Symbol:
Ush1c
Name:
USH1 protein network component harmonin
RGD ID:
1303329
Description:
Predicted to enable spectrin binding activity. Predicted to be involved in several processes, including G2/M transition of mitotic cell cycle; neuron development; and photoreceptor cell maintenance. Predicted to act upstream of or within inner ear development; neuromuscular process controlling balance; and parallel actin filament bundle assembly. Located in photoreceptor inner segment; photoreceptor outer segment; and stereocilium. Human ortholog(s) of this gene implicated in Usher syndrome; Usher syndrome type 1; Usher syndrome type 1C; and autosomal recessive nonsyndromic deafness 18A. Orthologous to human USH1C (USH1 protein network component harmonin); PARTICIPATES IN auditory mechanotransduction pathway; retinitis pigmentosa pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
harmonin; harmonin a1; MGC112571; Usher syndrome 1C; Usher syndrome 1C homolog; Usher syndrome 1C homolog (human)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,831,719 - 105,880,082 (-) NCBI GRCr8 mRatBN7.2 1 96,695,303 - 96,743,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,695,307 - 96,743,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 102,081,448 - 102,129,809 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 110,553,421 - 110,601,783 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,843,796 - 103,892,162 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 102,207,096 - 102,256,779 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 102,207,096 - 102,255,459 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 103,291,318 - 103,340,928 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,720,185 - 96,768,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,798,295 - 96,846,661 (-) NCBI Celera 1 90,943,948 - 90,992,307 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ush1c Rat 1,2-dimethylhydrazine decreases expression ISO Ush1c (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USH1C mRNA CTD PMID:22206623 Ush1c Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of USH1C protein CTD PMID:32145629 Ush1c Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ush1c (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ush1c Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ush1c (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ush1c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of USH1C mRNA CTD PMID:22298810 Ush1c Rat 4,4'-sulfonyldiphenol affects methylation ISO Ush1c (Mus musculus) 6480464 bisphenol S affects the methylation of USH1C gene CTD PMID:31683443 Ush1c Rat 4-hydroxyphenyl retinamide increases expression ISO Ush1c (Mus musculus) 6480464 Fenretinide results in increased expression of USH1C mRNA CTD PMID:28973697 Ush1c Rat 6-propyl-2-thiouracil multiple interactions ISO Ush1c (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of USH1C mRNA CTD PMID:36706583 Ush1c Rat actinomycin D multiple interactions ISO USH1C (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of USH1C mRNA CTD PMID:38460933 Ush1c Rat aflatoxin B1 affects methylation ISO USH1C (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of USH1C intron CTD PMID:30157460 Ush1c Rat Aflatoxin B2 alpha increases methylation ISO USH1C (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of USH1C intron CTD PMID:30157460 Ush1c Rat benzo[a]pyrene affects methylation ISO USH1C (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USH1C intron and Benzo(a)pyrene affects the methylation of USH1C promoter CTD PMID:27901495 and PMID:30157460 Ush1c Rat benzo[a]pyrene increases methylation ISO USH1C (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of USH1C exon CTD PMID:27901495 Ush1c Rat benzo[e]pyrene increases methylation ISO USH1C (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of USH1C intron CTD PMID:30157460 Ush1c Rat bisphenol A decreases expression ISO Ush1c (Mus musculus) 6480464 bisphenol A results in decreased expression of USH1C mRNA CTD PMID:26063408 Ush1c Rat bisphenol A decreases methylation ISO USH1C (Homo sapiens) 6480464 bisphenol A results in decreased methylation of USH1C gene CTD PMID:31601247 Ush1c Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USH1C protein CTD PMID:32145629 Ush1c Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of USH1C gene CTD PMID:28505145 Ush1c Rat bisphenol A increases expression ISO Ush1c (Mus musculus) 6480464 bisphenol A results in increased expression of USH1C mRNA CTD PMID:25594700 Ush1c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USH1C mRNA CTD PMID:25181051 Ush1c Rat cadmium atom multiple interactions ISO USH1C (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of USH1C mRNA CTD PMID:35301059 Ush1c Rat cadmium dichloride multiple interactions ISO USH1C (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of USH1C mRNA CTD PMID:35301059 Ush1c Rat CGP 52608 multiple interactions ISO USH1C (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USH1C gene] CTD PMID:28238834 Ush1c Rat chromium(6+) affects expression ISO Ush1c (Mus musculus) 6480464 chromium hexavalent ion affects the expression of USH1C mRNA CTD PMID:28472532 Ush1c Rat cisplatin multiple interactions ISO USH1C (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of USH1C mRNA CTD PMID:27392435 Ush1c Rat cisplatin increases expression ISO USH1C (Homo sapiens) 6480464 Cisplatin results in increased expression of USH1C mRNA CTD PMID:27392435 Ush1c Rat cobalt dichloride decreases expression ISO USH1C (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of USH1C mRNA CTD PMID:19376846 Ush1c Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of USH1C mRNA CTD PMID:26577399 Ush1c Rat dicrotophos increases expression ISO USH1C (Homo sapiens) 6480464 dicrotophos results in increased expression of USH1C mRNA CTD PMID:28302478 Ush1c Rat diiodine multiple interactions ISO Ush1c (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of USH1C mRNA CTD PMID:36706583 Ush1c Rat entinostat increases expression ISO USH1C (Homo sapiens) 6480464 entinostat results in increased expression of USH1C mRNA CTD PMID:27188386 Ush1c Rat furan increases expression EXP 6480464 furan results in increased expression of USH1C mRNA CTD PMID:27387713 Ush1c Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of USH1C mRNA CTD PMID:38314887 Ush1c Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of USH1C mRNA CTD PMID:21396975 Ush1c Rat lipopolysaccharide multiple interactions ISO USH1C (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of USH1C mRNA CTD PMID:35811015 Ush1c Rat menadione affects expression ISO USH1C (Homo sapiens) 6480464 Vitamin K 3 affects the expression of USH1C mRNA CTD PMID:20044591 Ush1c Rat methamphetamine increases expression ISO Ush1c (Mus musculus) 6480464 Methamphetamine results in increased expression of USH1C mRNA CTD PMID:26307267 Ush1c Rat methapyrilene increases methylation ISO USH1C (Homo sapiens) 6480464 Methapyrilene results in increased methylation of USH1C intron CTD PMID:30157460 Ush1c Rat methotrexate affects response to substance ISO USH1C (Homo sapiens) 6480464 USH1C protein affects the susceptibility to Methotrexate CTD PMID:16217747 Ush1c Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of USH1C gene CTD PMID:35440735 Ush1c Rat mono(2-ethylhexyl) phthalate increases expression ISO Ush1c (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of USH1C mRNA CTD PMID:22401849 Ush1c Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of USH1C mRNA CTD PMID:21515302 Ush1c Rat Nutlin-3 multiple interactions ISO USH1C (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of USH1C mRNA CTD PMID:38460933 Ush1c Rat PCB138 multiple interactions ISO Ush1c (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ush1c Rat potassium dichromate decreases expression ISO Ush1c (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of USH1C mRNA CTD PMID:23608068 Ush1c Rat rotenone increases expression ISO USH1C (Homo sapiens) 6480464 Rotenone results in increased expression of USH1C mRNA CTD PMID:29955902 Ush1c Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO USH1C (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of USH1C mRNA CTD PMID:35811015 Ush1c Rat silicon dioxide decreases expression ISO USH1C (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of USH1C mRNA CTD PMID:25895662 Ush1c Rat silver atom increases expression ISO Ush1c (Mus musculus) 6480464 Silver results in increased expression of USH1C mRNA CTD PMID:27131904 Ush1c Rat silver(0) increases expression ISO Ush1c (Mus musculus) 6480464 Silver results in increased expression of USH1C mRNA CTD PMID:27131904 Ush1c Rat sodium arsenite affects methylation ISO USH1C (Homo sapiens) 6480464 sodium arsenite affects the methylation of USH1C gene CTD PMID:28589171 Ush1c Rat sodium arsenite decreases expression ISO Ush1c (Mus musculus) 6480464 sodium arsenite results in decreased expression of USH1C mRNA CTD PMID:36209798 and PMID:37682722 Ush1c Rat sulforaphane decreases expression ISO USH1C (Homo sapiens) 6480464 sulforaphane results in decreased expression of USH1C mRNA CTD PMID:31838189 Ush1c Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of USH1C mRNA CTD PMID:21515302 Ush1c Rat trichostatin A increases expression ISO USH1C (Homo sapiens) 6480464 trichostatin A results in increased expression of USH1C mRNA CTD PMID:28542535 Ush1c Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of USH1C mRNA CTD PMID:21515302 Ush1c Rat valproic acid increases expression ISO USH1C (Homo sapiens) 6480464 Valproic Acid results in increased expression of USH1C mRNA CTD PMID:29154799 Ush1c Rat valproic acid affects expression ISO USH1C (Homo sapiens) 6480464 Valproic Acid affects the expression of USH1C mRNA CTD PMID:25979313 Ush1c Rat zinc atom decreases expression ISO USH1C (Homo sapiens) 6480464 Zinc results in decreased expression of USH1C mRNA CTD PMID:15984569 Ush1c Rat zinc(0) decreases expression ISO USH1C (Homo sapiens) 6480464 Zinc results in decreased expression of USH1C mRNA CTD PMID:15984569
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) Cuprizon (EXP) dicrotophos (ISO) diiodine (ISO) entinostat (ISO) furan (EXP) glyphosate (EXP) indole-3-methanol (EXP) lipopolysaccharide (ISO) menadione (ISO) methamphetamine (ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) Nutlin-3 (ISO) PCB138 (ISO) potassium dichromate (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sulforaphane (ISO) Tesaglitazar (EXP) trichostatin A (ISO) troglitazone (EXP) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Deafblindness in French Canadians from Quebec: a predominant founder mutation in the USH1C gene provides the first genetic link with the Acadian population.
Ebermann I, etal., Genome Biol. 2007;8(4):R47.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Mechanotransduction by hair cells: models, molecules, and mechanisms.
Gillespie PG and Muller U, Cell. 2009 Oct 2;139(1):33-44. doi: 10.1016/j.cell.2009.09.010.
4.
Mouse models of USH1C and DFNB18: phenotypic and molecular analyses of two new spontaneous mutations of the Ush1c gene.
Johnson KR, etal., Hum Mol Genet. 2003 Dec 1;12(23):3075-86. Epub 2003 Sep 30.
5.
Sensing sound: molecules that orchestrate mechanotransduction by hair cells.
Kazmierczak P and Muller U, Trends Neurosci. 2012 Apr;35(4):220-9. doi: 10.1016/j.tins.2011.10.007. Epub 2011 Dec 15.
6.
Exome sequencing identifies a founder frameshift mutation in an alternative exon of USH1C as the cause of autosomal recessive retinitis pigmentosa with late-onset hearing loss.
Khateb S, etal., PLoS One. 2012;7(12):e51566. doi: 10.1371/journal.pone.0051566. Epub 2012 Dec 12.
7.
Deafness and retinal degeneration in a novel USH1C knock-in mouse model.
Lentz JJ, etal., Dev Neurobiol. 2010 Mar;70(4):253-67. doi: 10.1002/dneu.20771.
8.
Rescue of hearing and vestibular function by antisense oligonucleotides in a mouse model of human deafness.
Lentz JJ, etal., Nat Med. 2013 Mar;19(3):345-50. doi: 10.1038/nm.3106. Epub 2013 Feb 4.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
Mutations in the alternatively spliced exons of USH1C cause non-syndromic recessive deafness.
Ouyang XM, etal., Hum Genet. 2002 Jul;111(1):26-30. Epub 2002 Jun 18.
12.
The giant spectrin betaV couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
Papal S, etal., Hum Mol Genet. 2013 Sep 15;22(18):3773-88. doi: 10.1093/hmg/ddt228. Epub 2013 May 23.
13.
Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2.
Reiners J, etal., Hum Mol Genet. 2005 Dec 15;14(24):3933-43. Epub 2005 Nov 21.
14.
Differential distribution of harmonin isoforms and their possible role in Usher-1 protein complexes in mammalian photoreceptor cells.
Reiners J, etal., Invest Ophthalmol Vis Sci 2003 Nov;44(11):5006-15.
15.
GOA pipeline
RGD automated data pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Mutations in the USH1C gene associated with sector retinitis pigmentosa and hearing loss.
Saihan Z, etal., Retina. 2011 Sep;31(8):1708-16. doi: 10.1097/IAE.0b013e31820d3fd1.
19.
Ush1c gene expression levels in the ear and eye suggest different roles for Ush1c in neurosensory organs in a new Ush1c knockout mouse.
Tian C, etal., Brain Res. 2010 Apr 30;1328:57-70. doi: 10.1016/j.brainres.2010.02.079. Epub 2010 Mar 6.
20.
A defect in harmonin, a PDZ domain-containing protein expressed in the inner ear sensory hair cells, underlies Usher syndrome type 1C.
Verpy E, etal., Nat Genet. 2000 Sep;26(1):51-5.
21.
Photoreceptor degeneration: genetic and mechanistic dissection of a complex trait.
Wright AF, etal., Nat Rev Genet. 2010 Apr;11(4):273-84. doi: 10.1038/nrg2717.
22.
Identification of three novel mutations in the USH1C gene and detection of thirty-one polymorphisms used for haplotype analysis.
Zwaenepoel I, etal., Hum Mutat. 2001;17(1):34-41.
Ush1c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 105,831,719 - 105,880,082 (-) NCBI GRCr8 mRatBN7.2 1 96,695,303 - 96,743,671 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 96,695,307 - 96,743,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 102,081,448 - 102,129,809 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 110,553,421 - 110,601,783 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 103,843,796 - 103,892,162 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 102,207,096 - 102,256,779 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 102,207,096 - 102,255,459 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 103,291,318 - 103,340,928 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 96,720,185 - 96,768,550 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 96,798,295 - 96,846,661 (-) NCBI Celera 1 90,943,948 - 90,992,307 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
USH1C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 17,493,900 - 17,544,416 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 17,493,895 - 17,544,416 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 17,515,447 - 17,565,963 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 17,472,018 - 17,522,539 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 17,645,289 - 17,695,946 (-) NCBI Celera Cytogenetic Map 11 p15.1 NCBI HuRef 11 17,199,243 - 17,249,828 (-) NCBI HuRef CHM1_1 11 17,515,265 - 17,565,784 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 17,591,495 - 17,642,149 (-) NCBI T2T-CHM13v2.0
Ush1c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 45,844,774 - 45,887,984 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 45,844,774 - 45,887,927 (-) Ensembl GRCm39 Ensembl GRCm38 7 46,195,350 - 46,238,490 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 46,195,350 - 46,238,503 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 53,450,721 - 53,493,860 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 46,063,399 - 46,106,532 (-) NCBI MGSCv36 mm8 Celera 7 41,668,925 - 41,712,073 (-) NCBI Celera Cytogenetic Map 7 B3 NCBI cM Map 7 29.66 NCBI
Ush1c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 32,298,759 - 32,351,505 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 32,303,045 - 32,351,401 (-) NCBI ChiLan1.0 ChiLan1.0
USH1C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 19,827,448 - 19,877,874 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 19,787,920 - 19,838,443 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 17,548,501 - 17,598,923 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 17,233,854 - 17,284,256 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 17,233,854 - 17,284,256 (-) Ensembl panpan1.1 panPan2
USH1C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 40,055,786 - 40,100,685 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 40,055,730 - 40,101,430 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 39,555,651 - 39,600,543 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 41,161,015 - 41,205,900 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 41,160,539 - 41,205,845 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 40,173,714 - 40,218,550 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 40,380,893 - 40,425,786 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 40,719,734 - 40,764,634 (-) NCBI UU_Cfam_GSD_1.0
Ush1c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 45,513,303 - 45,560,765 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 1,552,289 - 1,594,801 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 1,552,175 - 1,594,740 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USH1C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 41,593,802 - 41,647,247 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 41,593,793 - 41,646,777 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 44,613,841 - 44,706,204 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USH1C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 47,428,181 - 47,477,578 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 47,437,596 - 47,477,834 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 144,848,688 - 144,898,245 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ush1c
.
Predicted Target Of
Count of predictions: 159 Count of miRNA genes: 115 Interacting mature miRNAs: 123 Transcripts: ENSRNOT00000067392 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH132432
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 96,695,430 - 96,695,611 (+) MAPPER mRatBN7.2 Rnor_6.0 1 102,207,224 - 102,207,404 NCBI Rnor6.0 Rnor_5.0 1 103,291,446 - 103,291,626 UniSTS Rnor5.0 RGSC_v3.4 1 96,720,309 - 96,720,489 UniSTS RGSC3.4 Celera 1 90,944,072 - 90,944,252 UniSTS RH 3.4 Map 1 907.8 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
11
77
68
63
36
25
36
6
157
59
57
45
60
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067392 ⟹ ENSRNOP00000061783
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,695,307 - 96,743,671 (-) Ensembl Rnor_6.0 Ensembl 1 102,207,096 - 102,255,459 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100210 ⟹ ENSRNOP00000080627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,695,619 - 96,743,671 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103742 ⟹ ENSRNOP00000077287
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,695,307 - 96,743,671 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000120175 ⟹ ENSRNOP00000086685
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 96,697,168 - 96,731,071 (-) Ensembl
RefSeq Acc Id:
NM_212521 ⟹ NP_997686
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,831,723 - 105,880,082 (-) NCBI mRatBN7.2 1 96,695,307 - 96,743,671 (-) NCBI Rnor_6.0 1 102,207,100 - 102,255,459 (-) NCBI Rnor_5.0 1 103,291,318 - 103,340,928 (-) NCBI RGSC_v3.4 1 96,720,185 - 96,768,550 (-) RGD Celera 1 90,943,948 - 90,992,307 (-) RGD
Sequence:
CTCTAACTCTGAAGGAGGCAAGTCCTGTCTTGGTGGCTGACCTGCCGCCGCCTGAGCACCGCAGCCAGGCACCCTAAGAAGCAGACCGAGCTGCAAAGCAACTGGATCAGGCTCAGTCATGGACCGGA
hide sequence
RefSeq Acc Id:
XM_006229222 ⟹ XP_006229284
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 105,831,719 - 105,880,072 (-) NCBI mRatBN7.2 1 96,695,303 - 96,743,650 (-) NCBI Rnor_6.0 1 102,207,096 - 102,256,779 (-) NCBI Rnor_5.0 1 103,291,318 - 103,340,928 (-) NCBI
Sequence:
AAACCTAGGCCTGTGGGGATTATCTCGAGTACTAATTTATTCAGAAGGCAGTGAAGGACAGAGGCTGGGCTATAGCCGGCTCCCAACTTATGGAAAGCCCATGGCAGACGCACCATCCCTCGACAGGT
hide sequence
RefSeq Acc Id:
NP_997686 ⟸ NM_212521
- UniProtKB:
Q4KMB9 (UniProtKB/TrEMBL), A6JBB6 (UniProtKB/TrEMBL), Q6PPF3 (UniProtKB/TrEMBL), F7FHE4 (UniProtKB/TrEMBL)
- Sequence:
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPNRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKGGQADSVGL
hide sequence
RefSeq Acc Id:
XP_006229284 ⟸ XM_006229222
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZR66 (UniProtKB/TrEMBL)
- Sequence:
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPNRLPLFDAIRP
hide sequence
Ensembl Acc Id:
ENSRNOP00000061783 ⟸ ENSRNOT00000067392
Ensembl Acc Id:
ENSRNOP00000080627 ⟸ ENSRNOT00000100210
Ensembl Acc Id:
ENSRNOP00000077287 ⟸ ENSRNOT00000103742
Ensembl Acc Id:
ENSRNOP00000086685 ⟸ ENSRNOT00000120175
RGD ID: 13690060 Promoter ID: EPDNEW_R585 Type: initiation region Name: Ush1c_1 Description: USH1 protein network component harmonin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 102,255,431 - 102,255,491 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-24
Ush1c
USH1 protein network component harmonin
Ush1c
Usher syndrome 1C
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-03-27
Ush1c
Usher syndrome 1C
Ush1c
Usher syndrome 1C homolog (human)
Name changed
629549 APPROVED
2005-11-17
Ush1c
Usher syndrome 1C homolog (human)
Name updated
1299863 APPROVED
2005-02-14
Ush1c
harmonin a1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
mutation of the human homolog causes Usher syndrome type 1C, which is characterized by congenital deafness and prepubertal-onset retinitis pigmentosa
1303964
