Symbol:
Ndufs7
Name:
NADH:ubiquinone oxidoreductase core subunit S7
RGD ID:
1310013
Description:
Enables protease binding activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in neuronal cell body and synaptic membrane. Human ortholog(s) of this gene implicated in developmental disorder of mental health and nuclear type mitochondrial complex I deficiency 3. Orthologous to human NDUFS7 (NADH:ubiquinone oxidoreductase core subunit S7); PARTICIPATES IN doxorubicin pharmacokinetics pathway; Alzheimer's disease pathway; Huntington's disease pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362837; MGC105684; NADH dehydrogenase (ubiquinone) Fe-S protein 7; NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial; NADH-ubiquinone oxidoreductase Fe-S protein 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 10,103,226 - 10,110,862 (-) NCBI GRCr8 mRatBN7.2 7 9,452,556 - 9,460,135 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,450,392 - 9,460,195 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 12,335,345 - 12,342,615 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 14,210,685 - 14,217,955 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 12,072,020 - 12,079,284 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 12,318,776 - 12,326,403 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,318,757 - 12,326,392 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,488,476 - 12,496,073 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,963,916 - 10,971,188 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,963,916 - 10,971,188 (-) NCBI Celera 7 7,629,258 - 7,636,522 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndufs7 Rat (+)-dexrazoxane increases expression ISO Ndufs7 (Mus musculus) 6480464 Dexrazoxane results in increased expression of NDUFS7 mRNA CTD PMID:26873546 Ndufs7 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NDUFS7 mRNA] CTD PMID:31150632 Ndufs7 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NDUFS7 mRNA CTD PMID:32145629 Ndufs7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFS7 mRNA CTD PMID:15644576 and PMID:33387578 Ndufs7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ndufs7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NDUFS7 mRNA CTD PMID:21570461 and PMID:24680724 Ndufs7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFS7 mRNA CTD PMID:21215274 and PMID:32109520 Ndufs7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ndufs7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFS7 mRNA CTD PMID:19465110 Ndufs7 Rat 4,4'-sulfonyldiphenol increases expression ISO Ndufs7 (Mus musculus) 6480464 bisphenol S results in increased expression of NDUFS7 mRNA CTD PMID:39298647 Ndufs7 Rat 4,4'-sulfonyldiphenol increases methylation ISO Ndufs7 (Mus musculus) 6480464 bisphenol S results in increased methylation of NDUFS7 exon CTD PMID:33297965 Ndufs7 Rat aflatoxin B1 decreases methylation ISO NDUFS7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NDUFS7 intron CTD PMID:30157460 Ndufs7 Rat aristolochic acid A increases expression ISO NDUFS7 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NDUFS7 mRNA CTD PMID:33212167 Ndufs7 Rat arsenite(3-) decreases expression ISO Ndufs7 (Mus musculus) 6480464 arsenite results in decreased expression of NDUFS7 mRNA CTD PMID:33053406 Ndufs7 Rat arsenite(3-) multiple interactions ISO NDUFS7 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NDUFS7 mRNA] CTD PMID:32406909 Ndufs7 Rat astemizole increases expression EXP 6480464 Astemizole results in increased expression of NDUFS7 mRNA CTD PMID:20221588 Ndufs7 Rat benzo[a]pyrene increases expression ISO Ndufs7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NDUFS7 mRNA CTD PMID:22228805 Ndufs7 Rat benzo[a]pyrene decreases expression ISO Ndufs7 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NDUFS7 mRNA CTD PMID:27195522 Ndufs7 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ndufs7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NDUFS7 mRNA CTD PMID:35550907 Ndufs7 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ndufs7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NDUFS7 mRNA CTD PMID:33754040 Ndufs7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDUFS7 mRNA CTD PMID:25181051 Ndufs7 Rat bisphenol A increases expression ISO NDUFS7 (Homo sapiens) 6480464 bisphenol A results in increased expression of NDUFS7 protein CTD PMID:34186270 Ndufs7 Rat bisphenol A decreases methylation ISO NDUFS7 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NDUFS7 gene CTD PMID:31601247 Ndufs7 Rat bisphenol A increases expression ISO Ndufs7 (Mus musculus) 6480464 bisphenol A results in increased expression of NDUFS7 mRNA CTD PMID:33221593 Ndufs7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NDUFS7 mRNA CTD PMID:32145629 Ndufs7 Rat bisphenol AF increases expression ISO NDUFS7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NDUFS7 protein CTD PMID:34186270 Ndufs7 Rat Bisphenol B increases expression ISO NDUFS7 (Homo sapiens) 6480464 bisphenol B results in increased expression of NDUFS7 protein CTD PMID:34186270 Ndufs7 Rat bisphenol F decreases expression ISO Ndufs7 (Mus musculus) 6480464 bisphenol F results in decreased expression of NDUFS7 mRNA CTD PMID:38685157 Ndufs7 Rat bisphenol F increases expression ISO NDUFS7 (Homo sapiens) 6480464 bisphenol F results in increased expression of NDUFS7 protein CTD PMID:34186270 Ndufs7 Rat cadmium atom decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Cadmium results in decreased expression of NDUFS7 mRNA CTD PMID:24376830 Ndufs7 Rat captan decreases expression ISO Ndufs7 (Mus musculus) 6480464 Captan results in decreased expression of NDUFS7 mRNA CTD PMID:31558096 Ndufs7 Rat clobetasol increases expression ISO Ndufs7 (Mus musculus) 6480464 Clobetasol results in increased expression of NDUFS7 mRNA CTD PMID:27462272 Ndufs7 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of NDUFS7 mRNA CTD PMID:17602206 Ndufs7 Rat coenzyme Q10 increases expression ISO NDUFS7 (Homo sapiens) 6480464 coenzyme Q10 results in increased expression of NDUFS7 protein CTD PMID:19523936 Ndufs7 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NDUFS7 mRNA CTD PMID:22465980 Ndufs7 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NDUFS7 mRNA CTD PMID:22465980 Ndufs7 Rat corosolic acid decreases expression ISO NDUFS7 (Homo sapiens) 6480464 corosolic acid results in decreased expression of NDUFS7 mRNA CTD PMID:37939859 Ndufs7 Rat cyclosporin A decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NDUFS7 mRNA CTD PMID:20106945 Ndufs7 Rat deoxynivalenol decreases expression ISO NDUFS7 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of NDUFS7 protein CTD PMID:33890134 Ndufs7 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NDUFS7 mRNA CTD PMID:21266533 Ndufs7 Rat dibutyl phthalate decreases expression ISO Ndufs7 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NDUFS7 mRNA CTD PMID:17361019 Ndufs7 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NDUFS7 mRNA CTD PMID:29391264 Ndufs7 Rat epoxiconazole decreases expression ISO Ndufs7 (Mus musculus) 6480464 epoxiconazole results in decreased expression of NDUFS7 mRNA CTD PMID:35436446 Ndufs7 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of NDUFS7 mRNA CTD PMID:23962444 Ndufs7 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NDUFS7 mRNA CTD PMID:24136188 Ndufs7 Rat folic acid increases expression ISO Ndufs7 (Mus musculus) 6480464 Folic Acid results in increased expression of NDUFS7 mRNA CTD PMID:25629700 Ndufs7 Rat folpet decreases expression ISO Ndufs7 (Mus musculus) 6480464 folpet results in decreased expression of NDUFS7 mRNA CTD PMID:31558096 Ndufs7 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NDUFS7 mRNA CTD PMID:33387578 Ndufs7 Rat hypochlorous acid decreases expression ISO Ndufs7 (Mus musculus) 6480464 Hypochlorous Acid results in decreased expression of NDUFS7 mRNA CTD PMID:19376150 Ndufs7 Rat isotretinoin decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of NDUFS7 mRNA CTD PMID:20436886 Ndufs7 Rat ivermectin increases expression ISO NDUFS7 (Homo sapiens) 6480464 Ivermectin results in increased expression of NDUFS7 protein CTD PMID:32959892 Ndufs7 Rat malathion decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Malathion results in decreased expression of NDUFS7 mRNA CTD PMID:37047231 Ndufs7 Rat methyl methanesulfonate decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NDUFS7 mRNA CTD PMID:23649840 Ndufs7 Rat methylparaben decreases expression ISO NDUFS7 (Homo sapiens) 6480464 methylparaben results in decreased expression of NDUFS7 mRNA CTD PMID:38568856 Ndufs7 Rat monosodium L-glutamate multiple interactions ISO Ndufs7 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of NDUFS7 mRNA CTD PMID:19001666 Ndufs7 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFS7 mRNA CTD PMID:28659758 Ndufs7 Rat N-acetyl-L-cysteine increases expression ISO NDUFS7 (Homo sapiens) 6480464 Acetylcysteine results in increased expression of NDUFS7 protein CTD PMID:19523936 Ndufs7 Rat niclosamide decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Niclosamide results in decreased expression of NDUFS7 mRNA CTD PMID:22576131 Ndufs7 Rat nitrates multiple interactions ISO Ndufs7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NDUFS7 mRNA CTD PMID:35964746 Ndufs7 Rat ochratoxin A increases expression ISO NDUFS7 (Homo sapiens) 6480464 ochratoxin A results in increased expression of NDUFS7 mRNA CTD PMID:17316727 Ndufs7 Rat paracetamol affects expression ISO Ndufs7 (Mus musculus) 6480464 Acetaminophen affects the expression of NDUFS7 mRNA CTD PMID:17562736 Ndufs7 Rat paraquat increases expression ISO Ndufs7 (Mus musculus) 6480464 Paraquat results in increased expression of NDUFS7 mRNA CTD PMID:21371552 Ndufs7 Rat perfluorooctanoic acid increases expression ISO Ndufs7 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of NDUFS7 mRNA CTD PMID:20936131 Ndufs7 Rat perfluorooctanoic acid decreases expression ISO NDUFS7 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of NDUFS7 protein CTD PMID:26879310 Ndufs7 Rat perfluorooctanoic acid multiple interactions ISO Ndufs7 (Mus musculus) 6480464 PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of NDUFS7 mRNA] CTD PMID:20936131 Ndufs7 Rat permethrin multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFS7 mRNA CTD PMID:28659758 Ndufs7 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of NDUFS7 mRNA CTD PMID:28659758 Ndufs7 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of NDUFS7 mRNA CTD PMID:28374803 Ndufs7 Rat sodium arsenite decreases expression ISO NDUFS7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NDUFS7 mRNA CTD PMID:38568856 Ndufs7 Rat T-2 toxin multiple interactions EXP 6480464 GABPA promotes the reaction [T-2 Toxin results in increased expression of NDUFS7 mRNA] and T-2 Toxin promotes the reaction [GABPA protein binds to NDUFS7] CTD PMID:36863559 Ndufs7 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of NDUFS7 mRNA CTD PMID:29870751 and PMID:36863559 Ndufs7 Rat tert-butyl hydroperoxide decreases expression ISO NDUFS7 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of NDUFS7 mRNA CTD PMID:15336504 Ndufs7 Rat tetrachloroethene decreases expression ISO Ndufs7 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of NDUFS7 mRNA CTD PMID:28973375 Ndufs7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NDUFS7 mRNA CTD PMID:31150632 Ndufs7 Rat tetrachloromethane decreases expression ISO Ndufs7 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of NDUFS7 mRNA CTD PMID:31919559 Ndufs7 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NDUFS7 mRNA] CTD PMID:31150632 Ndufs7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NDUFS7 mRNA CTD PMID:23411599 and PMID:34492290 Ndufs7 Rat thiram decreases expression ISO NDUFS7 (Homo sapiens) 6480464 Thiram results in decreased expression of NDUFS7 mRNA CTD PMID:38568856 Ndufs7 Rat toluene affects expression EXP 6480464 Toluene affects the expression of NDUFS7 mRNA CTD PMID:21827849 Ndufs7 Rat Tributyltin oxide increases expression ISO Ndufs7 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of NDUFS7 mRNA CTD PMID:18958704 Ndufs7 Rat triphenyl phosphate affects expression ISO NDUFS7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDUFS7 mRNA CTD PMID:37042841 Ndufs7 Rat triptonide decreases expression ISO Ndufs7 (Mus musculus) 6480464 triptonide results in decreased expression of NDUFS7 mRNA CTD PMID:33045310 Ndufs7 Rat tungsten increases expression ISO Ndufs7 (Mus musculus) 6480464 Tungsten results in increased expression of NDUFS7 mRNA CTD PMID:30912803 Ndufs7 Rat tunicamycin increases expression ISO NDUFS7 (Homo sapiens) 6480464 Tunicamycin results in increased expression of NDUFS7 mRNA CTD PMID:29453283 Ndufs7 Rat valproic acid affects expression ISO NDUFS7 (Homo sapiens) 6480464 Valproic Acid affects the expression of NDUFS7 mRNA CTD PMID:25979313
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1.
Mitochondrial complex I activity and oxidative damage to mitochondrial proteins in the prefrontal cortex of patients with bipolar disorder.
Andreazza AC, etal., Arch Gen Psychiatry. 2010 Apr;67(4):360-8.
2.
Identification of two novel synaptic ¿-secretase associated proteins that affect amyloid ß-peptide levels without altering Notch processing.
Frykman S, etal., Neurochem Int. 2012 Jul;61(1):108-18. doi: 10.1016/j.neuint.2012.03.016. Epub 2012 Apr 10.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Proteomic and Metabolomic Analyses of Mitochondrial Complex I-deficient Mouse Model Generated by Spontaneous B2 Short Interspersed Nuclear Element (SINE) Insertion into NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4 (Ndufs4) Gene.
Leong DW, etal., J Biol Chem. 2012 Jun 8;287(24):20652-63. Epub 2012 Apr 25.
6.
Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.
Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
Ndufs7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 10,103,226 - 10,110,862 (-) NCBI GRCr8 mRatBN7.2 7 9,452,556 - 9,460,135 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 9,450,392 - 9,460,195 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 12,335,345 - 12,342,615 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 14,210,685 - 14,217,955 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 12,072,020 - 12,079,284 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 12,318,776 - 12,326,403 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 12,318,757 - 12,326,392 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 12,488,476 - 12,496,073 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,963,916 - 10,971,188 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,963,916 - 10,971,188 (-) NCBI Celera 7 7,629,258 - 7,636,522 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
NDUFS7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 1,383,907 - 1,395,584 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 1,383,527 - 1,395,589 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 1,383,906 - 1,395,583 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 1,334,906 - 1,346,581 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 1,334,905 - 1,346,582 NCBI Celera 19 1,318,163 - 1,329,866 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 1,158,739 - 1,170,441 (+) NCBI HuRef CHM1_1 19 1,383,997 - 1,395,689 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 1,353,497 - 1,365,582 (+) NCBI T2T-CHM13v2.0
Ndufs7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,084,939 - 80,092,628 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,084,955 - 80,092,628 (+) Ensembl GRCm39 Ensembl GRCm38 10 80,249,105 - 80,256,794 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 80,249,121 - 80,256,794 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 79,712,197 - 79,719,537 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 79,652,581 - 79,659,921 (+) NCBI MGSCv36 mm8 Celera 10 81,264,325 - 81,271,665 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Ndufs7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 6,540,450 - 6,547,975 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 6,540,360 - 6,548,072 (-) NCBI ChiLan1.0 ChiLan1.0
NDUFS7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 5,729,271 - 5,741,584 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 4,965,943 - 4,978,502 (+) NCBI NHGRI_mPanPan1 PanPan1.1 19 1,357,389 - 1,369,539 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 1,357,389 - 1,369,539 (+) Ensembl panpan1.1 panPan2
NDUFS7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 57,443,264 - 57,448,892 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 57,443,258 - 57,448,825 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 57,234,471 - 57,239,883 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 58,173,790 - 58,179,361 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 58,173,789 - 58,179,144 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 57,229,766 - 57,236,137 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 57,709,442 - 57,714,993 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 57,911,449 - 57,916,852 (-) NCBI UU_Cfam_GSD_1.0
Ndufs7
NDUFS7
NDUFS7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 1,152,380 - 1,163,488 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 1,152,540 - 1,164,175 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 7,698,881 - 7,710,027 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndufs7
.
Predicted Target Of
Count of predictions: 56 Count of miRNA genes: 55 Interacting mature miRNAs: 56 Transcripts: ENSRNOT00000039728 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
RH128241
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 10,103,235 - 10,104,067 (+) Marker Load Pipeline mRatBN7.2 7 9,452,565 - 9,453,397 (+) MAPPER mRatBN7.2 Rnor_6.0 7 12,318,786 - 12,319,617 NCBI Rnor6.0 Rnor_5.0 7 12,488,486 - 12,489,317 UniSTS Rnor5.0 RGSC_v3.4 7 10,963,926 - 10,964,757 UniSTS RGSC3.4 Celera 7 7,629,268 - 7,630,099 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039728 ⟹ ENSRNOP00000037256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,452,555 - 9,460,195 (-) Ensembl Rnor_6.0 Ensembl 7 12,318,757 - 12,326,392 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099635 ⟹ ENSRNOP00000095566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,450,392 - 9,459,835 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108576 ⟹ ENSRNOP00000092039
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 9,450,392 - 9,460,158 (-) Ensembl
RefSeq Acc Id:
NM_001008525 ⟹ NP_001008525
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,103,226 - 10,110,498 (-) NCBI mRatBN7.2 7 9,452,556 - 9,459,828 (-) NCBI Rnor_6.0 7 12,318,776 - 12,326,048 (-) NCBI Rnor_5.0 7 12,488,476 - 12,496,073 (-) NCBI RGSC_v3.4 7 10,963,916 - 10,971,188 (-) RGD Celera 7 7,629,258 - 7,636,522 (-) RGD
Sequence:
GGCCAAGATGGCGGCGCTGGCGGCTCCTGGCTTGCTCTCTGTACGGATCCTGGGTCTGCGCACAGGCACAGTGGCTCAGCTGCGCAGAGCCCACCAGAGTGTGGCAGCCACTGGGAGCCCGAGCAGCA
hide sequence
RefSeq Acc Id:
XM_006240972 ⟹ XP_006241034
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,103,226 - 10,110,862 (-) NCBI mRatBN7.2 7 9,452,556 - 9,460,135 (-) NCBI Rnor_6.0 7 12,318,776 - 12,326,403 (-) NCBI Rnor_5.0 7 12,488,476 - 12,496,073 (-) NCBI
Sequence:
ATGAGTTAAACCTCGTAGGTTTATACTATAGAAAGCTTCACAATGTCGTCTCTGTGGCGCAATCGGTTAGCGCGTTCGGCTGTTAACCGAAAGGAGGACGGTTGTGTACACTGCTCGGGCGCGATCAC
hide sequence
RefSeq Acc Id:
XM_039079404 ⟹ XP_038935332
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,103,226 - 10,110,805 (-) NCBI mRatBN7.2 7 9,452,556 - 9,460,135 (-) NCBI
RefSeq Acc Id:
XM_039079405 ⟹ XP_038935333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 10,103,226 - 10,107,996 (-) NCBI mRatBN7.2 7 9,452,556 - 9,457,327 (-) NCBI
RefSeq Acc Id:
NP_001008525 ⟸ NM_001008525
- UniProtKB:
Q5RJN0 (UniProtKB/TrEMBL), A6K8N6 (UniProtKB/TrEMBL), A0A8I6AES7 (UniProtKB/TrEMBL), A0A8I6B2Z5 (UniProtKB/TrEMBL)
- Sequence:
MAALAAPGLLSVRILGLRTGTVAQLRRAHQSVAATGSPSSTQSAVSKAGAGAVVPKPSHLPRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVA
hide sequence
RefSeq Acc Id:
XP_006241034 ⟸ XM_006240972
- Peptide Label:
isoform X2
- UniProtKB:
Q5RJN0 (UniProtKB/TrEMBL), A6K8N6 (UniProtKB/TrEMBL), A0A8I6AES7 (UniProtKB/TrEMBL), A0A8I6B2Z5 (UniProtKB/TrEMBL)
- Sequence:
MAALAAPGLLSVRILGLRTGTVAQLRRAHQSVAATGSPSSTQSAVSKAGAGAVVPKPSHLPRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000037256 ⟸ ENSRNOT00000039728
RefSeq Acc Id:
XP_038935332 ⟸ XM_039079404
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AES7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935333 ⟸ XM_039079405
- Peptide Label:
isoform X3
- UniProtKB:
A6K8N7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092039 ⟸ ENSRNOT00000108576
Ensembl Acc Id:
ENSRNOP00000095566 ⟸ ENSRNOT00000099635
RGD ID: 13695028 Promoter ID: EPDNEW_R5553 Type: multiple initiation site Name: Ndufs7_1 Description: NADH:ubiquinone oxidoreductase core subunit S7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 12,326,061 - 12,326,121 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Ndufs7
NADH:ubiquinone oxidoreductase core subunit S7
Ndufs7
NADH dehydrogenase (ubiquinone) Fe-S protein 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Ndufs7
NADH dehydrogenase (ubiquinone) Fe-S protein 7
Ndufs7_predicted
NADH dehydrogenase (ubiquinone) Fe-S protein 7 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ndufs7_predicted
NADH dehydrogenase (ubiquinone) Fe-S protein 7 (predicted)
Symbol and Name status set to approved
70820 APPROVED
