Symbol:
Atxn7l1
Name:
ataxin 7-like 1
RGD ID:
1305730
Description:
Orthologous to human ATXN7L1 (ataxin 7 like 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ataxin 7-like 4; ataxin-7-like protein 1; Atxn7l4; LOC362726; RGD1305730; RGD1564242; similar to hypothetical protein MGC33190
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATXN7L1 (ataxin 7 like 1) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Treefam
Mus musculus (house mouse):
Atxn7l1 (ataxin 7-like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atxn7l1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATXN7L1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATXN7L1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atxn7l1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATXN7L1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATXN7L1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atxn7l1 (ataxin 7 like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ATXN7L1 (ataxin 7 like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atxn7l1 (ataxin 7-like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
SGF73
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
atxn7l1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 55,487,309 - 55,709,751 (+) NCBI GRCr8 mRatBN7.2 6 49,759,876 - 49,982,323 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 49,759,883 - 49,982,320 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 52,459,930 - 52,680,552 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 52,459,946 - 52,675,574 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 6 51,491,170 - 51,596,750 (+) NCBI Celera 6 48,950,501 - 49,171,867 (+) NCBI Celera Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atxn7l1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ATXN7L1 mRNA] CTD PMID:31150632 Atxn7l1 Rat (-)-epigallocatechin 3-gallate increases expression ISO RGD:1345348 6480464 epigallocatechin gallate results in increased expression of ATXN7L1 mRNA CTD PMID:22079256 Atxn7l1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1345348 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ATXN7L1 mRNA CTD PMID:22079256 Atxn7l1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of ATXN7L1 mRNA CTD PMID:30723492 Atxn7l1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1345348 6480464 Tetrachlorodibenzodioxin affects the expression of ATXN7L1 mRNA CTD PMID:22574217 Atxn7l1 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO RGD:1614792 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased methylation of ATXN7L1 promoter CTD PMID:26251327 Atxn7l1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1614792 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ATXN7L1 mRNA CTD PMID:26251327 Atxn7l1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1345348 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Atxn7l1 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:1614792 6480464 bisphenol S results in increased methylation of ATXN7L1 exon CTD PMID:33297965 Atxn7l1 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1614792 6480464 Fenretinide results in decreased expression of ATXN7L1 mRNA CTD PMID:28973697 Atxn7l1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ATXN7L1 mRNA CTD PMID:24780913 Atxn7l1 Rat aflatoxin B1 affects expression ISO RGD:1345348 6480464 Aflatoxin B1 affects the expression of ATXN7L1 protein CTD PMID:20106945 Atxn7l1 Rat aflatoxin B1 increases methylation ISO RGD:1345348 6480464 Aflatoxin B1 results in increased methylation of ATXN7L1 intron CTD PMID:30157460 Atxn7l1 Rat aflatoxin B1 decreases methylation ISO RGD:1345348 6480464 Aflatoxin B1 results in decreased methylation of ATXN7L1 gene CTD PMID:27153756 Atxn7l1 Rat antirheumatic drug decreases expression ISO RGD:1345348 6480464 Antirheumatic Agents results in decreased expression of ATXN7L1 mRNA CTD PMID:24449571 Atxn7l1 Rat benzo[a]pyrene decreases expression ISO RGD:1345348 6480464 Benzo(a)pyrene results in decreased expression of ATXN7L1 mRNA CTD PMID:20064835|PMID:20106945|PMID:32234424 Atxn7l1 Rat benzo[a]pyrene increases methylation ISO RGD:1345348 6480464 Benzo(a)pyrene results in increased methylation of ATXN7L1 promoter CTD PMID:27901495 Atxn7l1 Rat benzo[a]pyrene affects methylation ISO RGD:1345348 6480464 Benzo(a)pyrene affects the methylation of ATXN7L1 intron CTD PMID:30157460 Atxn7l1 Rat benzo[a]pyrene decreases expression ISO RGD:1614792 6480464 Benzo(a)pyrene results in decreased expression of ATXN7L1 mRNA CTD PMID:19770486 Atxn7l1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ATXN7L1 mRNA CTD PMID:25181051 Atxn7l1 Rat bisphenol A decreases methylation ISO RGD:1345348 6480464 bisphenol A results in decreased methylation of ATXN7L1 gene CTD PMID:31601247 Atxn7l1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ATXN7L1 mRNA CTD PMID:30816183 Atxn7l1 Rat bisphenol A increases expression ISO RGD:1345348 6480464 bisphenol A results in increased expression of ATXN7L1 mRNA CTD PMID:29275510|PMID:36232920 Atxn7l1 Rat bisphenol A multiple interactions ISO RGD:1345348 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ATXN7L1 gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Atxn7l1 Rat butanal decreases expression ISO RGD:1345348 6480464 butyraldehyde results in decreased expression of ATXN7L1 mRNA CTD PMID:26079696 Atxn7l1 Rat cadmium atom multiple interactions ISO RGD:1345348 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ATXN7L1 more ... CTD PMID:35301059 Atxn7l1 Rat cadmium dichloride decreases expression ISO RGD:1345348 6480464 Cadmium Chloride results in decreased expression of ATXN7L1 mRNA CTD PMID:38568856 Atxn7l1 Rat cadmium dichloride multiple interactions ISO RGD:1345348 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ATXN7L1 more ... CTD PMID:35301059 Atxn7l1 Rat carbon nanotube decreases expression ISO RGD:1614792 6480464 Nanotubes, Carbon analog results in decreased expression of ATXN7L1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Atxn7l1 Rat CGP 52608 multiple interactions ISO RGD:1345348 6480464 CGP 52608 promotes the reaction [RORA protein binds to ATXN7L1 gene] CTD PMID:28238834 Atxn7l1 Rat chlordecone affects response to substance ISO RGD:1345348 6480464 ATXN7L1 gene SNP affects the susceptibility to Chlordecone CTD PMID:25622337 Atxn7l1 Rat cisplatin decreases expression ISO RGD:1345348 6480464 Cisplatin results in decreased expression of ATXN7L1 mRNA CTD PMID:27594783 Atxn7l1 Rat cisplatin multiple interactions ISO RGD:1345348 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ATXN7L1 mRNA CTD PMID:27392435 Atxn7l1 Rat cyclosporin A decreases expression ISO RGD:1345348 6480464 Cyclosporine results in decreased expression of ATXN7L1 mRNA CTD PMID:20106945 Atxn7l1 Rat cyclosporin A decreases methylation ISO RGD:1345348 6480464 Cyclosporine results in decreased methylation of ATXN7L1 promoter CTD PMID:27989131 Atxn7l1 Rat dexamethasone multiple interactions ISO RGD:1345348 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Atxn7l1 Rat Dibutyl phosphate affects expression ISO RGD:1345348 6480464 di-n-butylphosphoric acid affects the expression of ATXN7L1 mRNA CTD PMID:37042841 Atxn7l1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ATXN7L1 mRNA CTD PMID:21266533 Atxn7l1 Rat dorsomorphin multiple interactions ISO RGD:1345348 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Atxn7l1 Rat doxorubicin decreases expression ISO RGD:1345348 6480464 Doxorubicin results in decreased expression of ATXN7L1 mRNA CTD PMID:29803840 Atxn7l1 Rat epoxiconazole increases expression ISO RGD:1614792 6480464 epoxiconazole results in increased expression of ATXN7L1 mRNA CTD PMID:35436446 Atxn7l1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of ATXN7L1 mRNA CTD PMID:34044035 Atxn7l1 Rat folic acid decreases expression ISO RGD:1614792 6480464 Folic Acid results in decreased expression of ATXN7L1 mRNA CTD PMID:25629700 Atxn7l1 Rat fulvestrant multiple interactions ISO RGD:1345348 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ATXN7L1 gene CTD PMID:31601247 Atxn7l1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ATXN7L1 mRNA CTD PMID:33387578 Atxn7l1 Rat hydralazine multiple interactions ISO RGD:1345348 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ATXN7L1 mRNA CTD PMID:17183730 Atxn7l1 Rat indometacin multiple interactions ISO RGD:1345348 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Atxn7l1 Rat methamphetamine increases expression ISO RGD:1614792 6480464 Methamphetamine results in increased expression of ATXN7L1 mRNA CTD PMID:26307267 Atxn7l1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ATXN7L1 gene CTD PMID:35440735 Atxn7l1 Rat nickel sulfate increases expression ISO RGD:1345348 6480464 nickel sulfate results in increased expression of ATXN7L1 mRNA CTD PMID:22714537 Atxn7l1 Rat okadaic acid decreases expression ISO RGD:1345348 6480464 Okadaic Acid results in decreased expression of ATXN7L1 mRNA CTD PMID:38832940 Atxn7l1 Rat paracetamol increases expression ISO RGD:1345348 6480464 Acetaminophen results in increased expression of ATXN7L1 mRNA CTD PMID:22230336 Atxn7l1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ATXN7L1 mRNA CTD PMID:33387578 Atxn7l1 Rat paracetamol decreases expression ISO RGD:1345348 6480464 Acetaminophen results in decreased expression of ATXN7L1 mRNA CTD PMID:29067470 Atxn7l1 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1614792 6480464 perfluorohexanesulfonic acid results in increased expression of ATXN7L1 mRNA CTD PMID:37995155 Atxn7l1 Rat potassium chromate multiple interactions ISO RGD:1345348 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ATXN7L1 mRNA CTD PMID:22079256 Atxn7l1 Rat potassium chromate decreases expression ISO RGD:1345348 6480464 potassium chromate(VI) results in decreased expression of ATXN7L1 mRNA CTD PMID:22079256 Atxn7l1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1614792 6480464 Pregnenolone Carbonitrile results in decreased expression of ATXN7L1 mRNA CTD PMID:28903501 Atxn7l1 Rat propiconazole increases expression ISO RGD:1614792 6480464 propiconazole results in increased expression of ATXN7L1 mRNA CTD PMID:21278054 Atxn7l1 Rat SB 431542 multiple interactions ISO RGD:1345348 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Atxn7l1 Rat silicon dioxide increases expression ISO RGD:1345348 6480464 Silicon Dioxide analog results in increased expression of ATXN7L1 mRNA CTD PMID:25895662 Atxn7l1 Rat sodium arsenite increases expression ISO RGD:1345348 6480464 sodium arsenite results in increased expression of ATXN7L1 mRNA CTD PMID:38568856 Atxn7l1 Rat tebuconazole decreases expression ISO RGD:1345348 6480464 tebuconazole results in decreased expression of ATXN7L1 mRNA CTD PMID:30458266 Atxn7l1 Rat testosterone decreases expression ISO RGD:1345348 6480464 Testosterone results in decreased expression of ATXN7L1 mRNA CTD PMID:33359661 Atxn7l1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ATXN7L1 mRNA] CTD PMID:31150632 Atxn7l1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ATXN7L1 mRNA CTD PMID:31150632 Atxn7l1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ATXN7L1 mRNA CTD PMID:23411599|PMID:34492290 Atxn7l1 Rat trichostatin A decreases expression ISO RGD:1345348 6480464 trichostatin A results in decreased expression of ATXN7L1 mRNA CTD PMID:24935251 Atxn7l1 Rat triphenyl phosphate affects expression ISO RGD:1345348 6480464 triphenyl phosphate affects the expression of ATXN7L1 mRNA CTD PMID:37042841 Atxn7l1 Rat triptonide decreases expression ISO RGD:1614792 6480464 triptonide results in decreased expression of ATXN7L1 mRNA CTD PMID:33045310 Atxn7l1 Rat urethane decreases expression ISO RGD:1345348 6480464 Urethane results in decreased expression of ATXN7L1 mRNA CTD PMID:28818685 Atxn7l1 Rat valproic acid multiple interactions ISO RGD:1345348 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ATXN7L1 mRNA CTD PMID:17183730 Atxn7l1 Rat valproic acid decreases expression ISO RGD:1345348 6480464 Valproic Acid results in decreased expression of ATXN7L1 mRNA CTD PMID:23179753|PMID:24935251 Atxn7l1 Rat valproic acid decreases methylation ISO RGD:1345348 6480464 Valproic Acid results in decreased methylation of ATXN7L1 gene CTD PMID:29154799 Atxn7l1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ATXN7L1 mRNA CTD PMID:23034163 Atxn7l1 Rat vorinostat multiple interactions ISO RGD:1345348 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386
Atxn7l1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 55,487,309 - 55,709,751 (+) NCBI GRCr8 mRatBN7.2 6 49,759,876 - 49,982,323 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 49,759,883 - 49,982,320 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 52,459,930 - 52,680,552 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 52,459,946 - 52,675,574 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 6 51,491,170 - 51,596,750 (+) NCBI Celera 6 48,950,501 - 49,171,867 (+) NCBI Celera Cytogenetic Map 6 q16 NCBI
ATXN7L1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 105,604,772 - 105,876,599 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 105,604,772 - 105,876,599 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 105,245,219 - 105,517,045 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 105,188,055 - 105,304,264 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 104,994,769 - 105,110,979 NCBI Celera 7 100,050,314 - 100,322,052 (-) NCBI Celera Cytogenetic Map 7 q22.3 NCBI HuRef 7 99,603,460 - 99,874,805 (-) NCBI HuRef CHM1_1 7 105,178,559 - 105,450,676 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 106,918,950 - 107,191,449 (-) NCBI T2T-CHM13v2.0
Atxn7l1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 33,196,967 - 33,426,407 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 33,197,692 - 33,423,184 (+) Ensembl GRCm39 Ensembl GRCm38 12 33,146,968 - 33,376,408 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 33,147,693 - 33,373,185 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 33,832,551 - 34,053,142 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 33,887,798 - 33,953,520 (+) NCBI MGSCv36 mm8 Celera 12 34,597,134 - 34,812,636 (+) NCBI Celera Cytogenetic Map 12 A3 NCBI cM Map 12 14.03 NCBI
Atxn7l1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 10,167,187 - 10,226,155 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 10,167,196 - 10,391,362 (-) NCBI ChiLan1.0 ChiLan1.0
ATXN7L1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 142,455,632 - 142,722,059 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 190,720,280 - 190,992,018 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 97,594,803 - 97,861,463 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 110,325,150 - 110,590,054 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 110,327,942 - 110,590,021 (-) Ensembl panpan1.1 panPan2
ATXN7L1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 14,661,497 - 14,821,041 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 14,661,497 - 14,816,575 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 14,227,049 - 14,472,079 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 14,877,168 - 15,123,147 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 14,854,414 - 15,118,685 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 14,664,576 - 14,909,495 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 14,586,766 - 14,832,518 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 14,867,138 - 15,112,465 (+) NCBI UU_Cfam_GSD_1.0
Atxn7l1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 56,926,069 - 57,163,401 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 18,049,847 - 18,287,213 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 18,049,860 - 18,287,175 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATXN7L1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 105,464,484 - 105,799,064 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 105,464,614 - 105,925,637 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 116,232,446 - 116,608,014 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATXN7L1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 74,525,581 - 74,796,167 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 74,525,184 - 74,796,133 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 29,115,143 - 29,390,520 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atxn7l1
.
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
D6Got66
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 49,826,318 - 49,826,514 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,525,192 - 52,525,387 NCBI Rnor6.0 Rnor_5.0 6 62,148,594 - 62,148,789 UniSTS Rnor5.0 RGSC_v3.4 6 51,560,528 - 51,560,724 RGD RGSC3.4 RGSC_v3.4 6 51,560,529 - 51,560,724 UniSTS RGSC3.4 RGSC_v3.1 6 51,563,655 - 51,563,850 RGD Celera 6 49,016,918 - 49,017,113 UniSTS RH 3.4 Map 6 324.8 UniSTS RH 3.4 Map 6 324.8 RGD RH 2.0 Map 6 511.4 RGD Cytogenetic Map 6 q16 UniSTS
BF401506
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 49,907,664 - 49,907,843 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,605,575 - 52,605,753 NCBI Rnor6.0 Rnor_5.0 6 62,227,944 - 62,228,122 UniSTS Rnor5.0 RGSC_v3.4 6 51,642,884 - 51,643,062 UniSTS RGSC3.4 Celera 6 49,097,302 - 49,097,480 UniSTS RH 3.4 Map 6 326.3 UniSTS Cytogenetic Map 6 q16 UniSTS
BE113530
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 49,936,490 - 49,936,652 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,634,371 - 52,634,532 NCBI Rnor6.0 Rnor_5.0 6 62,256,740 - 62,256,901 UniSTS Rnor5.0 RGSC_v3.4 6 51,671,579 - 51,671,740 UniSTS RGSC3.4 Celera 6 49,126,124 - 49,126,285 UniSTS RH 3.4 Map 6 325.2 UniSTS Cytogenetic Map 6 q16 UniSTS
BE100986
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 115,071,898 - 115,072,046 (+) MAPPER mRatBN7.2 mRatBN7.2 6 49,859,431 - 49,859,582 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,558,183 - 52,558,333 NCBI Rnor6.0 Rnor_6.0 3 120,425,154 - 120,425,301 NCBI Rnor6.0 Rnor_5.0 6 62,181,585 - 62,181,735 UniSTS Rnor5.0 Rnor_5.0 3 126,908,213 - 126,908,360 UniSTS Rnor5.0 RGSC_v3.4 3 115,376,557 - 115,376,704 UniSTS RGSC3.4 RGSC_v3.4 6 51,594,421 - 51,594,571 UniSTS RGSC3.4 Celera 6 49,049,695 - 49,049,845 UniSTS Celera 3 113,906,291 - 113,906,438 UniSTS RH 3.4 Map 3 986.4 UniSTS Cytogenetic Map 3 q36 UniSTS Cytogenetic Map 6 q16 UniSTS
MARC_13945-13946:1007583817:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 49,759,936 - 49,760,683 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,460,002 - 52,460,748 NCBI Rnor6.0 Rnor_5.0 6 62,083,404 - 62,084,150 UniSTS Rnor5.0 RGSC_v3.4 6 51,494,625 - 51,495,371 UniSTS RGSC3.4 Celera 6 48,950,573 - 48,951,319 UniSTS Cytogenetic Map 6 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013474 ⟹ ENSRNOP00000013474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,759,883 - 49,859,651 (+) Ensembl Rnor_6.0 Ensembl 6 52,459,962 - 52,558,412 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000013842 ⟹ ENSRNOP00000013842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,759,883 - 49,982,320 (+) Ensembl Rnor_6.0 Ensembl 6 52,663,112 - 52,672,582 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000014054 ⟹ ENSRNOP00000014054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,922,746 - 49,974,568 (+) Ensembl Rnor_6.0 Ensembl 6 52,631,092 - 52,675,574 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000073277 ⟹ ENSRNOP00000066241
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 52,459,946 - 52,557,466 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,921,881 - 49,982,320 (+) Ensembl Rnor_6.0 Ensembl 6 52,608,416 - 52,672,653 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076777
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 52,460,058 - 52,631,300 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094865 ⟹ ENSRNOP00000083799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,759,883 - 49,982,320 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097180 ⟹ ENSRNOP00000083183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 49,759,894 - 49,982,320 (+) Ensembl
RefSeq Acc Id:
NM_001427851 ⟹ NP_001414780
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,319 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_006240013 ⟹ XP_006240075
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,646,598 - 55,702,001 (+) NCBI mRatBN7.2 6 49,917,221 - 49,974,573 (+) NCBI Rnor_6.0 6 52,618,775 - 52,675,499 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
CTTTATTATTTTATTTTTTTCCTTTGATTTAGTTTCTTGTGTTTCTGTCAATTATAGTGAAATTCACAAGAAAGAATATTGGCCCTGTGACTGTGCAATCATGTTGAGGGGTCGGCCAGAACTCAGTA
hide sequence
RefSeq Acc Id:
XM_006240014 ⟹ XP_006240076
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,637,626 - 55,702,001 (+) NCBI mRatBN7.2 6 49,910,201 - 49,974,573 (+) NCBI Rnor_6.0 6 52,607,261 - 52,675,499 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
AGATAGATAGATAGGGAGATAGGGAGATAGATGGATAGATAATACAGAAGGTTAAAGTCCTCCT
hide sequence
RefSeq Acc Id:
XM_006240015 ⟹ XP_006240077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,702,001 (+) NCBI mRatBN7.2 6 49,759,882 - 49,974,573 (+) NCBI Rnor_6.0 6 52,459,931 - 52,675,499 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
CCTCTTCTGCCGCCCTCCTCCCCCTCTCAGAACACTCAATGTCGGAACGTTCCGAAGATGACGT
hide sequence
RefSeq Acc Id:
XM_006240016 ⟹ XP_006240078
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,923 - 49,982,323 (+) NCBI Rnor_6.0 6 52,459,931 - 52,680,552 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
CCTCTTCTGCCGCCCTCCTCCCCCTCTCAGAACACTCAATGTCGGAACGTTCCGAAGATGACGT
hide sequence
RefSeq Acc Id:
XM_006240017 ⟹ XP_006240079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,672,145 - 55,702,001 (+) NCBI mRatBN7.2 6 49,944,715 - 49,974,573 (+) NCBI Rnor_6.0 6 52,642,594 - 52,675,499 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
ACATCACTGGGCAGGGAGGGGAATCTGCTTGATGCCAAGAGAACCATTTTTCTTAAAGCCAGAA
hide sequence
RefSeq Acc Id:
XM_006240018 ⟹ XP_006240080
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,672,145 - 55,702,001 (+) NCBI mRatBN7.2 6 49,944,715 - 49,974,573 (+) NCBI Rnor_6.0 6 52,642,594 - 52,675,499 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
ACATCACTGGGCAGGGAGGGGAATCTGCTTGATGCCAAGAGAACCATTTTTCTTAAAGCCAGAAGACCTGCCTTGGTCTAGAAAGATCAATTCAGACAGGCCAAGCACACAGGAAGAAGACATGGGGA
hide sequence
RefSeq Acc Id:
XM_006240019 ⟹ XP_006240081
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,587,085 (+) NCBI mRatBN7.2 6 49,759,885 - 49,859,656 (+) NCBI Rnor_6.0 6 52,459,937 - 52,558,407 (+) NCBI Rnor_5.0 6 62,083,357 - 62,302,011 (+) NCBI
Sequence:
CTGCCGCCCTCCTCCCCCTCTCAGAACACTCAATGTCGGAACGTTCCGAAGATGACGTCGGAGC
hide sequence
RefSeq Acc Id:
XM_008764632 ⟹ XP_008762854
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,879 - 49,982,323 (+) NCBI Rnor_6.0 6 52,459,930 - 52,680,552 (+) NCBI
Sequence:
GCCTCTTCTGCCGCCCTCCTCCCCCTCTCAGAACACTCAATGTCGGAACGTTCCGAAGATGACG
hide sequence
RefSeq Acc Id:
XM_008764634 ⟹ XP_008762856
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,923 - 49,982,323 (+) NCBI Rnor_6.0 6 52,459,988 - 52,680,552 (+) NCBI
Sequence:
ATGACGTCGGAGCGTTCTCGAATCCCGTGTCTCTCGGCTGCTGCTGCCGAAGGAACAGGGAAAAAGCAACAAGAAGGAACAGCAATGGCGACACTGCACCGCAAAGTGCCCAGTCCGGAGGCGTTTCT
hide sequence
RefSeq Acc Id:
XM_039113161 ⟹ XP_038969089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,702,001 (+) NCBI mRatBN7.2 6 49,759,878 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_039113162 ⟹ XP_038969090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,878 - 49,982,323 (+) NCBI
RefSeq Acc Id:
XM_039113164 ⟹ XP_038969092
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,878 - 49,982,323 (+) NCBI
RefSeq Acc Id:
XM_039113165 ⟹ XP_038969093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,319 - 55,702,001 (+) NCBI mRatBN7.2 6 49,759,876 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_039113166 ⟹ XP_038969094
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,488,149 - 55,702,001 (+) NCBI mRatBN7.2 6 49,773,882 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_039113167 ⟹ XP_038969095
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,702,001 (+) NCBI mRatBN7.2 6 49,759,881 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_039113168 ⟹ XP_038969096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,646,598 - 55,702,001 (+) NCBI mRatBN7.2 6 49,917,222 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_039113169 ⟹ XP_038969097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,677,467 - 55,702,001 (+) NCBI mRatBN7.2 6 49,950,049 - 49,974,573 (+) NCBI
RefSeq Acc Id:
XM_063262078 ⟹ XP_063118148
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,533,852 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262079 ⟹ XP_063118149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,533,852 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262081 ⟹ XP_063118151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,472 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262082 ⟹ XP_063118152
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI
RefSeq Acc Id:
XM_063262083 ⟹ XP_063118153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,669 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262084 ⟹ XP_063118154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,449 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262085 ⟹ XP_063118155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,637,626 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262086 ⟹ XP_063118156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,711 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262087 ⟹ XP_063118157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,322 - 55,709,751 (+) NCBI
RefSeq Acc Id:
XM_063262088 ⟹ XP_063118158
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,464 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262089 ⟹ XP_063118159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,637,630 - 55,702,001 (+) NCBI
RefSeq Acc Id:
XM_063262090 ⟹ XP_063118160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,649,713 - 55,709,751 (+) NCBI
RefSeq Acc Id:
XM_063262091 ⟹ XP_063118161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,637,626 - 55,709,751 (+) NCBI
RefSeq Acc Id:
XM_063262092 ⟹ XP_063118162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,705,006 (+) NCBI
RefSeq Acc Id:
XR_005505854
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,879 - 49,982,323 (+) NCBI
RefSeq Acc Id:
XR_005505855
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 55,487,309 - 55,709,751 (+) NCBI mRatBN7.2 6 49,759,879 - 49,982,323 (+) NCBI
RefSeq Acc Id:
XP_006240081 ⟸ XM_006240019
- Peptide Label:
isoform X24
- UniProtKB:
D3ZTM4 (UniProtKB/TrEMBL), B2GV59 (UniProtKB/TrEMBL)
- Sequence:
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCGRKQDSKRNA
hide sequence
RefSeq Acc Id:
XP_006240078 ⟸ XM_006240016
- Peptide Label:
isoform X14
- UniProtKB:
A0A8I6G9H2 (UniProtKB/TrEMBL)
- Sequence:
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDL
hide sequence
RefSeq Acc Id:
XP_006240077 ⟸ XM_006240015
- Peptide Label:
isoform X12
- Sequence:
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDL
hide sequence
RefSeq Acc Id:
XP_006240076 ⟸ XM_006240014
- Peptide Label:
isoform X11
- Sequence:
MCRPSPSPAASPASNLRTSLAQAKTKACVSGHNAVSSTSKPFKTPKDNLLTSSSTQHTVFSAKG
hide sequence
RefSeq Acc Id:
XP_006240075 ⟸ XM_006240013
- Peptide Label:
isoform X11
- Sequence:
MCRPSPSPAASPASNLRTSLAQAKTKACVSGHNAVSSTSKPFKTPKDNLLTSSSTQHTVFSAKG
hide sequence
RefSeq Acc Id:
XP_006240079 ⟸ XM_006240017
- Peptide Label:
isoform X19
- Sequence:
MNSTTTTAATSSSSSAVSTPPLIKPTLMSKSVPPSPEKTLNGKGTLSATIDKKHPNGTKNSNKP
hide sequence
RefSeq Acc Id:
XP_006240080 ⟸ XM_006240018
- Peptide Label:
isoform X19
- Sequence:
MNSTTTTAATSSSSSAVSTPPLIKPTLMSKSVPPSPEKTLNGKGTLSATIDKKHPNGTKNSNKP
hide sequence
RefSeq Acc Id:
XP_008762854 ⟸ XM_008764632
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZWG0 (UniProtKB/TrEMBL)
- Sequence:
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDL
hide sequence
RefSeq Acc Id:
XP_008762856 ⟸ XM_008764634
- Peptide Label:
isoform X15
- Sequence:
MTSERSRIPCLSAAAAEGTGKKQQEGTAMATLHRKVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKEDMHLFGHYPAHDDFYLVVCSACNQVVKPQVFQSHCERRHSSMCRP
hide sequence
Ensembl Acc Id:
ENSRNOP00000066241 ⟸ ENSRNOT00000073277
Ensembl Acc Id:
ENSRNOP00000014054 ⟸ ENSRNOT00000014054
Ensembl Acc Id:
ENSRNOP00000013474 ⟸ ENSRNOT00000013474
Ensembl Acc Id:
ENSRNOP00000013842 ⟸ ENSRNOT00000013842
RefSeq Acc Id:
XP_038969093 ⟸ XM_039113165
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038969090 ⟸ XM_039113162
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038969092 ⟸ XM_039113164
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038969089 ⟸ XM_039113161
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038969095 ⟸ XM_039113167
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038969094 ⟸ XM_039113166
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038969096 ⟸ XM_039113168
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_038969097 ⟸ XM_039113169
- Peptide Label:
isoform X22
Ensembl Acc Id:
ENSRNOP00000083183 ⟸ ENSRNOT00000097180
Ensembl Acc Id:
ENSRNOP00000083799 ⟸ ENSRNOT00000094865
RefSeq Acc Id:
XP_063118152 ⟸ XM_063262082
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_063118162 ⟸ XM_063262092
- Peptide Label:
isoform X23
RefSeq Acc Id:
NP_001414780 ⟸ NM_001427851
RefSeq Acc Id:
XP_063118157 ⟸ XM_063262087
- Peptide Label:
isoform X17
RefSeq Acc Id:
XP_063118148 ⟸ XM_063262078
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063118149 ⟸ XM_063262079
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063118161 ⟸ XM_063262091
- Peptide Label:
isoform X21
RefSeq Acc Id:
XP_063118155 ⟸ XM_063262085
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063118159 ⟸ XM_063262089
- Peptide Label:
isoform X20
- UniProtKB:
F1M9V0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118154 ⟸ XM_063262084
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_063118158 ⟸ XM_063262088
- Peptide Label:
isoform X18
RefSeq Acc Id:
XP_063118151 ⟸ XM_063262081
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063118153 ⟸ XM_063262083
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063118156 ⟸ XM_063262086
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063118160 ⟸ XM_063262090
- Peptide Label:
isoform X21
RGD ID: 13694558 Promoter ID: EPDNEW_R5075 Type: initiation region Name: Atxn7l1_1 Description: ataxin 7-like 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 52,460,055 - 52,460,115 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-09-29
Atxn7l1
ataxin 7-like 1
Atxn7l4
ataxin 7-like 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Atxn7l4
ataxin 7-like 4
Atxn7l4_predicted
ataxin 7-like 4 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Atxn7l4_predicted
ataxin 7-like 4 (predicted)
RGD1305730_predicted
similar to hypothetical protein MGC33190 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1305730_predicted
similar to hypothetical protein MGC33190 (predicted)
LOC362726_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC362726_predicted
similar to hypothetical protein MGC33190 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
