Symbol:
Gna14
Name:
G protein subunit alpha 14
RGD ID:
1308122
Description:
Predicted to enable G protein-coupled receptor binding activity; G-protein beta/gamma-subunit complex binding activity; and GTPase activity. Predicted to be involved in action potential; adenylate cyclase-modulating G protein-coupled receptor signaling pathway; and phospholipase C-activating dopamine receptor signaling pathway. Predicted to be part of heterotrimeric G-protein complex. Predicted to be active in cytoplasm. Orthologous to human GNA14 (G protein subunit alpha 14); PARTICIPATES IN acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family; eicosanoid signaling pathway; endothelin signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
guanine nucleotide binding protein, alpha 14; guanine nucleotide-binding protein subunit alpha-14; heterotrimeric guanine nucleotide-binding protein 1i; Hg1i; LOC309242; MGC105546; TGFB inducible early growth response 3; Tieg3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GNA14 (G protein subunit alpha 14) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Gna14 (guanine nucleotide binding protein, alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gna14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GNA14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GNA14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101971412 (guanine nucleotide-binding protein subunit alpha-14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GNA14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GNA14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gna14 (G protein subunit alpha 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LRRC75A (leucine rich repeat containing 75A) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GNA14 (G protein subunit alpha 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gna14 (guanine nucleotide binding protein, alpha 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gna14a (guanine nucleotide binding protein (G protein), alpha 14a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
GPA2
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
egl-30
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Galphaq
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gna14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 223,141,802 - 223,324,210 (+) NCBI GRCr8 mRatBN7.2 1 213,714,993 - 213,900,083 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 213,716,020 - 213,897,423 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 222,045,687 - 222,225,954 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 228,978,868 - 229,161,277 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 221,800,246 - 221,980,512 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 235,165,775 - 235,347,986 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 235,166,718 - 235,347,937 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 242,484,562 - 242,665,783 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 219,906,120 - 219,983,252 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 211,049,903 - 211,230,953 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gna14 Rat 1,1-dichloroethene decreases expression ISO Gna14 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of GNA14 mRNA CTD PMID:26682919 Gna14 Rat 1,2-dimethylhydrazine multiple interactions ISO Gna14 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GNA14 mRNA CTD PMID:22206623 Gna14 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of GNA14 mRNA CTD PMID:21983209 Gna14 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of GNA14 mRNA CTD PMID:25380136 Gna14 Rat 17alpha-ethynylestradiol increases expression ISO Gna14 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GNA14 mRNA CTD PMID:17942748 Gna14 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GNA14 mRNA CTD PMID:26496021 Gna14 Rat 17beta-estradiol decreases expression ISO Gna14 (Mus musculus) 6480464 Estradiol results in decreased expression of GNA14 mRNA CTD PMID:39298647 Gna14 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Gna14 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GNA14 mRNA CTD PMID:22298810 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GNA14 mRNA CTD PMID:33387578 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gna14 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin affects the methylation of GNA14 intron] which results in increased expression of GNA14 mRNA CTD PMID:33017471 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gna14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GNA14 mRNA CTD PMID:21570461 and PMID:26377647 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gna14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GNA14 mRNA CTD PMID:19933214 and PMID:25975270 Gna14 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GNA14 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GNA14 mRNA CTD PMID:23152189 Gna14 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Gna14 Rat 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone affects response to substance ISO GNA14 (Homo sapiens) 6480464 GNA14 gene SNP affects the susceptibility to 3-chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone CTD PMID:25622337 Gna14 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GNA14 mRNA CTD PMID:25380136 Gna14 Rat 4,4'-sulfonyldiphenol increases expression ISO Gna14 (Mus musculus) 6480464 bisphenol S results in increased expression of GNA14 mRNA CTD PMID:30951980 and PMID:39298647 Gna14 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GNA14 mRNA CTD PMID:24780913 and PMID:30047161 Gna14 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GNA14 mRNA CTD PMID:28959563 Gna14 Rat actinomycin D multiple interactions ISO GNA14 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of GNA14 mRNA CTD PMID:38460933 Gna14 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GNA14 mRNA CTD PMID:23630614 and PMID:25378103 Gna14 Rat aflatoxin B1 increases methylation ISO GNA14 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GNA14 intron CTD PMID:30157460 Gna14 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of GNA14 mRNA CTD PMID:35163327 Gna14 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of GNA14 mRNA CTD PMID:30047161 Gna14 Rat arsenite(3-) increases methylation ISO GNA14 (Homo sapiens) 6480464 arsenite results in increased methylation of GNA14 promoter CTD PMID:19716837 and PMID:23974009 Gna14 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of GNA14 gene CTD PMID:28931070 and PMID:35440735 Gna14 Rat Azoxymethane multiple interactions ISO Gna14 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNA14 mRNA CTD PMID:29950665 Gna14 Rat beauvericin multiple interactions ISO GNA14 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of GNA14 protein CTD PMID:32407736 Gna14 Rat benzo[a]pyrene decreases expression ISO Gna14 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GNA14 mRNA CTD PMID:21569818 Gna14 Rat benzo[a]pyrene affects methylation ISO GNA14 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GNA14 intron CTD PMID:30157460 Gna14 Rat benzo[a]pyrene increases methylation ISO Gna14 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of GNA14 intron CTD PMID:27901495 Gna14 Rat benzo[a]pyrene increases methylation ISO GNA14 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GNA14 promoter CTD PMID:27901495 Gna14 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of GNA14 mRNA CTD PMID:21839799 Gna14 Rat benzo[b]fluoranthene decreases expression ISO Gna14 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of GNA14 mRNA CTD PMID:26377693 Gna14 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gna14 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GNA14 mRNA CTD PMID:19850644 Gna14 Rat bis(2-ethylhexyl) phthalate increases expression ISO GNA14 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of GNA14 mRNA CTD PMID:31163220 Gna14 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gna14 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in decreased expression of GNA14 mRNA] CTD PMID:19850644 Gna14 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of GNA14 mRNA CTD PMID:26496021 Gna14 Rat bisphenol A increases expression ISO Gna14 (Mus musculus) 6480464 bisphenol A results in increased expression of GNA14 mRNA CTD PMID:30951980 Gna14 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GNA14 mRNA CTD PMID:25181051 Gna14 Rat bisphenol F increases expression ISO Gna14 (Mus musculus) 6480464 bisphenol F results in increased expression of GNA14 mRNA CTD PMID:30951980 Gna14 Rat carbamazepine affects expression ISO GNA14 (Homo sapiens) 6480464 Carbamazepine affects the expression of GNA14 mRNA CTD PMID:25979313 Gna14 Rat carbon nanotube decreases expression ISO Gna14 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Gna14 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of GNA14 mRNA CTD PMID:18500788 Gna14 Rat CGP 52608 multiple interactions ISO GNA14 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GNA14 gene] CTD PMID:28238834 Gna14 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GNA14 mRNA CTD PMID:17452286 Gna14 Rat choline multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GNA14 gene CTD PMID:20938992 and PMID:33549593 Gna14 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of GNA14 mRNA CTD PMID:22023808 Gna14 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of GNA14 mRNA CTD PMID:24386269 Gna14 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in decreased expression of GNA14 mRNA CTD PMID:26033743 Gna14 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in decreased expression of GNA14 mRNA CTD PMID:26033743 Gna14 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GNA14 mRNA CTD PMID:26577399 Gna14 Rat cyanocob(III)alamin multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA CTD PMID:33549593 Gna14 Rat dextran sulfate multiple interactions ISO Gna14 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNA14 mRNA CTD PMID:29950665 Gna14 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of GNA14 mRNA CTD PMID:17452286 Gna14 Rat dibenz[a,h]anthracene decreases expression ISO Gna14 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Gna14 Rat dibutyl phthalate increases expression ISO Gna14 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of GNA14 mRNA CTD PMID:21266533 Gna14 Rat dichloroacetic acid decreases expression ISO Gna14 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of GNA14 mRNA CTD PMID:28962523 Gna14 Rat dioxygen increases expression ISO GNA14 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of GNA14 mRNA CTD PMID:26516004 Gna14 Rat dorsomorphin multiple interactions ISO GNA14 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gna14 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GNA14 mRNA CTD PMID:29391264 Gna14 Rat enniatin multiple interactions ISO GNA14 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of GNA14 protein CTD PMID:32407736 Gna14 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of GNA14 mRNA CTD PMID:20655511 Gna14 Rat ethylparaben increases expression ISO GNA14 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of GNA14 mRNA CTD PMID:37690743 Gna14 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of GNA14 mRNA CTD PMID:30307764 Gna14 Rat folic acid multiple interactions ISO Gna14 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 more ... Gna14 Rat furan increases expression EXP 6480464 furan results in increased expression of GNA14 mRNA CTD PMID:25539665 more ... Gna14 Rat glycine betaine multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA CTD PMID:33549593 Gna14 Rat GW 4064 increases expression ISO Gna14 (Mus musculus) 6480464 GW 4064 results in increased expression of GNA14 mRNA CTD PMID:26655953 Gna14 Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of GNA14 promoter CTD PMID:23740543 Gna14 Rat L-methionine multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GNA14 gene CTD PMID:20938992 and PMID:33549593 Gna14 Rat mercury dibromide increases expression ISO GNA14 (Homo sapiens) 6480464 mercuric bromide results in increased expression of GNA14 mRNA CTD PMID:26272509 Gna14 Rat mercury dibromide multiple interactions ISO GNA14 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNA14 mRNA CTD PMID:27188386 Gna14 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of GNA14 mRNA CTD PMID:30047161 Gna14 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of GNA14 mRNA CTD PMID:25380136 Gna14 Rat nickel atom increases expression ISO GNA14 (Homo sapiens) 6480464 Nickel results in increased expression of GNA14 mRNA CTD PMID:25583101 Gna14 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of GNA14 mRNA CTD PMID:26720608 Gna14 Rat Nutlin-3 multiple interactions ISO GNA14 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of GNA14 mRNA CTD PMID:38460933 Gna14 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of GNA14 mRNA CTD PMID:23665939 Gna14 Rat paracetamol affects expression ISO Gna14 (Mus musculus) 6480464 Acetaminophen affects the expression of GNA14 mRNA CTD PMID:17562736 Gna14 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GNA14 mRNA CTD PMID:33387578 Gna14 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GNA14 mRNA CTD PMID:32680482 Gna14 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of GNA14 mRNA CTD PMID:35163327 Gna14 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of GNA14 mRNA CTD PMID:35163327 Gna14 Rat permethrin increases expression EXP 6480464 Permethrin results in increased expression of GNA14 mRNA CTD PMID:19017407 Gna14 Rat phenobarbital multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of GNA14 mRNA] CTD PMID:19482888 and PMID:33549593 Gna14 Rat phenobarbital affects expression ISO Gna14 (Mus musculus) 6480464 Phenobarbital affects the expression of GNA14 mRNA CTD PMID:23091169 Gna14 Rat phenobarbital increases expression ISO Gna14 (Mus musculus) 6480464 Phenobarbital results in increased expression of GNA14 mRNA CTD PMID:19270015 more ... Gna14 Rat phenylmercury acetate increases expression ISO GNA14 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GNA14 mRNA CTD PMID:26272509 Gna14 Rat phenylmercury acetate multiple interactions ISO GNA14 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GNA14 mRNA CTD PMID:27188386 Gna14 Rat pirinixic acid decreases expression ISO Gna14 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GNA14 mRNA CTD PMID:17950772 and PMID:20059764 Gna14 Rat pirinixic acid multiple interactions ISO Gna14 (Mus musculus) 6480464 NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of GNA14 mRNA] and PPARA protein promotes the reaction [pirinixic acid results in decreased expression of GNA14 mRNA] CTD PMID:17950772 and PMID:20059764 Gna14 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of GNA14 mRNA CTD PMID:30047161 Gna14 Rat rotenone increases expression ISO GNA14 (Homo sapiens) 6480464 Rotenone results in increased expression of GNA14 mRNA CTD PMID:29955902 Gna14 Rat SB 431542 multiple interactions ISO GNA14 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gna14 Rat silicon dioxide decreases expression ISO GNA14 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GNA14 mRNA CTD PMID:25895662 Gna14 Rat sodium arsenite affects methylation ISO GNA14 (Homo sapiens) 6480464 sodium arsenite affects the methylation of GNA14 gene CTD PMID:28589171 Gna14 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of GNA14 mRNA CTD PMID:25993096 Gna14 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of GNA14 mRNA CTD PMID:19281266 Gna14 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of GNA14 mRNA CTD PMID:30047161 Gna14 Rat tetrachloromethane affects expression ISO Gna14 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GNA14 mRNA CTD PMID:17484886 Gna14 Rat titanium dioxide increases expression ISO Gna14 (Mus musculus) 6480464 titanium dioxide results in increased expression of GNA14 mRNA CTD PMID:23557971 Gna14 Rat titanium dioxide decreases methylation ISO Gna14 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GNA14 gene CTD PMID:35295148 Gna14 Rat titanium dioxide multiple interactions ISO Gna14 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GNA14 mRNA CTD PMID:29950665 Gna14 Rat triadimefon decreases expression ISO GNA14 (Homo sapiens) 6480464 triadimefon results in decreased expression of GNA14 mRNA CTD PMID:26705709 Gna14 Rat trichloroethene decreases expression ISO Gna14 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of GNA14 mRNA CTD PMID:25549359 Gna14 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of GNA14 mRNA CTD PMID:30589522 Gna14 Rat valproic acid affects expression ISO GNA14 (Homo sapiens) 6480464 Valproic Acid affects the expression of GNA14 mRNA CTD PMID:25979313 Gna14 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of GNA14 mRNA CTD PMID:29427782 Gna14 Rat zinc atom multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA CTD PMID:33549593 Gna14 Rat zinc(0) multiple interactions ISO Gna14 (Mus musculus) 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc co-treated with Phenobarbital] results in increased expression of GNA14 mRNA CTD PMID:33549593
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) alpha-Zearalanol (EXP) amitrole (EXP) arsenite(3-) (ISO) atrazine (EXP) Azoxymethane (ISO) beauvericin (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (EXP) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyanocob(III)alamin (ISO) dextran sulfate (ISO) diazinon (EXP) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) enniatin (ISO) ethanol (EXP) ethylparaben (ISO) fenvalerate (EXP) folic acid (ISO) furan (EXP) glycine betaine (ISO) GW 4064 (ISO) hexane (EXP) L-methionine (ISO) mercury dibromide (ISO) methimazole (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) nitrofen (EXP) Nutlin-3 (ISO) orphenadrine (EXP) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctanoic acid (EXP) permethrin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) Soman (EXP) sulfadimethoxine (EXP) tetrachloromethane (ISO) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (ISO) triphenyl phosphate (EXP) valproic acid (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
Gna14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 223,141,802 - 223,324,210 (+) NCBI GRCr8 mRatBN7.2 1 213,714,993 - 213,900,083 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 213,716,020 - 213,897,423 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 222,045,687 - 222,225,954 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 228,978,868 - 229,161,277 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 221,800,246 - 221,980,512 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 235,165,775 - 235,347,986 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 235,166,718 - 235,347,937 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 242,484,562 - 242,665,783 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 219,906,120 - 219,983,252 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 211,049,903 - 211,230,953 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
GNA14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 77,423,079 - 77,648,322 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 77,423,079 - 77,648,322 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 80,037,995 - 80,263,238 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 79,228,368 - 79,453,043 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 77,268,102 - 77,492,777 NCBI Celera 9 50,615,129 - 50,840,361 (-) NCBI Celera Cytogenetic Map 9 q21.2 NCBI HuRef 9 49,869,436 - 50,095,508 (-) NCBI HuRef CHM1_1 9 80,184,787 - 80,410,463 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 89,579,647 - 89,805,301 (-) NCBI T2T-CHM13v2.0
Gna14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 16,413,031 - 16,590,706 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 16,413,126 - 16,588,184 (+) Ensembl GRCm39 Ensembl GRCm38 19 16,435,667 - 16,610,818 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 16,435,762 - 16,610,820 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 16,510,157 - 16,685,308 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 16,502,781 - 16,677,839 (+) NCBI MGSCv36 mm8 Celera 19 17,094,438 - 17,269,681 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 11.29 NCBI
Gna14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955512 1,707,503 - 1,917,513 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955512 1,703,750 - 1,918,321 (+) NCBI ChiLan1.0 ChiLan1.0
GNA14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 76,583,213 - 76,812,578 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 76,589,152 - 76,818,520 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 47,196,338 - 47,423,388 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 76,276,687 - 76,504,137 (-) NCBI panpan1.1 PanPan1.1 panPan2
GNA14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 80,992,992 - 81,178,362 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 80,992,863 - 81,177,674 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 81,455,728 - 81,642,025 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 81,404,645 - 81,590,940 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 81,405,467 - 81,590,428 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 81,190,051 - 81,376,315 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 80,911,720 - 81,098,022 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 81,641,964 - 81,827,205 (+) NCBI UU_Cfam_GSD_1.0
LOC101971412 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 128,116,262 - 128,313,527 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936503 12,859,715 - 13,056,244 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936503 12,860,296 - 13,056,880 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GNA14 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 230,341,942 - 230,546,120 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 230,341,947 - 230,545,123 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 257,105,693 - 257,310,461 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GNA14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 88,386,597 - 88,606,787 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 88,385,377 - 88,605,845 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 76,717,968 - 76,939,040 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gna14
.
Predicted Target Of
Count of predictions: 500 Count of miRNA genes: 238 Interacting mature miRNAs: 288 Transcripts: ENSRNOT00000020201 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH142098
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 223,323,972 - 223,324,187 (+) Marker Load Pipeline mRatBN7.2 1 213,897,187 - 213,897,402 (+) MAPPER mRatBN7.2 Rnor_6.0 1 235,347,702 - 235,347,916 NCBI Rnor6.0 Rnor_5.0 1 242,665,546 - 242,665,760 UniSTS Rnor5.0 RGSC_v3.4 1 219,983,015 - 219,983,229 UniSTS RGSC3.4 Celera 1 211,230,716 - 211,230,930 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
38
105
91
90
59
25
59
6
207
86
85
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020201 ⟹ ENSRNOP00000020201
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 213,716,020 - 213,897,423 (+) Ensembl Rnor_6.0 Ensembl 1 235,166,718 - 235,347,937 (+) Ensembl
RefSeq Acc Id:
NM_001013151 ⟹ NP_001013169
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 223,141,802 - 223,324,210 (+) NCBI mRatBN7.2 1 213,714,993 - 213,897,425 (+) NCBI Rnor_6.0 1 235,166,718 - 235,347,939 (+) NCBI Rnor_5.0 1 242,484,562 - 242,665,783 (+) NCBI RGSC_v3.4 1 219,906,120 - 219,983,252 (+) RGD Celera 1 211,049,903 - 211,230,953 (+) RGD
Sequence:
CGAAGGTCTAAGGATTGAGATTTTCAGAACACTGCAGACAGGGACTAGCTGGTCCTTTATCTGCAAGCCACGCCACACCTGCTGCTAGCCTACGACACCCTACAGTCGCGGAGAGACCACTCTTGCAG
hide sequence
RefSeq Acc Id:
XM_008760288 ⟹ XP_008758510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 223,141,811 - 223,324,210 (+) NCBI mRatBN7.2 1 213,714,993 - 213,900,083 (+) NCBI Rnor_6.0 1 235,165,775 - 235,347,986 (+) NCBI
Sequence:
TTATCTGCACCTTAAAATCTGCACAGACAAAATCAGCGAGGGTAATTTGCCTTTCCATTTGAGTTGTCAAGGGTGCTTTTAGATTTCCCACATCTACTCGCAAGAGTTCCAGGAGCTGTCCGGAAGCA
hide sequence
RefSeq Acc Id:
NP_001013169 ⟸ NM_001013151
- UniProtKB:
Q5EAP4 (UniProtKB/TrEMBL), F1LRE6 (UniProtKB/TrEMBL), A0A8J8XRQ3 (UniProtKB/TrEMBL)
- Sequence:
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSAISRDQVAAI
hide sequence
RefSeq Acc Id:
XP_008758510 ⟸ XM_008760288
- Peptide Label:
isoform X1
- UniProtKB:
Q5EAP4 (UniProtKB/TrEMBL), F1LRE6 (UniProtKB/TrEMBL), A0A8J8XRQ3 (UniProtKB/TrEMBL)
- Sequence:
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSAISRDQVAAI
hide sequence
Ensembl Acc Id:
ENSRNOP00000020201 ⟸ ENSRNOT00000020201
RGD ID: 13690808 Promoter ID: EPDNEW_R1333 Type: single initiation site Name: Gna14_1 Description: G protein subunit alpha 14 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 235,166,712 - 235,166,772 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-11
Gna14
G protein subunit alpha 14
Gna14
guanine nucleotide binding protein, alpha 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Gna14
guanine nucleotide binding protein, alpha 14
Tieg3
TGFB inducible early growth response 3
Symbol and Name updated
1299863 APPROVED
2005-12-06
Tieg3
TGFB inducible early growth response 3
Tieg3_predicted
TGFB inducible early growth response 3 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Tieg3_predicted
TGFB inducible early growth response 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
