Symbol:
Ppp1r3c
Name:
protein phosphatase 1, regulatory subunit 3C
RGD ID:
1309132
Description:
Enables [phosphorylase] phosphatase activity and enzyme binding activity. Contributes to phosphoprotein phosphatase activity. Involved in regulation of glycogen biosynthetic process and regulation of glycogen catabolic process. Located in glycogen granule. Orthologous to human PPP1R3C (protein phosphatase 1 regulatory subunit 3C); PARTICIPATES IN glycogen biosynthetic pathway; glycogen degradation pathway; insulin signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC100910671; LOC309513; PP1 subunit R5; protein phosphatase 1 regulatory subunit 3C; protein phosphatase 1 regulatory subunit 3C-like; protein phosphatase 1 regulatory subunit 5; protein phosphatase 1, regulatory (inhibitor) subunit 3C; protein targeting to glycogen; PTG; R5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Ppp1r3c (protein phosphatase 1, regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp1r3c (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp1r3c (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp1r3c (protein phosphatase 1 regulatory subunit 3C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PPP1R3C (protein phosphatase 1 regulatory subunit 3C)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ppp1r3c (protein phosphatase 1, regulatory subunit 3C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp1r3cb (protein phosphatase 1, regulatory subunit 3Cb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp1r3ca (protein phosphatase 1, regulatory subunit 3Ca)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
GAC1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
H18N23.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GIP2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Gbs-70E
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PIG2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
PIG1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ppp1r3c
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 243,873,524 - 243,878,527 (-) NCBI GRCr8 mRatBN7.2 1 234,460,958 - 234,465,961 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 234,460,652 - 234,465,961 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 242,855,971 - 242,860,979 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 249,778,292 - 249,783,285 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 242,616,484 - 242,621,477 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 255,371,830 - 255,376,833 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,371,810 - 255,376,833 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 262,628,937 - 262,633,940 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 240,991,884 - 240,996,887 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 241,175,278 - 241,180,280 (-) NCBI Celera 1 231,556,257 - 231,561,260 (-) NCBI Celera Cytogenetic Map 1 q53 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp1r3c Rat (+)-catechin multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PPP1R3C mRNA CTD PMID:24763279 Ppp1r3c Rat (1->4)-beta-D-glucan multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PPP1R3C mRNA CTD PMID:36331819 Ppp1r3c Rat (S)-amphetamine increases expression ISO Ppp1r3c (Mus musculus) 6480464 Dextroamphetamine results in increased expression of PPP1R3C mRNA CTD PMID:19194377 Ppp1r3c Rat 1,2-dichloroethane decreases expression ISO Ppp1r3c (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PPP1R3C mRNA CTD PMID:28960355 Ppp1r3c Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of PPP1R3C mRNA CTD PMID:25380136 and PMID:30723492 Ppp1r3c Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PPP1R3C mRNA CTD PMID:17351261 Ppp1r3c Rat 17beta-estradiol multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PPP1R3C mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of PPP1R3C mRNA CTD PMID:19619570 and PMID:30165855 Ppp1r3c Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PPP1R3C mRNA CTD PMID:35192832 Ppp1r3c Rat 17beta-estradiol increases expression ISO Ppp1r3c (Mus musculus) 6480464 Estradiol results in increased expression of PPP1R3C mRNA CTD PMID:39298647 Ppp1r3c Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PPP1R3C mRNA CTD PMID:32145629 Ppp1r3c Rat 17beta-estradiol decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Estradiol results in decreased expression of PPP1R3C mRNA CTD PMID:19619570 more ... Ppp1r3c Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PPP1R3C mRNA CTD PMID:19619570 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP1R3C mRNA CTD PMID:33387578 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ppp1r3c (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP1R3C mRNA CTD PMID:26290441 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppp1r3c (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPP1R3C mRNA CTD PMID:19770486 more ... Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of PPP1R3C mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PPP1R3C gene] CTD PMID:25975270 and PMID:28213091 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R3C mRNA CTD PMID:21215274 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R3C mRNA CTD PMID:19619570 and PMID:20106945 Ppp1r3c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R3C mRNA CTD PMID:19933214 more ... Ppp1r3c Rat 2-hydroxypropanoic acid decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PPP1R3C mRNA CTD PMID:30851411 Ppp1r3c Rat 2-methylcholine affects expression ISO PPP1R3C (Homo sapiens) 6480464 beta-methylcholine affects the expression of PPP1R3C mRNA CTD PMID:21179406 Ppp1r3c Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Ppp1r3c Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PPP1R3C mRNA CTD PMID:25380136 Ppp1r3c Rat 4,4'-sulfonyldiphenol increases expression ISO Ppp1r3c (Mus musculus) 6480464 bisphenol S results in increased expression of PPP1R3C mRNA CTD PMID:30951980 and PMID:39298647 Ppp1r3c Rat 4-hydroxyphenyl retinamide decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Fenretinide results in decreased expression of PPP1R3C mRNA CTD PMID:15958647 Ppp1r3c Rat 5-aza-2'-deoxycytidine multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[Decitabine co-treated with trichostatin A] affects the methylation of PPP1R3C promoter] which affects the expression of PPP1R3C mRNA CTD PMID:18803327 Ppp1r3c Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PPP1R3C mRNA CTD PMID:30047161 Ppp1r3c Rat 7,12-dimethyltetraphene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Ppp1r3c Rat 8-Br-cAMP increases expression ISO PPP1R3C (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of PPP1R3C mRNA CTD PMID:20147733 Ppp1r3c Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PPP1R3C mRNA CTD PMID:31881176 Ppp1r3c Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PPP1R3C mRNA CTD PMID:28959563 Ppp1r3c Rat aflatoxin B1 affects expression ISO PPP1R3C (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of PPP1R3C protein CTD PMID:20106945 Ppp1r3c Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PPP1R3C mRNA CTD PMID:33354967 Ppp1r3c Rat aflatoxin B1 decreases methylation ISO PPP1R3C (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PPP1R3C gene CTD PMID:27153756 Ppp1r3c Rat aflatoxin B1 decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of PPP1R3C mRNA CTD PMID:27153756 Ppp1r3c Rat all-trans-retinoic acid decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Tretinoin results in decreased expression of PPP1R3C mRNA CTD PMID:16249480 Ppp1r3c Rat all-trans-retinoic acid multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in increased expression of PPP1R3C mRNA CTD PMID:30951980 Ppp1r3c Rat all-trans-retinoic acid increases expression ISO PPP1R3C (Homo sapiens) 6480464 Tretinoin results in increased expression of PPP1R3C mRNA CTD PMID:23724009 Ppp1r3c Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PPP1R3C mRNA CTD PMID:35163327 Ppp1r3c Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPP1R3C mRNA CTD PMID:35163327 Ppp1r3c Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PPP1R3C mRNA CTD PMID:30047161 Ppp1r3c Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PPP1R3C mRNA CTD PMID:30779732 Ppp1r3c Rat amphotericin B decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of PPP1R3C mRNA CTD PMID:28534445 Ppp1r3c Rat antirheumatic drug increases expression ISO PPP1R3C (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PPP1R3C mRNA CTD PMID:24449571 Ppp1r3c Rat aristolochic acid A decreases expression ISO PPP1R3C (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PPP1R3C mRNA CTD PMID:33212167 Ppp1r3c Rat arsane multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat arsenic atom multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat arsenite(3-) multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PPP1R3C mRNA CTD PMID:15894712 Ppp1r3c Rat arsenite(3-) decreases expression ISO Ppp1r3c (Mus musculus) 6480464 arsenite results in decreased expression of PPP1R3C mRNA CTD PMID:15894712 Ppp1r3c Rat atazanavir sulfate multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of PPP1R3C mRNA CTD PMID:33819548 Ppp1r3c Rat atrazine increases expression ISO PPP1R3C (Homo sapiens) 6480464 Atrazine results in increased expression of PPP1R3C mRNA CTD PMID:22378314 Ppp1r3c Rat avobenzone decreases expression ISO PPP1R3C (Homo sapiens) 6480464 avobenzone results in decreased expression of PPP1R3C mRNA CTD PMID:31016361 Ppp1r3c Rat azathioprine decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Azathioprine results in decreased expression of PPP1R3C mRNA CTD PMID:22623647 Ppp1r3c Rat benzo[a]pyrene multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of PPP1R3C mRNA and AHR protein inhibits the reaction [Benzo(a)pyrene results in decreased expression of PPP1R3C mRNA] CTD PMID:15034205 and PMID:15894712 Ppp1r3c Rat benzo[a]pyrene increases methylation ISO PPP1R3C (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PPP1R3C 3' UTR more ... CTD PMID:27901495 Ppp1r3c Rat benzo[a]pyrene decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PPP1R3C mRNA CTD PMID:21632981 more ... Ppp1r3c Rat benzo[a]pyrene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in decreased expression of PPP1R3C mRNA and Benzo(a)pyrene results in decreased expression of PPP1R3C mRNA CTD PMID:15034205 more ... Ppp1r3c Rat benzo[a]pyrene increases expression ISO Ppp1r3c (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PPP1R3C mRNA CTD PMID:19770486 Ppp1r3c Rat benzo[a]pyrene diol epoxide I increases expression ISO PPP1R3C (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Ppp1r3c Rat benzo[b]fluoranthene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of PPP1R3C mRNA CTD PMID:26377693 Ppp1r3c Rat bis(2-ethylhexyl) phthalate decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PPP1R3C mRNA CTD PMID:31163220 Ppp1r3c Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PPP1R3C mRNA CTD PMID:30903817 Ppp1r3c Rat bisphenol A decreases expression ISO Ppp1r3c (Mus musculus) 6480464 bisphenol A results in decreased expression of PPP1R3C mRNA CTD PMID:34585602 Ppp1r3c Rat bisphenol A multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in increased expression of PPP1R3C mRNA CTD PMID:30951980 Ppp1r3c Rat bisphenol A affects expression ISO PPP1R3C (Homo sapiens) 6480464 bisphenol A affects the expression of PPP1R3C mRNA CTD PMID:30903817 Ppp1r3c Rat bisphenol A increases expression ISO PPP1R3C (Homo sapiens) 6480464 bisphenol A results in increased expression of PPP1R3C mRNA CTD PMID:29275510 Ppp1r3c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPP1R3C mRNA CTD PMID:30816183 more ... Ppp1r3c Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPP1R3C mRNA CTD PMID:25181051 and PMID:32145629 Ppp1r3c Rat bisphenol F increases expression ISO Ppp1r3c (Mus musculus) 6480464 bisphenol F results in increased expression of PPP1R3C mRNA CTD PMID:30951980 and PMID:38685157 Ppp1r3c Rat camptothecin increases expression ISO PPP1R3C (Homo sapiens) 6480464 Camptothecin results in increased expression of PPP1R3C mRNA CTD PMID:38460933 Ppp1r3c Rat cannabidiol increases expression ISO PPP1R3C (Homo sapiens) 6480464 Cannabidiol results in increased expression of PPP1R3C mRNA CTD PMID:26504004 Ppp1r3c Rat cantharidin decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Cantharidin results in decreased expression of PPP1R3C mRNA CTD PMID:36907384 Ppp1r3c Rat carbon nanotube affects expression ISO Ppp1r3c (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PPP1R3C mRNA CTD PMID:25554681 Ppp1r3c Rat carbon nanotube increases expression ISO Ppp1r3c (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of PPP1R3C mRNA CTD PMID:25620056 Ppp1r3c Rat carbon nanotube decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PPP1R3C mRNA CTD PMID:25554681 Ppp1r3c Rat CGP 52608 multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PPP1R3C gene] CTD PMID:28238834 Ppp1r3c Rat chenodeoxycholic acid multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA more ... CTD PMID:33819548 Ppp1r3c Rat chlordecone increases expression ISO Ppp1r3c (Mus musculus) 6480464 Chlordecone results in increased expression of PPP1R3C mRNA CTD PMID:33711761 Ppp1r3c Rat chloropicrin increases expression ISO PPP1R3C (Homo sapiens) 6480464 chloropicrin results in increased expression of PPP1R3C mRNA CTD PMID:26352163 Ppp1r3c Rat chloroprene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Chloroprene results in decreased expression of PPP1R3C mRNA CTD PMID:23125180 Ppp1r3c Rat chlorpyrifos increases methylation EXP 6480464 Chlorpyrifos results in increased methylation of PPP1R3C gene CTD PMID:32905263 Ppp1r3c Rat choline multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PPP1R3C mRNA CTD PMID:20938992 Ppp1r3c Rat chromium(6+) multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PPP1R3C mRNA CTD PMID:38479592 Ppp1r3c Rat cisplatin increases expression ISO PPP1R3C (Homo sapiens) 6480464 Cisplatin results in increased expression of PPP1R3C mRNA CTD PMID:27392435 Ppp1r3c Rat clobetasol increases expression ISO Ppp1r3c (Mus musculus) 6480464 Clobetasol results in increased expression of PPP1R3C mRNA CTD PMID:27462272 Ppp1r3c Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PPP1R3C mRNA CTD PMID:17602206 Ppp1r3c Rat clothianidin increases expression ISO PPP1R3C (Homo sapiens) 6480464 clothianidin results in increased expression of PPP1R3C mRNA CTD PMID:29044138 Ppp1r3c Rat cobalt atom multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of PPP1R3C mRNA CTD PMID:20105288 Ppp1r3c Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PPP1R3C mRNA CTD PMID:24386269 Ppp1r3c Rat cobalt dichloride increases expression ISO PPP1R3C (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PPP1R3C mRNA CTD PMID:19376846 and PMID:20105288 Ppp1r3c Rat copper atom multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPP1R3C mRNA CTD PMID:24690739 Ppp1r3c Rat copper(0) multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPP1R3C mRNA CTD PMID:24690739 Ppp1r3c Rat copper(II) sulfate decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PPP1R3C mRNA CTD PMID:19549813 Ppp1r3c Rat crocidolite asbestos decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of PPP1R3C mRNA CTD PMID:25351596 Ppp1r3c Rat cyclosporin A decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Cyclosporine results in decreased expression of PPP1R3C mRNA CTD PMID:19770486 Ppp1r3c Rat cyclosporin A multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in decreased expression of PPP1R3C mRNA CTD PMID:33819548 Ppp1r3c Rat cyclosporin A decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PPP1R3C mRNA CTD PMID:20106945 more ... Ppp1r3c Rat cyclosporin A increases expression ISO Ppp1r3c (Mus musculus) 6480464 Cyclosporine results in increased expression of PPP1R3C mRNA CTD PMID:25270620 Ppp1r3c Rat deoxycholic acid multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA more ... CTD PMID:33819548 Ppp1r3c Rat dexamethasone decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PPP1R3C mRNA CTD PMID:25047013 Ppp1r3c Rat dibenz[a,h]anthracene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ppp1r3c Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of PPP1R3C mRNA CTD PMID:21161181 Ppp1r3c Rat dioxygen increases expression ISO Ppp1r3c (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PPP1R3C mRNA CTD PMID:20880076 Ppp1r3c Rat dioxygen multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PPP1R3C mRNA CTD PMID:30529165 Ppp1r3c Rat dioxygen increases expression ISO PPP1R3C (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PPP1R3C mRNA CTD PMID:20042640 and PMID:26516004 Ppp1r3c Rat disulfiram multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of PPP1R3C mRNA CTD PMID:24690739 Ppp1r3c Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PPP1R3C mRNA CTD PMID:21551480 Ppp1r3c Rat dorsomorphin multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP1R3C mRNA CTD PMID:27188386 Ppp1r3c Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PPP1R3C mRNA CTD PMID:29391264 Ppp1r3c Rat entinostat increases expression ISO PPP1R3C (Homo sapiens) 6480464 entinostat results in increased expression of PPP1R3C mRNA CTD PMID:27188386 Ppp1r3c Rat epoxiconazole increases expression ISO Ppp1r3c (Mus musculus) 6480464 epoxiconazole results in increased expression of PPP1R3C mRNA CTD PMID:35436446 Ppp1r3c Rat ethanol affects expression ISO Ppp1r3c (Mus musculus) 6480464 Ethanol affects the expression of PPP1R3C mRNA CTD PMID:30319688 Ppp1r3c Rat ethanol increases expression ISO Ppp1r3c (Mus musculus) 6480464 Ethanol results in increased expression of PPP1R3C mRNA CTD PMID:30319688 Ppp1r3c Rat folic acid multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PPP1R3C mRNA CTD PMID:20938992 Ppp1r3c Rat formaldehyde decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PPP1R3C mRNA CTD PMID:27905399 Ppp1r3c Rat furan increases methylation EXP 6480464 furan results in increased methylation of PPP1R3C gene CTD PMID:22079235 Ppp1r3c Rat genistein decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Genistein results in decreased expression of PPP1R3C mRNA CTD PMID:22228119 Ppp1r3c Rat glutathione increases expression EXP 6480464 Glutathione deficiency results in increased expression of PPP1R3C mRNA CTD PMID:20621112 Ppp1r3c Rat glycochenodeoxycholic acid multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA more ... CTD PMID:33819548 Ppp1r3c Rat glycocholic acid multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA more ... CTD PMID:33819548 Ppp1r3c Rat glycodeoxycholic acid multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA more ... CTD PMID:33819548 Ppp1r3c Rat GW 4064 decreases expression ISO Ppp1r3c (Mus musculus) 6480464 GW 4064 results in decreased expression of PPP1R3C mRNA CTD PMID:26655953 Ppp1r3c Rat hydrogen peroxide affects expression ISO PPP1R3C (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PPP1R3C mRNA CTD PMID:23410634 Ppp1r3c Rat imiquimod multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [resveratrol co-treated with imiquimod] results in decreased expression of PPP1R3C mRNA CTD PMID:25965695 Ppp1r3c Rat L-methionine multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of PPP1R3C mRNA CTD PMID:20938992 Ppp1r3c Rat lead(0) affects expression ISO PPP1R3C (Homo sapiens) 6480464 Lead affects the expression of PPP1R3C mRNA CTD PMID:28903495 Ppp1r3c Rat manganese atom multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat manganese(0) multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat manganese(II) chloride multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat menadione affects expression ISO PPP1R3C (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PPP1R3C mRNA CTD PMID:23410634 Ppp1r3c Rat metformin increases expression EXP 6480464 Metformin results in increased expression of PPP1R3C mRNA CTD PMID:31324951 Ppp1r3c Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PPP1R3C mRNA CTD PMID:30047161 Ppp1r3c Rat methotrexate affects expression ISO Ppp1r3c (Mus musculus) 6480464 Methotrexate affects the expression of PPP1R3C mRNA CTD PMID:18502557 Ppp1r3c Rat methotrexate increases expression ISO PPP1R3C (Homo sapiens) 6480464 Methotrexate results in increased expression of PPP1R3C mRNA CTD PMID:24449571 Ppp1r3c Rat methylisothiazolinone increases expression ISO PPP1R3C (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of PPP1R3C mRNA CTD PMID:31629900 Ppp1r3c Rat methylmercury chloride increases expression ISO PPP1R3C (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PPP1R3C mRNA CTD PMID:28001369 Ppp1r3c Rat methylparaben increases expression ISO PPP1R3C (Homo sapiens) 6480464 methylparaben results in increased expression of PPP1R3C mRNA CTD PMID:31745603 Ppp1r3c Rat miconazole increases expression ISO Ppp1r3c (Mus musculus) 6480464 Miconazole results in increased expression of PPP1R3C mRNA CTD PMID:27462272 Ppp1r3c Rat N(4)-hydroxycytidine decreases expression ISO Ppp1r3c (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of PPP1R3C mRNA CTD PMID:37748715 Ppp1r3c Rat N-ethyl-N-nitrosourea increases expression ISO Ppp1r3c (Mus musculus) 6480464 Ethylnitrosourea results in increased expression of PPP1R3C mRNA CTD PMID:19100860 Ppp1r3c Rat N-nitrosodiethylamine increases expression ISO Ppp1r3c (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PPP1R3C mRNA CTD PMID:19100860 Ppp1r3c Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PPP1R3C mRNA CTD PMID:17602206 Ppp1r3c Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of PPP1R3C mRNA CTD PMID:25380136 Ppp1r3c Rat nefazodone multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in decreased expression of PPP1R3C mRNA CTD PMID:33819548 Ppp1r3c Rat nickel atom increases expression ISO PPP1R3C (Homo sapiens) 6480464 Nickel results in increased expression of PPP1R3C mRNA CTD PMID:25583101 Ppp1r3c Rat nickel dichloride increases expression ISO PPP1R3C (Homo sapiens) 6480464 nickel chloride results in increased expression of PPP1R3C mRNA CTD PMID:21455298 Ppp1r3c Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of PPP1R3C mRNA CTD PMID:22110744 Ppp1r3c Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PPP1R3C mRNA CTD PMID:24136188 Ppp1r3c Rat obeticholic acid decreases expression ISO PPP1R3C (Homo sapiens) 6480464 obeticholic acid results in decreased expression of PPP1R3C mRNA CTD PMID:27939613 Ppp1r3c Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of PPP1R3C mRNA CTD PMID:27638505 Ppp1r3c Rat paracetamol affects expression ISO Ppp1r3c (Mus musculus) 6480464 Acetaminophen affects the expression of PPP1R3C mRNA CTD PMID:15606129 Ppp1r3c Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PPP1R3C mRNA CTD PMID:33387578 Ppp1r3c Rat paracetamol multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PPP1R3C mRNA CTD PMID:33819548 Ppp1r3c Rat paracetamol increases expression ISO PPP1R3C (Homo sapiens) 6480464 Acetaminophen results in increased expression of PPP1R3C mRNA CTD PMID:21420995 Ppp1r3c Rat paraquat increases expression ISO Ppp1r3c (Mus musculus) 6480464 Paraquat results in increased expression of PPP1R3C mRNA CTD PMID:21463325 Ppp1r3c Rat parathion decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Parathion results in decreased expression of PPP1R3C mRNA CTD PMID:34813904 Ppp1r3c Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Ppp1r3c Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PPP1R3C mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PPP1R3C mRNA CTD PMID:36331819 Ppp1r3c Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPP1R3C mRNA CTD PMID:35163327 Ppp1r3c Rat phenobarbital increases expression ISO Ppp1r3c (Mus musculus) 6480464 Phenobarbital results in increased expression of PPP1R3C mRNA CTD PMID:19270015 Ppp1r3c Rat phenylmercury acetate decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PPP1R3C mRNA CTD PMID:26272509 Ppp1r3c Rat phenylmercury acetate multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP1R3C mRNA CTD PMID:27188386 Ppp1r3c Rat pioglitazone multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of PPP1R3C mRNA CTD PMID:27935865 Ppp1r3c Rat pirinixic acid decreases expression ISO Ppp1r3c (Mus musculus) 6480464 pirinixic acid results in decreased expression of PPP1R3C mRNA CTD PMID:20813756 Ppp1r3c Rat pirinixic acid increases expression ISO Ppp1r3c (Mus musculus) 6480464 pirinixic acid results in increased expression of PPP1R3C mRNA CTD PMID:18445702 Ppp1r3c Rat pirinixic acid multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of PPP1R3C mRNA CTD PMID:20813756 Ppp1r3c Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of PPP1R3C mRNA CTD PMID:28903501 Ppp1r3c Rat propiconazole decreases expression ISO Ppp1r3c (Mus musculus) 6480464 propiconazole results in decreased expression of PPP1R3C mRNA CTD PMID:21278054 Ppp1r3c Rat quercetin decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Quercetin results in decreased expression of PPP1R3C mRNA CTD PMID:21632981 Ppp1r3c Rat quinolin-8-ol decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of PPP1R3C mRNA CTD PMID:21632981 Ppp1r3c Rat rac-lactic acid decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PPP1R3C mRNA CTD PMID:30851411 Ppp1r3c Rat resveratrol multiple interactions ISO Ppp1r3c (Mus musculus) 6480464 [resveratrol co-treated with imiquimod] results in decreased expression of PPP1R3C mRNA CTD PMID:25965695 Ppp1r3c Rat rotenone decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Rotenone results in decreased expression of PPP1R3C mRNA CTD PMID:23186747 Ppp1r3c Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PPP1R3C (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PPP1R3C mRNA CTD PMID:33725128 Ppp1r3c Rat SB 431542 multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PPP1R3C mRNA CTD PMID:27188386 Ppp1r3c Rat silicon dioxide decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PPP1R3C mRNA and Silicon Dioxide results in decreased expression of PPP1R3C mRNA CTD PMID:25351596 and PMID:25895662 Ppp1r3c Rat silver atom increases expression ISO PPP1R3C (Homo sapiens) 6480464 Silver results in increased expression of PPP1R3C mRNA CTD PMID:26551752 Ppp1r3c Rat silver(0) increases expression ISO PPP1R3C (Homo sapiens) 6480464 Silver results in increased expression of PPP1R3C mRNA CTD PMID:26551752 Ppp1r3c Rat sodium arsenite increases expression ISO PPP1R3C (Homo sapiens) 6480464 sodium arsenite results in increased expression of PPP1R3C mRNA CTD PMID:38568856 Ppp1r3c Rat sodium arsenite multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PPP1R3C mRNA CTD PMID:39836092 Ppp1r3c Rat Soman increases expression EXP 6480464 Soman results in increased expression of PPP1R3C mRNA CTD PMID:19281266 Ppp1r3c Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of PPP1R3C mRNA CTD PMID:25905778 Ppp1r3c Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PPP1R3C mRNA CTD PMID:30047161 Ppp1r3c Rat sulforaphane decreases expression ISO PPP1R3C (Homo sapiens) 6480464 sulforaphane results in decreased expression of PPP1R3C mRNA CTD PMID:31838189 Ppp1r3c Rat sunitinib increases expression ISO PPP1R3C (Homo sapiens) 6480464 Sunitinib results in increased expression of PPP1R3C mRNA CTD PMID:31533062 Ppp1r3c Rat tamoxifen affects expression ISO Ppp1r3c (Mus musculus) 6480464 Tamoxifen affects the expression of PPP1R3C mRNA CTD PMID:20937368 Ppp1r3c Rat tartrazine multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in decreased expression of PPP1R3C mRNA CTD PMID:33819548 Ppp1r3c Rat tert-butyl hydroperoxide decreases expression ISO PPP1R3C (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PPP1R3C mRNA CTD PMID:15336504 Ppp1r3c Rat tert-butyl hydroperoxide affects expression ISO PPP1R3C (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of PPP1R3C mRNA CTD PMID:23410634 Ppp1r3c Rat testosterone increases expression ISO Ppp1r3c (Mus musculus) 6480464 Testosterone results in increased expression of PPP1R3C mRNA CTD PMID:20403060 Ppp1r3c Rat testosterone decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Testosterone results in decreased expression of PPP1R3C mRNA CTD PMID:33359661 Ppp1r3c Rat tetrachloromethane decreases expression ISO Ppp1r3c (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of PPP1R3C mRNA CTD PMID:31919559 Ppp1r3c Rat tetracycline increases expression ISO Ppp1r3c (Mus musculus) 6480464 Tetracycline results in increased expression of PPP1R3C mRNA CTD PMID:16917069 Ppp1r3c Rat tetraphene decreases expression ISO Ppp1r3c (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of PPP1R3C mRNA CTD PMID:26377693 Ppp1r3c Rat thapsigargin decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PPP1R3C mRNA CTD PMID:22378314 Ppp1r3c Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PPP1R3C mRNA CTD PMID:23411599 and PMID:34492290 Ppp1r3c Rat thiram increases expression ISO PPP1R3C (Homo sapiens) 6480464 Thiram results in increased expression of PPP1R3C mRNA CTD PMID:38568856 Ppp1r3c Rat titanium dioxide decreases expression ISO Ppp1r3c (Mus musculus) 6480464 titanium dioxide results in decreased expression of PPP1R3C mRNA CTD PMID:27760801 Ppp1r3c Rat tremolite asbestos increases expression ISO Ppp1r3c (Mus musculus) 6480464 tremolite results in increased expression of PPP1R3C mRNA CTD PMID:29279043 Ppp1r3c Rat tributylstannane decreases expression ISO Ppp1r3c (Mus musculus) 6480464 tributyltin results in decreased expression of PPP1R3C mRNA CTD PMID:31939706 Ppp1r3c Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PPP1R3C mRNA CTD PMID:33387578 Ppp1r3c Rat trichostatin A multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [[decitabine co-treated with trichostatin A] affects the methylation of PPP1R3C promoter] which affects the expression of PPP1R3C mRNA CTD PMID:18803327 Ppp1r3c Rat trichostatin A increases expression ISO PPP1R3C (Homo sapiens) 6480464 trichostatin A results in increased expression of PPP1R3C mRNA CTD PMID:24935251 Ppp1r3c Rat triclosan decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Triclosan results in decreased expression of PPP1R3C mRNA CTD PMID:30510588 and PMID:34681664 Ppp1r3c Rat trimellitic anhydride decreases expression ISO Ppp1r3c (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of PPP1R3C mRNA CTD PMID:19042947 Ppp1r3c Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of PPP1R3C mRNA CTD PMID:30589522 Ppp1r3c Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of PPP1R3C mRNA CTD PMID:23639586 Ppp1r3c Rat triptonide increases expression ISO Ppp1r3c (Mus musculus) 6480464 triptonide results in increased expression of PPP1R3C mRNA CTD PMID:33045310 Ppp1r3c Rat triticonazole increases expression EXP 6480464 triticonazole results in increased expression of PPP1R3C mRNA CTD PMID:36084822 Ppp1r3c Rat Tungsten carbide multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of PPP1R3C mRNA CTD PMID:20105288 Ppp1r3c Rat tunicamycin decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PPP1R3C mRNA CTD PMID:22378314 Ppp1r3c Rat valproic acid affects expression ISO PPP1R3C (Homo sapiens) 6480464 Valproic Acid affects the expression of PPP1R3C mRNA CTD PMID:25979313 Ppp1r3c Rat valproic acid decreases expression ISO PPP1R3C (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPP1R3C mRNA CTD PMID:29154799 Ppp1r3c Rat valproic acid increases expression ISO PPP1R3C (Homo sapiens) 6480464 Valproic Acid results in increased expression of PPP1R3C mRNA CTD PMID:24383497 more ... Ppp1r3c Rat valsartan multiple interactions ISO PPP1R3C (Homo sapiens) 6480464 Valsartan inhibits the reaction [AGT protein results in decreased expression of PPP1R3C mRNA] CTD PMID:19225232 Ppp1r3c Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PPP1R3C mRNA CTD PMID:20566332 Ppp1r3c Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PPP1R3C mRNA CTD PMID:19015723 Ppp1r3c Rat zinc sulfate increases expression ISO PPP1R3C (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of PPP1R3C mRNA CTD PMID:16330358
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) (S)-amphetamine (ISO) 1,2-dichloroethane (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) amphetamine (EXP) amphotericin B (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atazanavir sulfate (ISO) atrazine (ISO) avobenzone (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) camptothecin (ISO) cannabidiol (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (EXP) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clobetasol (ISO) clofibric acid (EXP) clothianidin (ISO) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) diethyl maleate (EXP) dioxygen (ISO) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) glutathione (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) GW 4064 (ISO) hydrogen peroxide (ISO) imiquimod (ISO) L-methionine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) metformin (EXP) methimazole (EXP) methotrexate (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) methylparaben (ISO) miconazole (ISO) N(4)-hydroxycytidine (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nefazodone (ISO) nickel atom (ISO) nickel dichloride (EXP,ISO) nimesulide (EXP) obeticholic acid (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) quercetin (ISO) quinolin-8-ol (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tartrazine (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetracycline (ISO) tetraphene (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tremolite asbestos (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) Triptolide (EXP) triptonide (ISO) triticonazole (EXP) Tungsten carbide (ISO) tunicamycin (ISO) valproic acid (ISO) valsartan (ISO) vinclozolin (EXP) zinc sulfate (ISO)
Ppp1r3c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 243,873,524 - 243,878,527 (-) NCBI GRCr8 mRatBN7.2 1 234,460,958 - 234,465,961 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 234,460,652 - 234,465,961 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 242,855,971 - 242,860,979 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 249,778,292 - 249,783,285 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 242,616,484 - 242,621,477 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 255,371,830 - 255,376,833 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,371,810 - 255,376,833 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 262,628,937 - 262,633,940 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 240,991,884 - 240,996,887 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 241,175,278 - 241,180,280 (-) NCBI Celera 1 231,556,257 - 231,561,260 (-) NCBI Celera Cytogenetic Map 1 q53 NCBI
PPP1R3C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 91,628,442 - 91,633,071 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 91,628,442 - 91,633,071 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 93,388,199 - 93,392,828 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 93,378,179 - 93,382,838 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 93,378,180 - 93,382,838 NCBI Celera 10 87,131,841 - 87,136,500 (-) NCBI Celera Cytogenetic Map 10 q23.32 NCBI HuRef 10 87,016,754 - 87,021,415 (-) NCBI HuRef CHM1_1 10 93,669,964 - 93,674,625 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 92,511,668 - 92,516,296 (-) NCBI T2T-CHM13v2.0
Ppp1r3c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 36,709,131 - 36,714,004 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 36,709,131 - 36,714,053 (-) Ensembl GRCm39 Ensembl GRCm38 19 36,731,731 - 36,736,604 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 36,731,731 - 36,736,653 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 36,806,221 - 36,811,094 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 36,796,877 - 36,801,797 (-) NCBI MGSCv36 mm8 Celera 19 37,506,440 - 37,511,313 (-) NCBI Celera Cytogenetic Map 19 C2 NCBI cM Map 19 31.89 NCBI
Ppp1r3c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 1,606,069 - 1,611,586 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 1,606,069 - 1,611,001 (+) NCBI ChiLan1.0 ChiLan1.0
PPP1R3C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 103,668,222 - 103,673,064 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 103,673,537 - 103,678,379 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 88,377,396 - 88,382,205 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 91,900,112 - 91,904,764 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 91,900,112 - 91,904,764 (-) Ensembl panpan1.1 panPan2
PPP1R3C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 6,167,532 - 6,172,057 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 6,168,917 - 6,172,004 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 6,341,554 - 6,346,099 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 6,423,121 - 6,427,666 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 6,423,123 - 6,427,604 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 6,146,246 - 6,150,797 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 6,178,972 - 6,183,517 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 6,342,849 - 6,347,399 (-) NCBI UU_Cfam_GSD_1.0
Ppp1r3c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 41,297,720 - 41,302,426 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936601 2,930,208 - 2,935,092 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936601 2,930,250 - 2,935,024 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP1R3C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 103,273,405 - 103,278,762 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 103,273,401 - 103,278,757 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 112,652,689 - 112,657,293 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP1R3C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 84,918,592 - 84,923,281 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 84,918,591 - 84,923,334 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 45,645,616 - 45,650,669 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp1r3c
.
Predicted Target Of
Count of predictions: 518 Count of miRNA genes: 249 Interacting mature miRNAs: 304 Transcripts: ENSRNOT00000024941, ENSRNOT00000073381 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
RH129209
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,460,983 - 234,461,163 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,371,856 - 255,372,035 NCBI Rnor6.0 Rnor_5.0 1 262,669,381 - 262,669,560 UniSTS Rnor5.0 Rnor_5.0 1 262,628,963 - 262,629,142 UniSTS Rnor5.0 RGSC_v3.4 1 240,991,910 - 240,992,089 UniSTS RGSC3.4 Celera 1 231,556,283 - 231,556,462 UniSTS RH 3.4 Map 1 1582.5 UniSTS Cytogenetic Map 1 q53 UniSTS
RH138361
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,462,295 - 234,462,468 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,373,168 - 255,373,340 NCBI Rnor6.0 Rnor_5.0 1 262,670,693 - 262,670,865 UniSTS Rnor5.0 Rnor_5.0 1 262,630,275 - 262,630,447 UniSTS Rnor5.0 RGSC_v3.4 1 240,993,222 - 240,993,394 UniSTS RGSC3.4 Celera 1 231,557,595 - 231,557,767 UniSTS RH 3.4 Map 1 1582.1 UniSTS Cytogenetic Map 1 q53 UniSTS
RH127645
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,461,029 - 234,461,216 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,371,902 - 255,372,088 NCBI Rnor6.0 Rnor_5.0 1 262,669,427 - 262,669,613 UniSTS Rnor5.0 Rnor_5.0 1 262,629,009 - 262,629,195 UniSTS Rnor5.0 RGSC_v3.4 1 240,991,956 - 240,992,142 UniSTS RGSC3.4 Celera 1 231,556,329 - 231,556,515 UniSTS RH 3.4 Map 1 1582.5 UniSTS Cytogenetic Map 1 q53 UniSTS
RH140525
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,461,029 - 234,461,170 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,371,902 - 255,372,042 NCBI Rnor6.0 Rnor_5.0 1 262,669,427 - 262,669,567 UniSTS Rnor5.0 Rnor_5.0 1 262,629,009 - 262,629,149 UniSTS Rnor5.0 RGSC_v3.4 1 240,991,956 - 240,992,096 UniSTS RGSC3.4 Celera 1 231,556,329 - 231,556,469 UniSTS RH 3.4 Map 1 1583.0 UniSTS Cytogenetic Map 1 q53 UniSTS
AA800273
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 243,873,763 - 243,873,968 (+) Marker Load Pipeline mRatBN7.2 1 234,461,197 - 234,461,402 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,372,070 - 255,372,274 NCBI Rnor6.0 Rnor_5.0 1 262,669,595 - 262,669,799 UniSTS Rnor5.0 Rnor_5.0 1 262,629,177 - 262,629,381 UniSTS Rnor5.0 RGSC_v3.4 1 240,992,124 - 240,992,328 UniSTS RGSC3.4 Celera 1 231,556,497 - 231,556,701 UniSTS RH 3.4 Map 1 1582.7 UniSTS Cytogenetic Map 1 q53 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024941 ⟹ ENSRNOP00000024941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 234,460,962 - 234,465,961 (-) Ensembl Rnor_6.0 Ensembl 1 255,371,810 - 255,376,833 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107925 ⟹ ENSRNOP00000082332
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 234,460,652 - 234,465,837 (-) Ensembl
RefSeq Acc Id:
NM_001012072 ⟹ NP_001012072
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 243,873,524 - 243,878,527 (-) NCBI mRatBN7.2 1 234,460,958 - 234,465,961 (-) NCBI Rnor_6.0 1 255,371,830 - 255,376,833 (-) NCBI Rnor_5.0 1 262,628,937 - 262,633,940 (-) NCBI RGSC_v3.4 1 240,991,884 - 240,996,887 (-) RGD Celera 1 231,556,257 - 231,561,260 (-) RGD
Sequence:
GGCTTGACCGCGGCGCTGCATCCGCTAAGTGCGTGGTGCGAAGCTGCGCTGGGTGCGGTTGTCGCGGTCGCCACTGCCTCTCGGTCCAATGAGCTGCACCAGGATGATCCACGTGCTGGATCCACGAC
hide sequence
RefSeq Acc Id:
NP_001012072 ⟸ NM_001012072
- UniProtKB:
Q5U2R5 (UniProtKB/Swiss-Prot), A6I157 (UniProtKB/TrEMBL), G3V8E0 (UniProtKB/TrEMBL)
- Sequence:
MSCTRMIHVLDPRPLTSSVMPVDMAMRICLAHSPPLKSFLGPYNGLQRRHFVNKPKPLKPCLSVKQEAKSQKEWKSPHSQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSSLKL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024941 ⟸ ENSRNOT00000024941
Ensembl Acc Id:
ENSRNOP00000082332 ⟸ ENSRNOT00000107925
RGD ID: 13690873 Promoter ID: EPDNEW_R1398 Type: single initiation site Name: Ppp1r3c_1 Description: protein phosphatase 1, regulatory subunit 3C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 255,376,841 - 255,376,901 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-13
Ppp1r3c
protein phosphatase 1, regulatory subunit 3C
LOC100910671
protein phosphatase 1 regulatory subunit 3C-like
Data merged from RGD:6497444
737654 PROVISIONAL
2012-07-05
LOC100910671
protein phosphatase 1 regulatory subunit 3C-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2011-10-18
Ppp1r3c
protein phosphatase 1, regulatory subunit 3C
Ppp1r3c
protein phosphatase 1, regulatory (inhibitor) subunit 3C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Ppp1r3c
protein phosphatase 1, regulatory (inhibitor) subunit 3C
Ppp1r3c_predicted
protein phosphatase 1, regulatory (inhibitor) subunit 3C (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Ppp1r3c_predicted
protein phosphatase 1, regulatory (inhibitor) subunit 3C (predicted)
Symbol and Name status set to approved
70820 APPROVED
