Symbol:
Map3k5
Name:
mitogen-activated protein kinase kinase kinase 5
RGD ID:
1306565
Description:
Enables MAP kinase kinase kinase activity. Involved in several processes, including endothelial cell apoptotic process; positive regulation of MAPK cascade; and positive regulation of cardiac muscle cell apoptotic process. Located in external side of plasma membrane. Used to study cerebral infarction and myocardial infarction. Biomarker of membranous glomerulonephritis and transient cerebral ischemia. Human ortholog(s) of this gene implicated in Huntington's disease. Orthologous to human MAP3K5 (mitogen-activated protein kinase kinase kinase 5); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; p38 MAPK signaling pathway; phosphatidylinositol 3-kinase-Akt signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; 4-vinylcyclohexene dioxide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
apoptosis signal regulating kinase 1; Ask1; LOC365057; RGD1306565; similar to apoptosis signal-regulating kinase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 16,505,387 - 16,723,899 (+) NCBI GRCr8 mRatBN7.2 1 14,685,776 - 14,904,935 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 14,685,492 - 14,904,800 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 14,451,174 - 14,657,631 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 20,453,039 - 20,659,558 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 14,666,217 - 14,883,508 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 15,412,603 - 15,613,752 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 15,412,603 - 15,613,746 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 16,961,080 - 17,160,996 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 15,205,361 - 15,346,422 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 15,204,326 - 15,346,541 (+) NCBI Celera 1 13,127,308 - 13,336,631 (+) NCBI Celera Cytogenetic Map 1 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map3k5 Rat (1->4)-beta-D-glucan multiple interactions ISO Map3k5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MAP3K5 mRNA CTD PMID:36331819 Map3k5 Rat (S)-naringenin increases expression ISO MAP3K5 (Homo sapiens) 6480464 naringenin results in increased expression of MAP3K5 protein CTD PMID:27838343 Map3k5 Rat 1,2-dimethylhydrazine increases expression ISO Map3k5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MAP3K5 mRNA CTD PMID:22206623 Map3k5 Rat 1,4-dithiothreitol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [NCX 4040 inhibits the reaction [TXN1 protein binds to MAP3K5 protein]] CTD PMID:18922898 Map3k5 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases phosphorylation ISO Map3k5 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:28939911 Map3k5 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Map3k5 (Mus musculus) 6480464 CIB1 gene mutant form promotes the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:28939911 Map3k5 Rat 17beta-estradiol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of MAP3K5 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of MAP3K5 mRNA CTD PMID:19619570 and PMID:30165855 Map3k5 Rat 17beta-estradiol decreases expression ISO Map3k5 (Mus musculus) 6480464 Estradiol results in decreased expression of MAP3K5 mRNA CTD PMID:39298647 Map3k5 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of MAP3K5 mRNA CTD PMID:32145629 Map3k5 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MAP3K5 mRNA CTD PMID:26496021 Map3k5 Rat 17beta-estradiol increases expression ISO MAP3K5 (Homo sapiens) 6480464 Estradiol results in increased expression of MAP3K5 mRNA CTD PMID:19619570 Map3k5 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Map3k5 (Mus musculus) 6480464 2 more ... CTD PMID:25639565 Map3k5 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Map3k5 (Mus musculus) 6480464 troxerutin inhibits the reaction [2 more ... CTD PMID:25639565 Map3k5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of MAP3K5 mRNA CTD PMID:19619570 Map3k5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Map3k5 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of MAP3K5 mRNA CTD PMID:25975270 Map3k5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MAP3K5 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP3K5 mRNA CTD PMID:22574217 Map3k5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP3K5 mRNA CTD PMID:19619570 Map3k5 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Map3k5 Rat 2-hydroxypropanoic acid decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAP3K5 mRNA CTD PMID:30851411 Map3k5 Rat 3-methyladenine affects response to substance ISO MAP3K5 (Homo sapiens) 6480464 3-methyladenine affects the susceptibility to MAP3K5 protein CTD PMID:20929985 Map3k5 Rat 3-methyladenine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [MAP3K5 protein results in decreased phosphorylation of MTOR protein] more ... CTD PMID:20929985 Map3k5 Rat 4,4'-sulfonyldiphenol increases expression ISO Map3k5 (Mus musculus) 6480464 bisphenol S results in increased expression of MAP3K5 mRNA CTD PMID:30951980 Map3k5 Rat 4,4'-sulfonyldiphenol affects expression ISO Map3k5 (Mus musculus) 6480464 bisphenol S affects the expression of MAP3K5 mRNA CTD PMID:39298647 Map3k5 Rat 4-hydroxyphenyl retinamide increases expression ISO Map3k5 (Mus musculus) 6480464 Fenretinide results in increased expression of MAP3K5 mRNA CTD PMID:28973697 Map3k5 Rat 4-nitrophenol decreases expression ISO Map3k5 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of MAP3K5 mRNA CTD PMID:34673133 Map3k5 Rat 4-phenylbutyric acid decreases expression ISO MAP3K5 (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of MAP3K5 protein CTD PMID:29444456 Map3k5 Rat 4-phenylbutyric acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Cadmium Chloride results in increased expression of MAP3K5 protein] CTD PMID:29444456 Map3k5 Rat 4-vinylcyclohexene dioxide increases expression EXP 6480464 4-vinyl-1-cyclohexene dioxide results in increased expression of MAP3K5 mRNA CTD PMID:23274565 Map3k5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MAP3K5 mRNA CTD PMID:24780913 more ... Map3k5 Rat aflatoxin B1 affects expression ISO MAP3K5 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MAP3K5 protein CTD PMID:20106945 Map3k5 Rat aflatoxin B1 decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of MAP3K5 mRNA CTD PMID:27153756 Map3k5 Rat aldehydo-D-glucose multiple interactions ISO Map3k5 (Mus musculus) 6480464 [[[[Glucose results in decreased expression of MIR17 mRNA] which results in increased expression of TXNIP mRNA] which results in increased expression of TXNIP protein] promotes the reaction [TXNIP protein binds to TXN1 protein]] which results in increased activity of MAP3K5 protein more ... CTD PMID:26660634 Map3k5 Rat aldehydo-D-glucose increases expression ISO MAP3K5 (Homo sapiens) 6480464 Glucose results in increased expression of MAP3K5 protein CTD PMID:16731828 Map3k5 Rat aldehydo-D-glucose multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Glucose deficiency promotes the reaction [DAXX protein binds to MAP3K5 protein] and Glucose results in increased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:14505347 and PMID:16731828 Map3k5 Rat all-trans-retinoic acid decreases expression ISO Map3k5 (Mus musculus) 6480464 Tretinoin results in decreased expression of MAP3K5 mRNA CTD PMID:22498432 Map3k5 Rat all-trans-retinoic acid increases expression ISO MAP3K5 (Homo sapiens) 6480464 Tretinoin results in increased expression of MAP3K5 mRNA CTD PMID:21934132 and PMID:23724009 Map3k5 Rat andrographolide multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 andrographolide inhibits the reaction [VEGFA protein results in increased phosphorylation of MAP3K5 protein] CTD PMID:24814888 Map3k5 Rat antirheumatic drug decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MAP3K5 mRNA CTD PMID:24449571 Map3k5 Rat aristolochic acid A decreases expression ISO MAP3K5 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MAP3K5 mRNA CTD PMID:33212167 Map3k5 Rat belinostat decreases expression ISO MAP3K5 (Homo sapiens) 6480464 belinostat results in decreased expression of MAP3K5 mRNA CTD PMID:27188386 Map3k5 Rat benzene increases expression ISO MAP3K5 (Homo sapiens) 6480464 Benzene results in increased expression of MAP3K5 mRNA CTD PMID:33064461 Map3k5 Rat benzo[a]pyrene decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MAP3K5 mRNA CTD PMID:20064835 Map3k5 Rat benzo[a]pyrene increases methylation ISO Map3k5 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of MAP3K5 intron CTD PMID:27901495 Map3k5 Rat benzo[a]pyrene decreases expression ISO Map3k5 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MAP3K5 mRNA CTD PMID:19770486 Map3k5 Rat benzo[a]pyrene diol epoxide I decreases expression ISO MAP3K5 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Map3k5 Rat berberine multiple interactions ISO Map3k5 (Mus musculus) 6480464 Berberine inhibits the reaction [[lipopolysaccharide and Escherichia coli O111 B4 co-treated with TNF protein] results in decreased expression of and results in increased phosphorylation of MAP3K5 protein] CTD PMID:30240693 Map3k5 Rat bicuculline multiple interactions ISO Map3k5 (Mus musculus) 6480464 [Bicuculline co-treated with Ethanol] results in increased expression of MAP3K5 protein CTD PMID:29044621 Map3k5 Rat bis(2-ethylhexyl) phthalate increases expression ISO Map3k5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MAP3K5 mRNA CTD PMID:34319233 Map3k5 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MAP3K5 mRNA CTD PMID:26496021 Map3k5 Rat bisphenol A multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 1 more ... CTD PMID:33039870 Map3k5 Rat bisphenol A increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 bisphenol A results in increased phosphorylation of MAP3K5 protein CTD PMID:33039870 Map3k5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAP3K5 mRNA CTD PMID:25181051 more ... Map3k5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAP3K5 mRNA CTD PMID:25461909 Map3k5 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of MAP3K5 mRNA CTD PMID:32479839 Map3k5 Rat cadmium dichloride multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Cadmium Chloride results in increased expression of MAP3K5 protein] more ... CTD PMID:18703135 and PMID:29444456 Map3k5 Rat cadmium dichloride decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MAP3K5 mRNA CTD PMID:38568856 Map3k5 Rat cadmium dichloride increases expression ISO MAP3K5 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAP3K5 mRNA and Cadmium Chloride results in increased expression of MAP3K5 protein CTD PMID:29444456 and PMID:38382870 Map3k5 Rat cadmium dichloride increases phosphorylation EXP 6480464 Cadmium Chloride results in increased phosphorylation of MAP3K5 protein CTD PMID:18021293 and PMID:18703135 Map3k5 Rat cadmium dichloride increases activity ISO MAP3K5 (Homo sapiens) 6480464 Cadmium Chloride results in increased activity of MAP3K5 protein CTD PMID:16337887 Map3k5 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP3K5 protein] CTD PMID:18703135 Map3k5 Rat cadmium dichloride increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 Cadmium Chloride results in increased phosphorylation of MAP3K5 protein CTD PMID:18703135 Map3k5 Rat cadmium sulfide decreases expression ISO MAP3K5 (Homo sapiens) 6480464 cadmium sulfide results in decreased expression of MAP3K5 mRNA CTD PMID:27866839 Map3k5 Rat calcitriol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Calcitriol promotes the reaction [TXNIP protein binds to TNPO1 protein]] which results in increased activity of MAP3K5 protein CTD PMID:10843682 Map3k5 Rat calcitriol increases activity ISO MAP3K5 (Homo sapiens) 6480464 Calcitriol results in increased activity of MAP3K5 protein CTD PMID:10843682 Map3k5 Rat camptothecin decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Camptothecin results in decreased expression of MAP3K5 mRNA CTD PMID:17374387 Map3k5 Rat cannabidiol decreases expression ISO Map3k5 (Mus musculus) 6480464 Cannabidiol results in decreased expression of MAP3K5 mRNA CTD PMID:33019509 Map3k5 Rat cannabidiol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of MAP3K5 mRNA CTD PMID:30096889 Map3k5 Rat cannabigerol decreases expression ISO Map3k5 (Mus musculus) 6480464 cannabigerol results in decreased expression of MAP3K5 mRNA CTD PMID:33019509 Map3k5 Rat carbon nanotube decreases expression ISO Map3k5 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Map3k5 Rat Carnosol multiple interactions ISO Map3k5 (Mus musculus) 6480464 carnosol inhibits the reaction [Dietary Fats results in increased expression of MAP3K5 protein] more ... CTD PMID:34678374 Map3k5 Rat chenodeoxycholic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat chloroethene decreases expression ISO Map3k5 (Mus musculus) 6480464 Vinyl Chloride results in decreased expression of MAP3K5 mRNA CTD PMID:18579281 Map3k5 Rat chromium(6+) multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 chromium hexavalent ion inhibits the reaction [TXN protein binds to MAP3K5 protein] CTD PMID:19703554 Map3k5 Rat ciguatoxin CTX1B affects expression ISO Map3k5 (Mus musculus) 6480464 Ciguatoxins affects the expression of MAP3K5 mRNA CTD PMID:18353800 Map3k5 Rat cisplatin decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Cisplatin results in decreased expression of MAP3K5 mRNA CTD PMID:19561079 and PMID:27392435 Map3k5 Rat cisplatin multiple interactions ISO Map3k5 (Mus musculus) 6480464 Curcumin inhibits the reaction [Cisplatin results in increased phosphorylation of MAP3K5 protein] CTD PMID:36178099 Map3k5 Rat cisplatin increases phosphorylation ISO Map3k5 (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of MAP3K5 protein CTD PMID:36178099 Map3k5 Rat cisplatin multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of MAP3K5 mRNA CTD PMID:27392435 Map3k5 Rat copper atom multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP3K5 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of MAP3K5 mRNA CTD PMID:20971185 and PMID:30911355 Map3k5 Rat copper(0) multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of MAP3K5 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of MAP3K5 mRNA CTD PMID:20971185 and PMID:30911355 Map3k5 Rat copper(II) chloride decreases expression ISO MAP3K5 (Homo sapiens) 6480464 cupric chloride results in decreased expression of MAP3K5 mRNA CTD PMID:38568856 Map3k5 Rat copper(II) sulfate decreases expression ISO Map3k5 (Mus musculus) 6480464 Copper Sulfate results in decreased expression of MAP3K5 mRNA CTD PMID:18579281 Map3k5 Rat crocidolite asbestos affects expression ISO MAP3K5 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of MAP3K5 mRNA CTD PMID:17331233 Map3k5 Rat curcumin increases phosphorylation ISO MAP3K5 (Homo sapiens) 150429751 Curcumin increases phosphorylation of MAP3K5 protein in uterine cervix RGD Map3k5 Rat curcumin multiple interactions ISO Map3k5 (Mus musculus) 6480464 Curcumin inhibits the reaction [Cisplatin results in increased phosphorylation of MAP3K5 protein] CTD PMID:36178099 Map3k5 Rat D-glucose increases expression ISO MAP3K5 (Homo sapiens) 6480464 Glucose results in increased expression of MAP3K5 protein CTD PMID:16731828 Map3k5 Rat D-glucose multiple interactions ISO Map3k5 (Mus musculus) 6480464 [[[[Glucose results in decreased expression of MIR17 mRNA] which results in increased expression of TXNIP mRNA] which results in increased expression of TXNIP protein] promotes the reaction [TXNIP protein binds to TXN1 protein]] which results in increased activity of MAP3K5 protein more ... CTD PMID:26660634 Map3k5 Rat D-glucose multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Glucose deficiency promotes the reaction [DAXX protein binds to MAP3K5 protein] and Glucose results in increased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:14505347 and PMID:16731828 Map3k5 Rat daunorubicin decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Daunorubicin results in decreased expression of MAP3K5 mRNA CTD PMID:17374387 Map3k5 Rat deoxycholic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat deoxynivalenol increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 deoxynivalenol results in increased phosphorylation of MAP3K5 protein CTD PMID:20181660 Map3k5 Rat deoxynivalenol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 AG 1879 inhibits the reaction [deoxynivalenol results in increased phosphorylation of MAP3K5 protein] CTD PMID:20181660 Map3k5 Rat desferrioxamine B multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [Plant Extracts results in increased phosphorylation of MAP3K5 protein] CTD PMID:20206247 Map3k5 Rat Dibutyl phosphate affects expression ISO MAP3K5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAP3K5 mRNA CTD PMID:37042841 Map3k5 Rat dieldrin affects methylation ISO Map3k5 (Mus musculus) 6480464 Dieldrin affects the methylation of MAP3K5 gene CTD PMID:38995845 Map3k5 Rat dimethyl sulfoxide multiple interactions EXP 6480464 Dimethyl Sulfoxide inhibits the reaction [Thioacetamide results in increased activity of MAP3K5 protein] CTD PMID:12370186 Map3k5 Rat dimethyl sulfoxide decreases activity EXP 6480464 Dimethyl Sulfoxide results in decreased activity of MAP3K5 protein CTD PMID:12370186 Map3k5 Rat dimethylarsinic acid increases expression ISO Map3k5 (Mus musculus) 6480464 Cacodylic Acid results in increased expression of MAP3K5 mRNA CTD PMID:17441966 Map3k5 Rat disodium selenite multiple interactions ISO Map3k5 (Mus musculus) 6480464 Sodium Selenite promotes the reaction [[Streptozocin co-treated with Dietary Fats] results in increased phosphorylation of MAP3K5 protein] CTD PMID:26522834 Map3k5 Rat dorsomorphin multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Map3k5 Rat doxorubicin multiple interactions ISO Map3k5 (Mus musculus) 6480464 PSMB10 protein inhibits the reaction [Doxorubicin results in increased expression of MAP3K5 protein] more ... CTD PMID:25896364 Map3k5 Rat doxorubicin decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAP3K5 mRNA CTD PMID:29803840 Map3k5 Rat doxorubicin increases expression ISO Map3k5 (Mus musculus) 6480464 Doxorubicin results in increased expression of MAP3K5 protein CTD PMID:25896364 Map3k5 Rat edaravone decreases activity ISO Map3k5 (Mus musculus) 6480464 Edaravone results in decreased activity of MAP3K5 protein CTD PMID:15824197 Map3k5 Rat efavirenz increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 efavirenz metabolite results in increased phosphorylation of MAP3K5 protein and efavirenz results in increased phosphorylation of MAP3K5 protein CTD PMID:21958719 Map3k5 Rat elemental selenium decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Selenium results in decreased expression of MAP3K5 mRNA CTD PMID:19244175 Map3k5 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MAP3K5 mRNA CTD PMID:29391264 and PMID:31464424 Map3k5 Rat entinostat increases expression ISO MAP3K5 (Homo sapiens) 6480464 entinostat results in increased expression of MAP3K5 mRNA CTD PMID:26272509 Map3k5 Rat entinostat multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP3K5 mRNA CTD PMID:27188386 Map3k5 Rat ethanol multiple interactions ISO Map3k5 (Mus musculus) 6480464 [Bicuculline co-treated with Ethanol] results in increased expression of MAP3K5 protein more ... CTD PMID:29044621 Map3k5 Rat ethanol increases expression ISO Map3k5 (Mus musculus) 6480464 Ethanol results in increased expression of MAP3K5 protein CTD PMID:29044621 Map3k5 Rat ethyl methanesulfonate decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of MAP3K5 mRNA CTD PMID:23649840 Map3k5 Rat etoposide decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Etoposide results in decreased expression of MAP3K5 mRNA CTD PMID:17374387 Map3k5 Rat fingolimod hydrochloride multiple interactions ISO Map3k5 (Mus musculus) 6480464 [lipopolysaccharide and Escherichia coli O111 B4 co-treated with Okadaic Acid co-treated with Fingolimod Hydrochloride] results in increased expression of MAP3K5 mRNA CTD PMID:33069748 Map3k5 Rat flutamide increases expression ISO Map3k5 (Mus musculus) 6480464 Flutamide results in increased expression of MAP3K5 mRNA CTD PMID:32662666 Map3k5 Rat folic acid decreases expression ISO Map3k5 (Mus musculus) 6480464 Folic Acid results in decreased expression of MAP3K5 mRNA CTD PMID:25629700 Map3k5 Rat formaldehyde decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MAP3K5 mRNA CTD PMID:23416264 Map3k5 Rat furan increases expression EXP 6480464 furan results in increased expression of MAP3K5 mRNA CTD PMID:26194646 Map3k5 Rat furan multiple interactions ISO Map3k5 (Mus musculus) 6480464 rhodioloside inhibits the reaction [furan results in increased phosphorylation of MAP3K5 protein] CTD PMID:34450210 Map3k5 Rat furan increases phosphorylation ISO Map3k5 (Mus musculus) 6480464 furan results in increased phosphorylation of MAP3K5 protein CTD PMID:34450210 Map3k5 Rat gamma-aminobutyric acid multiple interactions ISO Map3k5 (Mus musculus) 6480464 gamma-Aminobutyric Acid inhibits the reaction [Ethanol results in increased expression of MAP3K5 protein] CTD PMID:29044621 Map3k5 Rat geldanamycin increases expression ISO MAP3K5 (Homo sapiens) 6480464 geldanamycin results in increased expression of MAP3K5 mRNA CTD PMID:26705709 Map3k5 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MAP3K5 mRNA CTD PMID:33387578 Map3k5 Rat glucose increases expression ISO MAP3K5 (Homo sapiens) 6480464 Glucose results in increased expression of MAP3K5 protein CTD PMID:16731828 Map3k5 Rat glucose multiple interactions ISO Map3k5 (Mus musculus) 6480464 [[[[Glucose results in decreased expression of MIR17 mRNA] which results in increased expression of TXNIP mRNA] which results in increased expression of TXNIP protein] promotes the reaction [TXNIP protein binds to TXN1 protein]] which results in increased activity of MAP3K5 protein more ... CTD PMID:26660634 Map3k5 Rat glucose multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Glucose deficiency promotes the reaction [DAXX protein binds to MAP3K5 protein] and Glucose results in increased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:14505347 and PMID:16731828 Map3k5 Rat glycochenodeoxycholic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat glycocholic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat glycodeoxycholic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat glycyrrhetinate multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Cadmium Chloride results in increased expression of MAP3K5 protein] CTD PMID:29444456 Map3k5 Rat glycyrrhetinic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [Cadmium Chloride results in increased expression of MAP3K5 protein] CTD PMID:29444456 Map3k5 Rat hexadecanoic acid increases expression ISO Map3k5 (Mus musculus) 6480464 Palmitic Acid results in increased expression of MAP3K5 protein CTD PMID:34678374 Map3k5 Rat hexadecanoic acid multiple interactions ISO Map3k5 (Mus musculus) 6480464 carnosol inhibits the reaction [Palmitic Acid results in increased expression of MAP3K5 protein] more ... CTD PMID:34678374 Map3k5 Rat hydrogen peroxide increases activity EXP 6480464 Hydrogen Peroxide results in increased activity of MAP3K5 protein CTD PMID:15629441 Map3k5 Rat hydrogen peroxide multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 ASK1 protein inhibits the reaction [Hydrogen Peroxide promotes the reaction [MAP3K5 protein binds to MAP2K7 protein]] and Hydrogen Peroxide promotes the reaction [MAP3K5 protein binds to MAP2K7 protein] CTD PMID:28939911 Map3k5 Rat hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of MAP3K5 protein CTD PMID:16157298 Map3k5 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of MAP3K5 mRNA CTD PMID:21396975 Map3k5 Rat indole-3-methanol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [indole-3-carbinol results in decreased expression of and results in increased phosphorylation of MAP3K5 protein] and indole-3-carbinol results in decreased expression of and results in increased phosphorylation of MAP3K5 protein CTD PMID:33118390 Map3k5 Rat inulin multiple interactions ISO Map3k5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MAP3K5 mRNA CTD PMID:36331819 Map3k5 Rat irinotecan decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Irinotecan metabolite results in decreased expression of MAP3K5 mRNA and Irinotecan results in decreased expression of MAP3K5 mRNA CTD PMID:15956246 Map3k5 Rat isoprenaline decreases expression ISO Map3k5 (Mus musculus) 6480464 Isoproterenol results in decreased expression of MAP3K5 mRNA CTD PMID:21335049 Map3k5 Rat kainic acid decreases expression ISO Map3k5 (Mus musculus) 6480464 Kainic Acid results in decreased expression of MAP3K5 mRNA CTD PMID:17997037 Map3k5 Rat KN-93 multiple interactions EXP 6480464 KN 93 inhibits the reaction [Phenylephrine results in increased activity of MAP3K5 protein] CTD PMID:15629441 Map3k5 Rat L-1,4-dithiothreitol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [NCX 4040 inhibits the reaction [TXN1 protein binds to MAP3K5 protein]] CTD PMID:18922898 Map3k5 Rat L-ascorbic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Plant Extracts results in increased phosphorylation of MAP3K5 protein] CTD PMID:20206247 Map3k5 Rat lactulose multiple interactions EXP 6480464 Lactulose inhibits the reaction [Thioacetamide results in increased expression of MAP3K5 protein] CTD PMID:35961375 Map3k5 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of MAP3K5 mRNA CTD PMID:36642386 Map3k5 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of MAP3K5 mRNA CTD PMID:36642386 Map3k5 Rat lenvatinib increases expression EXP 6480464 lenvatinib results in increased expression of MAP3K5 mRNA CTD PMID:34019861 Map3k5 Rat lipopolysaccharide increases response to substance ISO Map3k5 (Mus musculus) 6480464 MAP3K5 protein results in increased susceptibility to Lipopolysaccharides CTD PMID:21449566 Map3k5 Rat lipopolysaccharide increases expression ISO MAP3K5 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of MAP3K5 mRNA CTD PMID:35811015 Map3k5 Rat lipopolysaccharide multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MAP3K5 mRNA CTD PMID:35811015 Map3k5 Rat LY 379268 increases phosphorylation EXP 6480464 LY 379268 results in increased phosphorylation of MAP3K5 protein CTD PMID:17293559 Map3k5 Rat mancozeb increases expression ISO Map3k5 (Mus musculus) 6480464 mancozeb results in increased expression of MAP3K5 mRNA CTD PMID:36007320 Map3k5 Rat mercury dibromide multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP3K5 mRNA CTD PMID:27188386 Map3k5 Rat mercury dichloride increases activity ISO MAP3K5 (Homo sapiens) 6480464 Mercuric Chloride results in increased activity of MAP3K5 protein CTD PMID:16337887 Map3k5 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MAP3K5 mRNA CTD PMID:30047161 Map3k5 Rat methyl methanesulfonate decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of MAP3K5 mRNA CTD PMID:23649840 Map3k5 Rat MK-2206 multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 MK 2206 promotes the reaction [Cadmium Chloride results in increased expression of MAP3K5 protein] CTD PMID:29444456 Map3k5 Rat muscimol multiple interactions ISO Map3k5 (Mus musculus) 6480464 Muscimol inhibits the reaction [Ethanol results in increased expression of MAP3K5 protein] CTD PMID:29044621 Map3k5 Rat N-acetyl-L-cysteine multiple interactions ISO Map3k5 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Rotenone inhibits the reaction [TXN protein binds to and results in decreased activity of MAP3K5 protein]] CTD PMID:16449798 Map3k5 Rat N-acetyl-L-cysteine multiple interactions ISO MAP3K5 (Homo sapiens) 150429751 N-acetyl-L-cysteine co-treated with Curcumin increases phosphorylation of MAP3K5 protein in uterine cervix RGD Map3k5 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP3K5 protein] CTD PMID:18703135 Map3k5 Rat N-acetyl-L-cysteine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [bisphenol A results in increased phosphorylation of MAP3K5 protein] more ... CTD PMID:18703135 more ... Map3k5 Rat N-acetylsphingosine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 N-acetylsphingosine affects the phosphorylation of and results in increased activity of MAP3K5 protein and TXNIP affects the reaction [N-acetylsphingosine affects the phosphorylation of and results in increased activity of MAP3K5 protein] CTD PMID:18270325 Map3k5 Rat N-methyl-4-phenylpyridinium increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAP3K5 protein CTD PMID:20946892 Map3k5 Rat N-methyl-4-phenylpyridinium increases expression ISO MAP3K5 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MAP3K5 protein CTD PMID:34732784 Map3k5 Rat N-methyl-4-phenylpyridinium increases phosphorylation EXP 6480464 1-Methyl-4-phenylpyridinium results in increased phosphorylation of MAP3K5 protein CTD PMID:28939911 Map3k5 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 1-Methyl-4-phenylpyridinium promotes the reaction [MAP3K5 protein binds to MAP2K7 protein] more ... CTD PMID:28939911 Map3k5 Rat N-methyl-4-phenylpyridinium increases expression ISO Map3k5 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MAP3K5 protein CTD PMID:28939911 Map3k5 Rat N-methyl-4-phenylpyridinium multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 1-methylpropyl-2-imidazolyl disulfide inhibits the reaction [schisanhenol inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased expression of MAP3K5 protein]] more ... CTD PMID:20946892 and PMID:34732784 Map3k5 Rat N-methyl-4-phenylpyridinium decreases expression ISO MAP3K5 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of MAP3K5 mRNA CTD PMID:25234470 Map3k5 Rat neoechinulin A multiple interactions ISO Map3k5 (Mus musculus) 6480464 neoechinulin A inhibits the reaction [[APP protein binds to APP protein binds to APP protein] which results in increased phosphorylation of MAP3K5 protein] CTD PMID:23261590 Map3k5 Rat nickel subsulfide affects response to substance ISO MAP3K5 (Homo sapiens) 6480464 MAP3K5 protein affects the susceptibility to nickel subsulfide CTD PMID:20112989 Map3k5 Rat nickel subsulfide multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 nickel subsulfide results in increased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:20112989 Map3k5 Rat nickel sulfate increases expression ISO MAP3K5 (Homo sapiens) 6480464 nickel sulfate results in increased expression of MAP3K5 mRNA CTD PMID:22714537 Map3k5 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of MAP3K5 gene CTD PMID:30521419 Map3k5 Rat obeticholic acid decreases expression ISO MAP3K5 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of MAP3K5 mRNA CTD PMID:27939613 Map3k5 Rat okadaic acid multiple interactions ISO Map3k5 (Mus musculus) 6480464 [lipopolysaccharide and Escherichia coli O111 B4 co-treated with Okadaic Acid co-treated with Fingolimod Hydrochloride] results in increased expression of MAP3K5 mRNA CTD PMID:33069748 Map3k5 Rat ozone multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MAP3K5 mRNA CTD PMID:35430440 Map3k5 Rat paclitaxel multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 MAP3K5 protein affects the reaction [Paclitaxel results in increased activity of CASP3 protein] and MAP3K5 protein affects the reaction [Paclitaxel results in increased cleavage of PARP1 protein] CTD PMID:10075725 Map3k5 Rat paracetamol multiple interactions ISO Map3k5 (Mus musculus) 6480464 MAP3K5 protein affects the reaction [Acetaminophen results in increased expression of ACTG1 mRNA] more ... CTD PMID:18700144 Map3k5 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MAP3K5 mRNA CTD PMID:33387578 Map3k5 Rat paracetamol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat paracetamol decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MAP3K5 mRNA CTD PMID:21420995 and PMID:29067470 Map3k5 Rat paracetamol increases response to substance ISO Map3k5 (Mus musculus) 6480464 MAP3K5 protein results in increased susceptibility to Acetaminophen CTD PMID:18700144 Map3k5 Rat paracetamol increases activity ISO Map3k5 (Mus musculus) 6480464 Acetaminophen results in increased activity of MAP3K5 protein CTD PMID:18700144 Map3k5 Rat paraquat multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Paraquat co-treated with MAP3K5 protein] results in increased degradation of SQSTM1 protein more ... CTD PMID:19735704 and PMID:20929985 Map3k5 Rat perfluorooctane-1-sulfonic acid increases expression ISO Map3k5 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of MAP3K5 mRNA CTD PMID:26300304 Map3k5 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Map3k5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MAP3K5 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MAP3K5 mRNA CTD PMID:36331819 Map3k5 Rat phenobarbital increases expression ISO Map3k5 (Mus musculus) 6480464 Phenobarbital results in increased expression of MAP3K5 mRNA CTD PMID:19270015 Map3k5 Rat phenylephrine multiple interactions EXP 6480464 CAMK2D protein promotes the reaction [Phenylephrine results in increased activity of MAP3K5 protein] and KN 93 inhibits the reaction [Phenylephrine results in increased activity of MAP3K5 protein] CTD PMID:15629441 Map3k5 Rat phenylephrine increases activity EXP 6480464 Phenylephrine results in increased activity of MAP3K5 protein CTD PMID:15629441 Map3k5 Rat phenylmercury acetate increases expression ISO MAP3K5 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MAP3K5 mRNA CTD PMID:26272509 Map3k5 Rat phenylmercury acetate multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP3K5 mRNA CTD PMID:27188386 Map3k5 Rat pirinixic acid increases expression ISO Map3k5 (Mus musculus) 6480464 pirinixic acid results in increased expression of MAP3K5 mRNA CTD PMID:18445702 Map3k5 Rat platycodin D multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [platycodin D affects the phosphorylation of and results in increased activity of MAP3K5 protein] and platycodin D affects the phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:22784044 Map3k5 Rat potassium chromate increases expression ISO MAP3K5 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of MAP3K5 mRNA CTD PMID:22714537 Map3k5 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Map3k5 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of MAP3K5 mRNA CTD PMID:28903501 Map3k5 Rat procymidone increases expression ISO Map3k5 (Mus musculus) 6480464 procymidone results in increased expression of MAP3K5 mRNA CTD PMID:35913088 Map3k5 Rat protein kinase inhibitor multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of MAP3K5 mRNA] CTD PMID:28003376 Map3k5 Rat quercetin multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Quercetin results in decreased phosphorylation of and results in increased activity of MAP3K5 protein] and Quercetin results in decreased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:20083342 Map3k5 Rat rac-lactic acid decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MAP3K5 mRNA CTD PMID:30851411 Map3k5 Rat raloxifene multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of MAP3K5 mRNA CTD PMID:19059307 Map3k5 Rat reactive oxygen species multiple interactions ISO Map3k5 (Mus musculus) 6480464 Reactive Oxygen Species affects the reaction [TXN protein binds to and results in decreased activity of MAP3K5 protein] CTD PMID:16449798 Map3k5 Rat resveratrol increases activity ISO MAP3K5 (Homo sapiens) 6480464 resveratrol results in increased activity of MAP3K5 protein CTD PMID:15217905 Map3k5 Rat resveratrol multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of MAP3K5 mRNA CTD PMID:23557933 Map3k5 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Streptozocin results in increased expression of MAP3K5 protein] CTD PMID:26499206 Map3k5 Rat rotenone multiple interactions ISO Map3k5 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Rotenone inhibits the reaction [TXN protein binds to and results in decreased activity of MAP3K5 protein]] and Rotenone inhibits the reaction [TXN protein binds to and results in decreased activity of MAP3K5 protein] CTD PMID:16449798 Map3k5 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of MAP3K5 mRNA CTD PMID:28374803 Map3k5 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MAP3K5 mRNA CTD PMID:35811015 Map3k5 Rat Salidroside multiple interactions ISO Map3k5 (Mus musculus) 6480464 rhodioloside inhibits the reaction [furan results in increased phosphorylation of MAP3K5 protein] CTD PMID:34450210 Map3k5 Rat salubrinal affects response to substance ISO MAP3K5 (Homo sapiens) 6480464 salubrinal affects the susceptibility to MAP3K5 protein CTD PMID:20929985 Map3k5 Rat salubrinal multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 salubrinal affects the susceptibility to [Paraquat co-treated with MAP3K5 protein] more ... CTD PMID:19735704 and PMID:20929985 Map3k5 Rat SB 431542 multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Map3k5 Rat selenium atom decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Selenium results in decreased expression of MAP3K5 mRNA CTD PMID:19244175 Map3k5 Rat sevoflurane increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 sevoflurane results in increased phosphorylation of MAP3K5 protein CTD PMID:18349187 Map3k5 Rat sodium arsenite increases activity ISO MAP3K5 (Homo sapiens) 6480464 sodium arsenite results in increased activity of MAP3K5 protein CTD PMID:16337887 Map3k5 Rat sodium arsenite affects expression ISO MAP3K5 (Homo sapiens) 6480464 sodium arsenite affects the expression of MAP3K5 mRNA CTD PMID:34032870 Map3k5 Rat sodium arsenite decreases expression ISO MAP3K5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MAP3K5 mRNA CTD PMID:38568856 Map3k5 Rat sodium arsenite increases expression ISO MAP3K5 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP3K5 mRNA CTD PMID:22714537 Map3k5 Rat sodium dichromate decreases expression ISO Map3k5 (Mus musculus) 6480464 sodium bichromate results in decreased expression of MAP3K5 mRNA CTD PMID:22155349 Map3k5 Rat sodium dichromate increases expression ISO Map3k5 (Mus musculus) 6480464 sodium bichromate results in increased expression of MAP3K5 mRNA CTD PMID:22155349 Map3k5 Rat streptozocin multiple interactions ISO Map3k5 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased phosphorylation of MAP3K5 protein more ... CTD PMID:16731828 and PMID:26522834 Map3k5 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of MAP3K5 protein CTD PMID:26499206 Map3k5 Rat streptozocin multiple interactions EXP 6480464 resveratrol inhibits the reaction [Streptozocin results in increased expression of MAP3K5 protein] CTD PMID:26499206 Map3k5 Rat succimer multiple interactions ISO Map3k5 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of MAP3K5 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of MAP3K5 mRNA CTD PMID:21641980 and PMID:26378955 Map3k5 Rat surfactin multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 4-methylumbelliferone 8-carbaldehyde inhibits the reaction [surfactin peptide results in increased phosphorylation of MAP3K5 protein] and KIRA6 inhibits the reaction [surfactin peptide results in increased phosphorylation of MAP3K5 protein] CTD PMID:34850538 Map3k5 Rat surfactin increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 surfactin peptide results in increased phosphorylation of MAP3K5 protein CTD PMID:34850538 Map3k5 Rat surfactin C increases phosphorylation ISO MAP3K5 (Homo sapiens) 6480464 surfactin peptide results in increased phosphorylation of MAP3K5 protein CTD PMID:34850538 Map3k5 Rat surfactin C multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 4-methylumbelliferone 8-carbaldehyde inhibits the reaction [surfactin peptide results in increased phosphorylation of MAP3K5 protein] and KIRA6 inhibits the reaction [surfactin peptide results in increased phosphorylation of MAP3K5 protein] CTD PMID:34850538 Map3k5 Rat tamoxifen multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of MAP3K5 mRNA CTD PMID:19059307 Map3k5 Rat tartrazine multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of MAP3K5 mRNA CTD PMID:33819548 Map3k5 Rat temozolomide increases expression ISO MAP3K5 (Homo sapiens) 6480464 Temozolomide results in increased expression of MAP3K5 mRNA CTD PMID:31758290 Map3k5 Rat teprenone multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 geranylgeranylacetone inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased expression of MAP3K5 protein] CTD PMID:34732784 Map3k5 Rat tert-butyl hydroperoxide increases expression ISO MAP3K5 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of MAP3K5 mRNA CTD PMID:15336504 Map3k5 Rat tetrachloroethene increases expression ISO Map3k5 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of MAP3K5 mRNA CTD PMID:28973375 Map3k5 Rat tetrachloromethane increases expression ISO Map3k5 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MAP3K5 mRNA CTD PMID:31919559 Map3k5 Rat thioacetamide multiple interactions EXP 6480464 Dimethyl Sulfoxide inhibits the reaction [Thioacetamide results in increased activity of MAP3K5 protein] more ... CTD PMID:12370186 and PMID:35961375 Map3k5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAP3K5 mRNA and Thioacetamide results in increased expression of MAP3K5 protein CTD PMID:23411599 and PMID:35961375 Map3k5 Rat thioacetamide increases activity EXP 6480464 Thioacetamide results in increased activity of MAP3K5 protein CTD PMID:12370186 Map3k5 Rat thiram decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Thiram results in decreased expression of MAP3K5 mRNA CTD PMID:38568856 Map3k5 Rat titanium dioxide increases methylation ISO Map3k5 (Mus musculus) 6480464 titanium dioxide results in increased methylation of MAP3K5 promoter CTD PMID:35295148 Map3k5 Rat titanium dioxide decreases methylation ISO Map3k5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP3K5 gene CTD PMID:35295148 Map3k5 Rat titanium dioxide increases expression ISO Map3k5 (Mus musculus) 6480464 titanium dioxide results in increased expression of MAP3K5 mRNA CTD PMID:23557971 Map3k5 Rat tributylstannane multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 tributyltin results in increased expression of and results in increased phosphorylation of MAP3K5 protein CTD PMID:24038145 Map3k5 Rat trichostatin A increases expression ISO MAP3K5 (Homo sapiens) 6480464 trichostatin A results in increased expression of MAP3K5 mRNA CTD PMID:24935251 Map3k5 Rat troglitazone multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 mito-carboxy proxyl inhibits the reaction [troglitazone results in increased activity of MAP3K5 protein] CTD PMID:17975114 Map3k5 Rat troglitazone increases activity ISO MAP3K5 (Homo sapiens) 6480464 troglitazone results in increased activity of MAP3K5 protein CTD PMID:17975114 Map3k5 Rat tungsten decreases expression ISO Map3k5 (Mus musculus) 6480464 Tungsten results in decreased expression of MAP3K5 mRNA CTD PMID:30912803 Map3k5 Rat tunicamycin multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 Tunicamycin results in increased phosphorylation of and results in increased activity of MAP3K5 protein CTD PMID:19735704 Map3k5 Rat valproic acid affects expression ISO Map3k5 (Mus musculus) 6480464 Valproic Acid affects the expression of MAP3K5 mRNA CTD PMID:17292431 Map3k5 Rat valproic acid affects expression ISO MAP3K5 (Homo sapiens) 6480464 Valproic Acid affects the expression of MAP3K5 mRNA CTD PMID:25979313 Map3k5 Rat valproic acid increases expression ISO MAP3K5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAP3K5 mRNA CTD PMID:23179753 more ... Map3k5 Rat valproic acid multiple interactions ISO MAP3K5 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAP3K5 mRNA CTD PMID:27188386 Map3k5 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of MAP3K5 gene CTD PMID:30207508 Map3k5 Rat vitamin E decreases expression ISO MAP3K5 (Homo sapiens) 6480464 Vitamin E results in decreased expression of MAP3K5 mRNA CTD PMID:19244175
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (S)-naringenin (ISO) 1,2-dimethylhydrazine (ISO) 1,4-dithiothreitol (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 3-methyladenine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenol (ISO) 4-phenylbutyric acid (ISO) 4-vinylcyclohexene dioxide (EXP) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) andrographolide (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) belinostat (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) berberine (ISO) bicuculline (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium dichloride (EXP,ISO) cadmium sulfide (ISO) calcitriol (ISO) camptothecin (ISO) cannabidiol (ISO) cannabigerol (ISO) carbon nanotube (ISO) Carnosol (ISO) chenodeoxycholic acid (ISO) chloroethene (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) curcumin (ISO) D-glucose (ISO) daunorubicin (ISO) deoxycholic acid (ISO) deoxynivalenol (ISO) desferrioxamine B (ISO) Dibutyl phosphate (ISO) dieldrin (ISO) dimethyl sulfoxide (EXP) dimethylarsinic acid (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) edaravone (ISO) efavirenz (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) etoposide (ISO) fingolimod hydrochloride (ISO) flutamide (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP,ISO) gamma-aminobutyric acid (ISO) geldanamycin (ISO) gentamycin (EXP) glucose (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) hexadecanoic acid (ISO) hydrogen peroxide (EXP,ISO) indole-3-methanol (EXP,ISO) inulin (ISO) irinotecan (ISO) isoprenaline (ISO) kainic acid (ISO) KN-93 (EXP) L-1,4-dithiothreitol (ISO) L-ascorbic acid (ISO) lactulose (EXP) lead diacetate (EXP) lead(0) (EXP) lenvatinib (EXP) lipopolysaccharide (ISO) LY 379268 (EXP) mancozeb (ISO) mercury dibromide (ISO) mercury dichloride (ISO) methimazole (EXP) methyl methanesulfonate (ISO) MK-2206 (ISO) muscimol (ISO) N-acetyl-L-cysteine (EXP,ISO) N-acetylsphingosine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) neoechinulin A (ISO) nickel subsulfide (ISO) nickel sulfate (ISO) Nor-9-carboxy-delta9-THC (ISO) obeticholic acid (ISO) okadaic acid (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) platycodin D (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) procymidone (ISO) protein kinase inhibitor (ISO) quercetin (ISO) rac-lactic acid (ISO) raloxifene (ISO) reactive oxygen species (ISO) resveratrol (EXP,ISO) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Salidroside (ISO) salubrinal (ISO) SB 431542 (ISO) selenium atom (ISO) sevoflurane (ISO) sodium arsenite (ISO) sodium dichromate (ISO) streptozocin (EXP,ISO) succimer (ISO) surfactin (ISO) surfactin C (ISO) tamoxifen (ISO) tartrazine (ISO) temozolomide (ISO) teprenone (ISO) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichostatin A (ISO) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
apoptotic signaling pathway (IEA,ISO) cellular response to amino acid starvation (IEA,ISO) cellular response to hydrogen peroxide (IEA,IEP,ISO) cellular response to reactive nitrogen species (IEA,ISO) cellular response to tumor necrosis factor (IEP) endothelial cell apoptotic process (IEP) intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (IBA,IEA,ISO) intrinsic apoptotic signaling pathway in response to oxidative stress (IBA,IEA,ISO) JNK cascade (IBA,IDA,IEA,ISO) MAPK cascade (IEA,ISO) neuron apoptotic process (IBA,IEA,ISO) neuron intrinsic apoptotic signaling pathway in response to oxidative stress (IEA,ISO) p38MAPK cascade (IBA,IEA,ISO) positive regulation of apoptotic process (IEA,ISO) positive regulation of cardiac muscle cell apoptotic process (IMP) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of JNK cascade (IEA,ISO) positive regulation of JUN kinase activity (IMP,ISO) positive regulation of MAPK cascade (IEA,ISO) positive regulation of myoblast differentiation (IEA,ISO) positive regulation of p38MAPK cascade (IMP) positive regulation of protein phosphorylation (IDA) positive regulation of vascular associated smooth muscle cell proliferation (IMP) programmed necrotic cell death (IEA,ISO) regulation of programmed cell death (IEA,ISO) response to endoplasmic reticulum stress (IEA,IEP,ISO) response to ischemia (IEP) stress-activated MAPK cascade (IEA,ISO)
Molecular Function
ATP binding (IEA,ISO) identical protein binding (IEA,ISO) JUN kinase kinase kinase activity (IEA,ISO) kinase activity (IEA) magnesium ion binding (IEA,ISO) MAP kinase kinase kinase activity (IBA,IDA,IEA,ISO) metal ion binding (IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein domain specific binding (IEA,ISO) protein homodimerization activity (IEA,ISO) protein kinase activity (IEA,ISO) protein kinase binding (IEA,ISO) protein phosphatase binding (IEA,ISO) protein serine/threonine kinase activity (IEA) transferase activity (IEA)
1.
Brain-targeting delivery for RNAi neuroprotection against cerebral ischemia reperfusion injury.
An S, etal., Biomaterials. 2013 Nov;34(35):8949-59. doi: 10.1016/j.biomaterials.2013.07.060. Epub 2013 Aug 19.
2.
ASK1 and MAP2K6 as modifiers of age at onset in Huntington's disease.
Arning L, etal., J Mol Med (Berl). 2008 Apr;86(4):485-90. doi: 10.1007/s00109-007-0299-6. Epub 2008 Mar 8.
3.
Tumor necrosis factor-alpha and apoptosis signal-regulating kinase 1 control reactive oxygen species release, mitochondrial autophagy, and c-Jun N-terminal kinase/p38 phosphorylation during necrotizing enterocolitis.
Baregamian N, etal., Oxid Med Cell Longev. 2009 Nov-Dec;2(5):297-306. doi: 10.4161/oxim.2.5.9541.
4.
Inhibition of apoptosis signal-regulating kinase 1 reduces endoplasmic reticulum stress and nuclear huntingtin fragments in a mouse model of Huntington disease.
Cho KJ, etal., Neuroscience. 2009 Nov 10;163(4):1128-34. doi: 10.1016/j.neuroscience.2009.07.048. Epub 2009 Jul 28.
5.
Mechanisms and functions of p38 MAPK signalling.
Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
6.
NQDI 1, an inhibitor of ASK1 attenuates acute ischemic renal injury by modulating oxidative stress and cell death.
El Eter E Cardiovasc Hematol Agents Med Chem. 2013 Sep;11(3):179-86.
7.
Evidence for apoptosis signal-regulating kinase 1 in the regenerating palatal epithelium upon acute injury.
Funato N, etal., Lab Invest. 1998 Apr;78(4):477-83.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
An apoptosis signal-regulating kinase 1 inhibitor reduces cardiomyocyte apoptosis and infarct size in a rat ischemia-reperfusion model.
Gerczuk PZ, etal., J Cardiovasc Pharmacol. 2012 Sep;60(3):276-82. doi: 10.1097/FJC.0b013e31825ea0fa.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Activation of ASK1, downstream MAPKK and MAPK isoforms during cardiac ischaemia.
Harding SJ, etal., Biochim Biophys Acta. 2010 Sep;1802(9):733-40. doi: 10.1016/j.bbadis.2010.06.005. Epub 2010 Jun 13.
12.
Activation of the stress-activated MAP kinase, p38, but not JNK in cortical motor neurons during early presymptomatic stages of amyotrophic lateral sclerosis in transgenic mice.
Holasek SS, etal., Brain Res. 2005 May 31;1045(1-2):185-98. Epub 2005 Apr 25.
13.
Activation of apoptosis signal-regulating kinase 1 in injured artery and its critical role in neointimal hyperplasia.
Izumi Y, etal., Circulation. 2003 Dec 2;108(22):2812-8. Epub 2003 Nov 24.
14.
Curcumin induced human gastric cancer BGC-823 cells apoptosis by ROS-mediated ASK1-MKK4-JNK stress signaling pathway.
Liang T, etal., Int J Mol Sci. 2014 Sep 5;15(9):15754-65. doi: 10.3390/ijms150915754.
15.
Endogenous nitric oxide induces activation of apoptosis signal-regulating kinase 1 via S-nitrosylation in rat hippocampus during cerebral ischemia-reperfusion.
Liu DH, etal., Neuroscience. 2013 Jan 15;229:36-48. doi: 10.1016/j.neuroscience.2012.10.055. Epub 2012 Nov 5.
16.
Bax inhibitor-1 suppresses early brain injury following experimental subarachnoid hemorrhage in rats.
Liu J, etal., Int J Mol Med. 2018 Nov;42(5):2891-2902. doi: 10.3892/ijmm.2018.3858. Epub 2018 Sep 5.
17.
MicroRNA-145 Protects against Myocardial Ischemia Reperfusion Injury via CaMKII-Mediated Antiapoptotic and Anti-Inflammatory Pathways.
Liu Z, etal., Oxid Med Cell Longev. 2019 Sep 10;2019:8948657. doi: 10.1155/2019/8948657. eCollection 2019.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Induction of apoptosis signal regulating kinase 1 (ASK1) after spinal cord injury in rats: possible involvement of ASK1-JNK and -p38 pathways in neuronal apoptosis.
Nakahara S, etal., J Neuropathol Exp Neurol. 1999 May;58(5):442-50.
20.
ASK1 is essential for endoplasmic reticulum stress-induced neuronal cell death triggered by expanded polyglutamine repeats.
Nishitoh H, etal., Genes Dev. 2002 Jun 1;16(11):1345-55.
21.
Blocking Daxx trafficking attenuates neuronal cell death following ischemia/reperfusion in rat hippocampus CA1 region.
Niu YL, etal., Arch Biochem Biophys. 2011 Nov;515(1-2):89-98. doi: 10.1016/j.abb.2011.07.016. Epub 2011 Aug 6.
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
Role of apoptosis signal-regulating kinase 1 in complement-mediated glomerular epithelial cell injury.
Ren G, etal., Mol Immunol. 2008 Apr;45(8):2236-46. doi: 10.1016/j.molimm.2007.11.013. Epub 2008 Feb 21.
24.
GOA pipeline
RGD automated data pipeline
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Inhibition of apoptosis-regulated signaling kinase-1 and prevention of congestive heart failure by estrogen.
Satoh M, etal., Circulation. 2007 Jun 26;115(25):3197-204. Epub 2007 Jun 11.
28.
Formation of a tumour necrosis factor receptor 1 molecular scaffolding complex and activation of apoptosis signal-regulating kinase 1 during seizure-induced neuronal death.
Shinoda S, etal., Eur J Neurosci. 2003 May;17(10):2065-76.
29.
The effect of apoptosis signal-regulating kinase 1 gene transfer on rat collagen induced arthritis.
Terauchi R, etal., J Rheumatol. 2005 Dec;32(12):2373-80.
30.
Apoptosis signal-regulating kinase 1 is a novel target molecule for cognitive impairment induced by chronic cerebral hypoperfusion.
Toyama K, etal., Arterioscler Thromb Vasc Biol. 2014 Mar;34(3):616-25. doi: 10.1161/ATVBAHA.113.302440. Epub 2013 Dec 26.
31.
Targeted deletion of apoptosis signal-regulating kinase 1 attenuates left ventricular remodeling.
Yamaguchi O, etal., Proc Natl Acad Sci U S A. 2003 Dec 23;100(26):15883-8. Epub 2003 Dec 9.
32.
Novel mechanism and role of angiotensin II induced vascular endothelial injury in hypertensive diastolic heart failure.
Yamamoto E, etal., Arterioscler Thromb Vasc Biol. 2007 Dec;27(12):2569-75. Epub 2007 Oct 11.
33.
Hypercapnic acidosis confers antioxidant and anti-apoptosis effects against ventilator-induced lung injury.
Yang WC, etal., Lab Invest. 2013 Dec;93(12):1339-49. doi: 10.1038/labinvest.2013.118. Epub 2013 Oct 14.
34.
Hydrogen peroxide predisposes neonatal rat ventricular myocytes to Fas-mediated apoptosis.
Yaniv G, etal., Biochem Biophys Res Commun. 2005 Oct 28;336(3):740-6. doi: 10.1016/j.bbrc.2005.08.167.
35.
Biphasic activation of apoptosis signal-regulating kinase 1-stress-activated protein kinase 1-c-Jun N-terminal protein kinase pathway is selectively mediated by Ca2+-permeable alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionate receptors involving oxidative stress following brain ischemia in rat hippocampus.
Zhang Q, etal., Neurosci Lett. 2003 Jan 30;337(1):51-5.
Map3k5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 16,505,387 - 16,723,899 (+) NCBI GRCr8 mRatBN7.2 1 14,685,776 - 14,904,935 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 14,685,492 - 14,904,800 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 14,451,174 - 14,657,631 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 20,453,039 - 20,659,558 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 14,666,217 - 14,883,508 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 15,412,603 - 15,613,752 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 15,412,603 - 15,613,746 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 16,961,080 - 17,160,996 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 15,205,361 - 15,346,422 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 15,204,326 - 15,346,541 (+) NCBI Celera 1 13,127,308 - 13,336,631 (+) NCBI Celera Cytogenetic Map 1 p12 NCBI
MAP3K5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 136,557,046 - 136,793,091 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 136,557,046 - 136,793,097 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 136,878,184 - 137,113,615 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 136,919,880 - 137,155,349 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 136,919,880 - 137,155,349 NCBI Celera 6 137,618,672 - 137,854,128 (-) NCBI Celera Cytogenetic Map 6 q23.3 NCBI HuRef 6 134,442,506 - 134,677,689 (-) NCBI HuRef CHM1_1 6 137,140,796 - 137,376,381 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 137,745,240 - 137,981,287 (-) NCBI T2T-CHM13v2.0
Map3k5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 19,809,847 - 20,018,496 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 19,810,218 - 20,018,499 (+) Ensembl GRCm39 Ensembl GRCm38 10 19,934,101 - 20,142,750 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 19,934,472 - 20,142,753 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 19,654,332 - 19,862,556 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 19,623,888 - 19,831,139 (+) NCBI MGSCv36 mm8 Celera 10 19,821,331 - 20,029,886 (+) NCBI Celera Cytogenetic Map 10 A3 NCBI cM Map 10 9.35 NCBI
Map3k5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 163,103 - 377,808 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 162,499 - 376,919 (+) NCBI ChiLan1.0 ChiLan1.0
MAP3K5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 156,523,085 - 156,789,428 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 154,421,795 - 154,688,128 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 134,316,841 - 134,582,843 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 138,406,398 - 138,641,720 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 138,406,398 - 138,641,727 (-) Ensembl panpan1.1 panPan2
MAP3K5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 29,107,813 - 29,306,437 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 29,108,591 - 29,306,503 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 29,990,542 - 30,188,619 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 29,268,427 - 29,467,057 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 29,268,507 - 29,467,038 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 29,153,995 - 29,352,081 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 29,038,857 - 29,237,270 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 29,337,976 - 29,536,372 (-) NCBI UU_Cfam_GSD_1.0
Map3k5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 124,209,480 - 124,418,731 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936560 3,989,420 - 4,197,501 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936560 3,988,696 - 4,197,953 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP3K5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 27,380,142 - 27,600,493 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 27,380,143 - 27,600,500 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 30,747,576 - 30,980,371 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP3K5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 36,614,489 - 36,858,524 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 36,615,633 - 36,858,601 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 8,796,832 - 9,040,884 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map3k5
.
Predicted Target Of
Count of predictions: 136 Count of miRNA genes: 57 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000051496, ENSRNOT00000067070 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578650 Bmd6 Bone mineral density QTL 6 12.2 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 1 509108 43284926 Rat 1354647 Despr8 Despair related QTL 8 0.0000341 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 1 24744506 Rat 1578651 Bmd7 Bone mineral density QTL 7 14.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 1 509108 43284926 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 2313070 Bss52 Bone structure and strength QTL 52 4.4 0.0001 body length (VT:0001256) body length (CMO:0000013) 1 1 32356093 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 2298546 Neuinf4 Neuroinflammation QTL 4 5.1 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 1 1 28736750 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 2317755 Glom22 Glomerulus QTL 22 3.8 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 11481482 32355910 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 2313090 Bmd69 Bone mineral density QTL 69 4.4 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 1 32356093 Rat 4889451 Eae29 Experimental allergic encephalomyelitis QTL 29 5.51 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 5925877 24697545 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1600360 Mcs16 Mammary carcinoma susceptibility QTL 16 2.4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 2244390 43433040 Rat 1578669 Bss9 Bone structure and strength QTL 9 6.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 1 509108 43284926 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 2313053 Bss51 Bone structure and strength QTL 51 3.8 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 1 32356093 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000051496 ⟹ ENSRNOP00000051338
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 14,685,492 - 14,904,800 (+) Ensembl Rnor_6.0 Ensembl 1 15,412,603 - 15,613,746 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000067070 ⟹ ENSRNOP00000063417
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 14,686,358 - 14,904,800 (+) Ensembl Rnor_6.0 Ensembl 1 15,412,603 - 15,613,746 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096116 ⟹ ENSRNOP00000090845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 14,685,492 - 14,904,800 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104843 ⟹ ENSRNOP00000084904
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 14,685,492 - 14,904,800 (+) Ensembl
RefSeq Acc Id:
NM_001277694 ⟹ NP_001264623
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 16,505,964 - 16,723,218 (+) NCBI mRatBN7.2 1 14,686,358 - 14,903,639 (+) NCBI Rnor_6.0 1 15,412,603 - 15,613,752 (+) NCBI Rnor_5.0 1 16,961,080 - 17,160,996 (+) NCBI Celera 1 13,127,308 - 13,336,631 (+) NCBI
Sequence:
ATGGGCACCGAAGCCGGCGAGGGCATCACTTTCTCCGTGCCGCCCATTTTGTCCGCGGGTTTCTGCCCCATCCCGGAGGGCGGCAGCTGCCGGAGGGGAGGAGGAGCGGCGACGGCGGCGGAGGGCGA
hide sequence
RefSeq Acc Id:
XM_039084822 ⟹ XP_038940750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 16,505,387 - 16,723,899 (+) NCBI mRatBN7.2 1 14,685,776 - 14,904,935 (+) NCBI
RefSeq Acc Id:
XM_039084825 ⟹ XP_038940753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 16,651,717 - 16,723,899 (+) NCBI mRatBN7.2 1 14,832,146 - 14,904,918 (+) NCBI
RefSeq Acc Id:
NP_001264623 ⟸ NM_001277694
- UniProtKB:
A0A8I6AEL0 (UniProtKB/TrEMBL), A0A8I6A280 (UniProtKB/TrEMBL)
- Sequence:
MGTEAGEGITFSVPPILSAGFCPIPEGGSCRRGGGAATAAEGEPSLQPLLMPPPPPPPGSFWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTVAYVINEASQGQLVVAESEALQSLREACE
hide sequence
Ensembl Acc Id:
ENSRNOP00000063417 ⟸ ENSRNOT00000067070
Ensembl Acc Id:
ENSRNOP00000051338 ⟸ ENSRNOT00000051496
RefSeq Acc Id:
XP_038940750 ⟸ XM_039084822
- Peptide Label:
isoform X1
- UniProtKB:
D3ZZH6 (UniProtKB/TrEMBL), A0A8I6A280 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038940753 ⟸ XM_039084825
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000084904 ⟸ ENSRNOT00000104843
Ensembl Acc Id:
ENSRNOP00000090845 ⟸ ENSRNOT00000096116
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-10
RGD1306565
similar to apoptosis signal-regulating kinase 1
Map3k5
mitogen-activated protein kinase kinase kinase 5
Data merged from RGD:1306431
737654 APPROVED
2012-10-10
Map3k5
mitogen-activated protein kinase kinase kinase 5
RGD1306565
similar to apoptosis signal-regulating kinase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1306565
similar to apoptosis signal-regulating kinase 1
RGD1306565_predicted
similar to apoptosis signal-regulating kinase 1 (predicted)
'predicted' is removed
2292626 APPROVED
2008-04-30
Map3k5
mitogen-activated protein kinase kinase kinase 5
Map3k5_predicted
mitogen-activated protein kinase kinase kinase 5 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-20
RGD1306565_predicted
similar to apoptosis signal-regulating kinase 1 (predicted)
LOC365057_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC365057_predicted
similar to apoptosis signal-regulating kinase 1 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Map3k5_predicted
mitogen-activated protein kinase kinase kinase 5 (predicted)
Symbol and Name status set to approved
70820 APPROVED
