464 triptonide affects the expression of R3HDM2 mRNA CTD PMID:33045310 R3hdm2 Rat tungsten decreases expression ISO R3hdm2 (Mus musculus) 6480464 Tungsten results in decreased expression of R3HDM2 mRNA CTD PMID:30912803 R3hdm2 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of R3HDM2 mRNA CTD PMID:24136188 R3hdm2 Rat valproic acid affects expression ISO R3hdm2 (Mus musculus) 6480464 Valproic Acid affects the expression of R3HDM2 mRNA CTD PMID:17292431 R3hdm2 Rat valproic acid multiple interactions ISO R3HDM2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of R3HDM2 mRNA CTD PMID:27188386 R3hdm2 Rat valproic acid decreases expression ISO R3HDM2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of R3HDM2 mRNA CTD PMID:23179753 more ... R3hdm2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of R3HDM2 mRNA CTD PMID:20566332 and PMID:23034163 R3hdm2 Rat vorinostat decreases expression ISO R3HDM2 (Homo sapiens) 6480464 vorinostat results in decreased expression of R3HDM2 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) cocaine (EXP) coumarin (EXP) coumestrol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) hydrogen peroxide (ISO) indometacin (ISO) lead(0) (ISO) leflunomide (EXP) menadione (ISO) methapyrilene (EXP,ISO) methimazole (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) niclosamide (ISO) nimesulide (EXP) nitrates (ISO) ozone (ISO) pregnenolone 16alpha-carbonitrile (EXP) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
R3hdm2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 65,097,685 - 65,225,863 (+) NCBI GRCr8 mRatBN7.2 7 63,212,519 - 63,340,574 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 65,121,615 - 65,229,838 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 67,324,036 - 67,432,265 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 67,125,283 - 67,233,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 70,677,226 - 70,805,255 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 70,697,050 - 70,805,221 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 70,850,447 - 70,978,640 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 67,364,886 - 67,475,880 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 67,442,533 - 67,496,606 (+) NCBI Celera 7 60,371,508 - 60,479,475 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
R3HDM2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 57,253,764 - 57,431,141 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 57,253,762 - 57,431,043 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 57,647,547 - 57,824,826 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 55,933,814 - 55,977,083 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 57,301,742 - 57,358,703 (-) NCBI Celera Cytogenetic Map 12 q13.3 NCBI HuRef 12 54,686,409 - 54,742,604 (-) NCBI HuRef CHM1_1 12 57,615,659 - 57,672,355 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 57,221,992 - 57,399,417 (-) NCBI T2T-CHM13v2.0
R3hdm2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 127,216,201 - 127,335,253 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 127,216,196 - 127,335,253 (+) Ensembl GRCm39 Ensembl GRCm38 10 127,380,332 - 127,499,384 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 127,380,327 - 127,499,384 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 126,827,367 - 126,936,440 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 126,823,816 - 126,902,329 (+) NCBI MGSCv36 mm8 Celera 10 129,782,901 - 129,890,901 (+) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 74.5 NCBI
R3hdm2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 4,981,968 - 5,127,390 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 4,981,967 - 5,127,409 (-) NCBI ChiLan1.0 ChiLan1.0
R3HDM2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 36,909,060 - 37,086,655 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 36,905,831 - 37,083,424 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 31,494,789 - 31,672,343 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 31,784,823 - 31,923,910 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 31,868,368 - 31,923,910 (+) Ensembl panpan1.1 panPan2
R3HDM2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 1,377,664 - 1,504,008 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 1,370,350 - 1,504,017 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 1,441,640 - 1,607,075 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 1,388,352 - 1,552,863 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 1,380,736 - 1,552,848 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 1,364,935 - 1,530,961 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 1,606,926 - 1,772,486 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 1,731,870 - 1,897,782 (-) NCBI UU_Cfam_GSD_1.0
R3hdm2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 57,298,889 - 57,422,845 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936646 1,448,362 - 1,494,637 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936646 1,447,704 - 1,571,363 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
R3HDM2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 22,549,010 - 22,719,054 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 22,558,645 - 22,714,250 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 24,392,777 - 24,541,400 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
R3HDM2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 53,165,259 - 53,340,627 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 53,164,779 - 53,224,708 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 192,624,737 - 192,805,448 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
R3hdm2
.
Predicted Target Of
Count of predictions: 86 Count of miRNA genes: 65 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000045964 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
D7Rat230
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 65,179,648 - 65,179,793 (+) Marker Load Pipeline mRatBN7.2 7 63,294,367 - 63,294,498 (+) MAPPER mRatBN7.2 Rnor_6.0 7 70,759,424 - 70,759,568 NCBI Rnor6.0 Rnor_5.0 7 70,932,760 - 70,932,904 UniSTS Rnor5.0 RGSC_v3.4 7 67,428,165 - 67,428,310 RGD RGSC3.4 RGSC_v3.4 7 67,428,166 - 67,428,310 UniSTS RGSC3.4 RGSC_v3.1 7 67,448,895 - 67,449,040 RGD Celera 7 60,433,366 - 60,433,510 UniSTS FHH x ACI Map 7 33.46 UniSTS FHH x ACI Map 7 33.46 RGD Cytogenetic Map 7 q22 UniSTS
RH141287
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 63,340,216 - 63,340,410 (+) MAPPER mRatBN7.2 Rnor_6.0 7 70,804,898 - 70,805,091 NCBI Rnor6.0 Rnor_5.0 7 70,978,283 - 70,978,476 UniSTS Rnor5.0 RGSC_v3.4 7 67,475,537 - 67,475,730 UniSTS RGSC3.4 Celera 7 60,479,132 - 60,479,325 UniSTS Cytogenetic Map 7 q22 UniSTS
fc22b03.x1
Rat Assembly Chr Position (strand) Source JBrowse Celera 7 60,467,826 - 60,468,229 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045964 ⟹ ENSRNOP00000046983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl Rnor_6.0 Ensembl 7 70,697,050 - 70,805,221 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090001 ⟹ ENSRNOP00000073015
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl Rnor_6.0 Ensembl 7 70,753,101 - 70,804,778 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097324 ⟹ ENSRNOP00000096190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107753 ⟹ ENSRNOP00000078773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110189 ⟹ ENSRNOP00000078234
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 63,232,346 - 63,340,540 (+) Ensembl
RefSeq Acc Id:
NM_001130557 ⟹ NP_001124029
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,117,630 - 65,225,849 (+) NCBI mRatBN7.2 7 63,232,346 - 63,340,560 (+) NCBI Rnor_6.0 7 70,697,050 - 70,805,241 (+) NCBI Rnor_5.0 7 70,850,447 - 70,978,640 (+) NCBI RGSC_v3.4 7 67,364,886 - 67,475,880 (+) RGD Celera 7 60,371,508 - 60,479,475 (+) RGD
Sequence:
GTTAAACTTGTTTCCTAAGAGAGATGCCATACCAGCACTGGACTCATGGAGACTGAGCATTTATTCAGAAATCCATAGAAGCTGCTATACCCTGCTGCAGAACATGTCTAACAGTAACACTACTCAGG
hide sequence
RefSeq Acc Id:
XM_006241472 ⟹ XP_006241534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,145,534 - 65,225,863 (+) NCBI mRatBN7.2 7 63,260,255 - 63,340,574 (+) NCBI Rnor_6.0 7 70,725,305 - 70,805,255 (+) NCBI Rnor_5.0 7 70,850,447 - 70,978,640 (+) NCBI
Sequence:
TCTTTTTCTCCTGAGAGGGAGGGGTCGGAGAGAAGGAAGAAGAAAAATGGATCTGAAGTCTTTG
hide sequence
RefSeq Acc Id:
XM_006241483 ⟹ XP_006241545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,551 - 63,340,574 (+) NCBI Rnor_6.0 7 70,687,777 - 70,805,255 (+) NCBI Rnor_5.0 7 70,850,447 - 70,978,640 (+) NCBI
Sequence:
CTACCTGCCTCTGCCTAAGTGCTGGGATTAAAGGTGTGTACCGCCACCATCTGACTGTAGAGGC
hide sequence
RefSeq Acc Id:
XM_008765413 ⟹ XP_008763635
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,805 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,519 - 63,340,574 (+) NCBI Rnor_6.0 7 70,677,226 - 70,805,255 (+) NCBI
Sequence:
TTCCCGAGCCCCCTTCCCCTCCCCCGCCCCGCTCCCCTGCCTCCCCGCCCCGGGCCCGGGGAGA
hide sequence
RefSeq Acc Id:
XM_017594931 ⟹ XP_017450420
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI Rnor_6.0 7 70,677,304 - 70,805,255 (+) NCBI
Sequence:
AGCCCGCCCCCAGAAGCGCGCCGCCGCCGCCGGCCGTCGGGGCCGAGCCGCAGCCGAGCGGCCGTGGGCCCGGGCGGCGGGCGGACACCGGGCACCCTCCCCGCGCTGGCCCCCGTGAGGTGAATTGC
hide sequence
RefSeq Acc Id:
XM_017594935 ⟹ XP_017450424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,144,693 - 65,225,863 (+) NCBI mRatBN7.2 7 63,259,420 - 63,340,574 (+) NCBI Rnor_6.0 7 70,724,274 - 70,805,255 (+) NCBI
Sequence:
TTTTGTGTGTATGTGTGTCTGTCTGTCCGTCTGTTGGCAGAGCTCTGGGTGACATCCTTGAAAC
hide sequence
RefSeq Acc Id:
XM_017594936 ⟹ XP_017450425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,387 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI Rnor_6.0 7 70,687,776 - 70,805,255 (+) NCBI
Sequence:
GCTACCTGCCTCTGCCTAAGTGCTGGGATTAAAGGTGTGTACCGCCACCATCTGACTGTAGAGG
hide sequence
RefSeq Acc Id:
XM_017594940 ⟹ XP_017450429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,387 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI Rnor_6.0 7 70,687,776 - 70,805,255 (+) NCBI
Sequence:
GCTACCTGCCTCTGCCTAAGTGCTGGGATTAAAGGTGTGTACCGCCACCATCTGACTGTAGAGG
hide sequence
RefSeq Acc Id:
XM_017594943 ⟹ XP_017450432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,390 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI Rnor_6.0 7 70,687,776 - 70,805,255 (+) NCBI
Sequence:
GCTACCTGCCTCTGCCTAAGTGCTGGGATTAAAGGTGTGTACCGCCACCATCTGACTGTAGAGGCCATTTTCTTTCAGGTTTTATTTTAATTTTATGTGTGTGGGTGTGTTTCACCTATTTGCTTGTC
hide sequence
RefSeq Acc Id:
XM_039079496 ⟹ XP_038935424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079497 ⟹ XP_038935425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079498 ⟹ XP_038935426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079499 ⟹ XP_038935427
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,847 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079500 ⟹ XP_038935428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,847 - 65,225,863 (+) NCBI mRatBN7.2 7 63,212,550 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079501 ⟹ XP_038935429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,384 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079502 ⟹ XP_038935430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,388 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079504 ⟹ XP_038935432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,385 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079505 ⟹ XP_038935433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,389 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079506 ⟹ XP_038935434
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,383 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079507 ⟹ XP_038935435
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,387 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079508 ⟹ XP_038935436
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,388 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079509 ⟹ XP_038935437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,173,325 - 65,225,863 (+) NCBI mRatBN7.2 7 63,288,044 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079510 ⟹ XP_038935438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,188,020 - 65,225,863 (+) NCBI mRatBN7.2 7 63,302,725 - 63,340,574 (+) NCBI
RefSeq Acc Id:
XM_039079511 ⟹ XP_038935439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,367 - 65,221,890 (+) NCBI mRatBN7.2 7 63,288,044 - 63,335,576 (+) NCBI
RefSeq Acc Id:
XM_063263806 ⟹ XP_063119876
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,380 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263807 ⟹ XP_063119877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263808 ⟹ XP_063119878
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263809 ⟹ XP_063119879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263810 ⟹ XP_063119880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263811 ⟹ XP_063119881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,847 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263812 ⟹ XP_063119882
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,365 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263813 ⟹ XP_063119883
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,381 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263814 ⟹ XP_063119884
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,373 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263815 ⟹ XP_063119885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263816 ⟹ XP_063119886
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,144,694 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263817 ⟹ XP_063119887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,805 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263818 ⟹ XP_063119888
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,386 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263819 ⟹ XP_063119889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263820 ⟹ XP_063119890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263821 ⟹ XP_063119891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,718 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263822 ⟹ XP_063119892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,386 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263823 ⟹ XP_063119893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,387 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263824 ⟹ XP_063119894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,097,685 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263825 ⟹ XP_063119895
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,131,367 - 65,221,890 (+) NCBI
RefSeq Acc Id:
XM_063263826 ⟹ XP_063119896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,193,687 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263827 ⟹ XP_063119897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,193,838 - 65,225,863 (+) NCBI
RefSeq Acc Id:
XM_063263828 ⟹ XP_063119898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 65,193,687 - 65,225,863 (+) NCBI
RefSeq Acc Id:
NP_001124029 ⟸ NM_001130557
- UniProtKB:
A6HQV5 (UniProtKB/TrEMBL), A0A8I5ZKH5 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_006241545 ⟸ XM_006241483
- Peptide Label:
isoform X21
- UniProtKB:
A6HQV5 (UniProtKB/TrEMBL), A0A8I5ZKH5 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_006241534 ⟸ XM_006241472
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_008763635 ⟸ XM_008765413
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHA
hide sequence
RefSeq Acc Id:
XP_017450420 ⟸ XM_017594931
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_017450425 ⟸ XM_017594936
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHA
hide sequence
RefSeq Acc Id:
XP_017450429 ⟸ XM_017594940
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_017450432 ⟸ XM_017594943
- Peptide Label:
isoform X20
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
RefSeq Acc Id:
XP_017450424 ⟸ XM_017594935
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
- Sequence:
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEEVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEECSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKDDKDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000046983 ⟸ ENSRNOT00000045964
Ensembl Acc Id:
ENSRNOP00000073015 ⟸ ENSRNOT00000090001
RefSeq Acc Id:
XP_038935426 ⟸ XM_039079498
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935424 ⟸ XM_039079496
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935425 ⟸ XM_039079497
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935427 ⟸ XM_039079499
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935428 ⟸ XM_039079500
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935432 ⟸ XM_039079504
- Peptide Label:
isoform X8
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935433 ⟸ XM_039079505
- Peptide Label:
isoform X11
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935429 ⟸ XM_039079501
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935430 ⟸ XM_039079502
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935435 ⟸ XM_039079507
- Peptide Label:
isoform X14
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935434 ⟸ XM_039079506
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935436 ⟸ XM_039079508
- Peptide Label:
isoform X16
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935437 ⟸ XM_039079509
- Peptide Label:
isoform X25
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935439 ⟸ XM_039079511
- Peptide Label:
isoform X28
RefSeq Acc Id:
XP_038935438 ⟸ XM_039079510
- Peptide Label:
isoform X27
Ensembl Acc Id:
ENSRNOP00000078234 ⟸ ENSRNOT00000110189
Ensembl Acc Id:
ENSRNOP00000078773 ⟸ ENSRNOT00000107753
Ensembl Acc Id:
ENSRNOP00000096190 ⟸ ENSRNOT00000097324
RefSeq Acc Id:
XP_063119880 ⟸ XM_063263810
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119877 ⟸ XM_063263807
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119879 ⟸ XM_063263809
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119878 ⟸ XM_063263808
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119889 ⟸ XM_063263819
- Peptide Label:
isoform X18
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119890 ⟸ XM_063263820
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119894 ⟸ XM_063263824
- Peptide Label:
isoform X24
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119885 ⟸ XM_063263815
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119891 ⟸ XM_063263821
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I5ZKH5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119887 ⟸ XM_063263817
- Peptide Label:
isoform X15
- UniProtKB:
G3V9G7 (UniProtKB/TrEMBL), A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119881 ⟸ XM_063263811
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119882 ⟸ XM_063263812
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119895 ⟸ XM_063263825
- Peptide Label:
isoform X26
RefSeq Acc Id:
XP_063119884 ⟸ XM_063263814
- Peptide Label:
isoform X10
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119876 ⟸ XM_063263806
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119883 ⟸ XM_063263813
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119892 ⟸ XM_063263822
- Peptide Label:
isoform X22
- UniProtKB:
A0A0G2K4E8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119888 ⟸ XM_063263818
- Peptide Label:
isoform X17
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119893 ⟸ XM_063263823
- Peptide Label:
isoform X23
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119886 ⟸ XM_063263816
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I5ZLX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119896 ⟸ XM_063263826
- Peptide Label:
isoform X29
RefSeq Acc Id:
XP_063119898 ⟸ XM_063263828
- Peptide Label:
isoform X30
RefSeq Acc Id:
XP_063119897 ⟸ XM_063263827
- Peptide Label:
isoform X29
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-27
R3hdm2
R3H domain containing 2
RGD1310066
similar to mKIAA1002 protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1310066
similar to mKIAA1002 protein
RGD1310066_predicted
similar to mKIAA1002 protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1310066_predicted
similar to mKIAA1002 protein (predicted)
LOC362894_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC362894_predicted
similar to mKIAA1002 protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
