Symbol:
Ppp1r1b
Name:
protein phosphatase 1, regulatory inhibitor subunit 1B
RGD ID:
736949
MGI Page
MGI
Description:
Predicted to enable dopamine receptor binding activity and protein phosphatase inhibitor activity. Acts upstream of or within several processes, including negative regulation of female receptivity; response to cocaine; and visual learning. Located in cytoplasm; neuronal cell body; and nucleus. Is expressed in central nervous system; limb mesenchyme; nucleus pulposus; retina; and ureteric tip. Human ortholog(s) of this gene implicated in bipolar disorder and schizophrenia. Orthologous to human PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
AU040756; Dar; DARP; DARPP-32; Darpp32; dopamine- and cAMP-regulated neuronal phosphoprotein; protein phosphatase 1 regulatory subunit 1B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ppp1r1b (protein phosphatase 1, regulatory (inhibitor) subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp1r1b (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp1r1b (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp1r1b (protein phosphatase 1 regulatory inhibitor subunit 1B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ppp1r1b (protein phosphatase 1, regulatory (inhibitor) subunit 1B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp1r1b (protein phosphatase 1, regulatory (inhibitor) subunit 1B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 98,239,232 - 98,248,622 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 98,239,230 - 98,248,622 (+) Ensembl GRCm39 Ensembl GRCm38 11 98,348,406 - 98,357,796 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 98,348,404 - 98,357,796 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 98,210,052 - 98,219,109 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 98,164,828 - 98,173,885 (+) NCBI MGSCv36 mm8 Celera 11 108,003,018 - 108,012,075 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 61.75 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp1r1b Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PPP1R1B mRNA CTD PMID:36331819 Ppp1r1b Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of PPP1R1B mRNA CTD PMID:28189721 and PMID:28960355 Ppp1r1b Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of PPP1R1B mRNA CTD PMID:22206623 Ppp1r1b Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PPP1R1B mRNA CTD PMID:17942748 Ppp1r1b Mouse 17beta-estradiol increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Estradiol results in increased expression of PPP1R1B mRNA CTD PMID:20068009 Ppp1r1b Mouse 17beta-estradiol increases expression ISO PPP1R1B (Homo sapiens) 6480464 Estradiol results in increased expression of PPP1R1B mRNA CTD PMID:23019147 Ppp1r1b Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ppp1r1b Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ppp1r1b Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PPP1R1B mRNA CTD PMID:18465118 Ppp1r1b Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R1B mRNA CTD PMID:32109520 Ppp1r1b Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1R1B mRNA CTD PMID:26290441 and PMID:33956508 Ppp1r1b Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PPP1R1B mRNA CTD PMID:26377647 Ppp1r1b Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Ppp1r1b Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Ppp1r1b Mouse 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine increases phosphorylation EXP 6480464 4-iodo-2 and 5-dimethoxyphenylisopropylamine results in increased phosphorylation of PPP1R1B protein CTD PMID:11880652 Ppp1r1b Mouse 2-methyl-6-(phenylethynyl)pyridine multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 6-methyl-2-(phenylethynyl)pyridine affects the reaction [Cocaine affects the phosphorylation of PPP1R1B protein] CTD PMID:17680995 Ppp1r1b Mouse 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide increases phosphorylation EXP 6480464 Raclopride results in increased phosphorylation of PPP1R1B protein CTD PMID:12064480 Ppp1r1b Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of PPP1R1B mRNA CTD PMID:30951980 Ppp1r1b Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of PPP1R1B promoter CTD PMID:33297965 Ppp1r1b Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of PPP1R1B mRNA CTD PMID:28973697 Ppp1r1b Mouse 5-fluorouracil increases response to substance ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein results in increased susceptibility to Fluorouracil CTD PMID:17470401 Ppp1r1b Mouse 5-methoxytryptamine decreases phosphorylation EXP 6480464 5-Methoxytryptamine results in decreased phosphorylation of PPP1R1B protein CTD PMID:11880652 Ppp1r1b Mouse 5-methoxytryptamine increases phosphorylation EXP 6480464 5-Methoxytryptamine results in increased phosphorylation of PPP1R1B protein CTD PMID:11880652 Ppp1r1b Mouse 6-propyl-2-thiouracil decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PPP1R1B mRNA CTD PMID:24780913 Ppp1r1b Mouse acrylamide decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Acrylamide results in decreased expression of PPP1R1B mRNA CTD PMID:32763439 Ppp1r1b Mouse aflatoxin B1 increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of PPP1R1B mRNA CTD PMID:23630614 and PMID:25378103 Ppp1r1b Mouse aflatoxin B1 increases methylation ISO PPP1R1B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PPP1R1B promoter CTD PMID:30157460 Ppp1r1b Mouse Aflatoxin B2 alpha increases methylation ISO PPP1R1B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PPP1R1B promoter CTD PMID:30157460 Ppp1r1b Mouse all-trans-retinoic acid increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Tretinoin results in increased expression of PPP1R1B mRNA CTD PMID:16026464 Ppp1r1b Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of PPP1R1B mRNA CTD PMID:33053406 Ppp1r1b Mouse benzo[a]pyrene decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of PPP1R1B mRNA CTD PMID:21839799 Ppp1r1b Mouse benzo[a]pyrene increases methylation ISO PPP1R1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PPP1R1B promoter CTD PMID:27901495 Ppp1r1b Mouse benzo[a]pyrene decreases methylation ISO PPP1R1B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PPP1R1B exon CTD PMID:27901495 Ppp1r1b Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PPP1R1B mRNA CTD PMID:22228805 Ppp1r1b Mouse bis(2-ethylhexyl) phthalate decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PPP1R1B mRNA CTD PMID:31163220 Ppp1r1b Mouse bisphenol A increases expression ISO PPP1R1B (Homo sapiens) 6480464 bisphenol A results in increased expression of PPP1R1B mRNA CTD PMID:23019147 Ppp1r1b Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPP1R1B mRNA CTD PMID:32156529 Ppp1r1b Mouse bisphenol A increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PPP1R1B mRNA CTD PMID:34947998 and PMID:38750585 Ppp1r1b Mouse bisphenol A affects expression ISO Ppp1r1b (Rattus norvegicus) 6480464 bisphenol A affects the expression of PPP1R1B mRNA CTD PMID:25181051 Ppp1r1b Mouse bisphenol AF increases expression ISO PPP1R1B (Homo sapiens) 6480464 bisphenol AF results in increased expression of PPP1R1B protein CTD PMID:34186270 Ppp1r1b Mouse Bisphenol B increases expression ISO PPP1R1B (Homo sapiens) 6480464 bisphenol B results in increased expression of PPP1R1B protein CTD PMID:34186270 Ppp1r1b Mouse bisphenol F decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 4 and 4'-bisphenol F results in decreased expression of PPP1R1B mRNA CTD PMID:26186136 Ppp1r1b Mouse bisphenol F increases expression ISO PPP1R1B (Homo sapiens) 6480464 bisphenol F results in increased expression of PPP1R1B protein CTD PMID:34186270 Ppp1r1b Mouse bisphenol F decreases expression EXP 6480464 bisphenol F results in decreased expression of PPP1R1B mRNA CTD PMID:38685157 Ppp1r1b Mouse Butylparaben multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in decreased expression of PPP1R1B mRNA CTD PMID:34383603 Ppp1r1b Mouse cadmium atom multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of PPP1R1B mRNA CTD PMID:31904401 Ppp1r1b Mouse cadmium dichloride multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of PPP1R1B mRNA CTD PMID:31904401 Ppp1r1b Mouse camptothecin decreases response to substance ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein alternative form results in decreased susceptibility to Camptothecin and PPP1R1B protein results in decreased susceptibility to Camptothecin CTD PMID:16061638 Ppp1r1b Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of PPP1R1B mRNA CTD PMID:25554681 Ppp1r1b Mouse cisplatin increases response to substance ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein results in increased susceptibility to Cisplatin CTD PMID:17470401 Ppp1r1b Mouse clorgyline multiple interactions EXP 6480464 [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] inhibits the reaction [resveratrol promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein]] and [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein] CTD PMID:23499958 Ppp1r1b Mouse clozapine multiple interactions EXP 6480464 Clozapine inhibits the reaction [Serotonin results in decreased phosphorylation of PPP1R1B protein] and Clozapine inhibits the reaction [Serotonin results in increased phosphorylation of PPP1R1B protein] CTD PMID:11880652 Ppp1r1b Mouse clozapine increases phosphorylation EXP 6480464 Clozapine results in increased phosphorylation of PPP1R1B protein CTD PMID:12871586 Ppp1r1b Mouse cobalt dichloride decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of PPP1R1B mRNA CTD PMID:24386269 Ppp1r1b Mouse cocaine multiple interactions EXP 6480464 [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] inhibits the reaction [resveratrol promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein]] more ... CTD PMID:10103106 more ... Ppp1r1b Mouse cocaine increases phosphorylation EXP 6480464 Cocaine results in increased phosphorylation of PPP1R1B protein CTD PMID:15665076 more ... Ppp1r1b Mouse cocaine affects phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 Cocaine affects the phosphorylation of PPP1R1B protein CTD PMID:15287884 and PMID:17680995 Ppp1r1b Mouse cocaine multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 6-methyl-2-(phenylethynyl)pyridine affects the reaction [Cocaine affects the phosphorylation of PPP1R1B protein] more ... CTD PMID:11268215 and PMID:17680995 Ppp1r1b Mouse cocaine increases response to substance EXP 6480464 PPP1R1B gene mutant form results in increased susceptibility to Cocaine and PPP1R1B mutant form results in increased susceptibility to Cocaine CTD PMID:10103106 and PMID:11268215 Ppp1r1b Mouse cocaine affects response to substance EXP 6480464 PPP1R1B affects the susceptibility to Cocaine CTD PMID:20682746 Ppp1r1b Mouse cocaine increases expression EXP 6480464 Cocaine results in increased expression of PPP1R1B protein CTD PMID:16710312 Ppp1r1b Mouse colforsin daropate hydrochloride multiple interactions EXP 6480464 PDE1B protein affects the reaction [Colforsin results in increased phosphorylation of PPP1R1B protein] CTD PMID:12077213 Ppp1r1b Mouse colforsin daropate hydrochloride increases phosphorylation EXP 6480464 Colforsin results in increased phosphorylation of PPP1R1B protein CTD PMID:12077213 Ppp1r1b Mouse corticosterone multiple interactions EXP 6480464 Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Corticosterone] CTD PMID:10516482 Ppp1r1b Mouse corticotropin multiple interactions EXP 6480464 Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Adrenocorticotropic Hormone] CTD PMID:10516482 Ppp1r1b Mouse Cuprizon decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of PPP1R1B mRNA CTD PMID:27523638 Ppp1r1b Mouse Cuprizon affects expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Cuprizone affects the expression of PPP1R1B mRNA CTD PMID:26577399 Ppp1r1b Mouse curcumin multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 Curcumin inhibits the reaction [sodium arsenite results in decreased phosphorylation of PPP1R1B protein] CTD PMID:27966075 Ppp1r1b Mouse cyhalothrin decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 cyhalothrin results in decreased expression of PPP1R1B protein CTD PMID:28495607 Ppp1r1b Mouse DDE multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in decreased expression of PPP1R1B mRNA CTD PMID:34383603 Ppp1r1b Mouse deguelin multiple interactions EXP 6480464 deguelin inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:17209049 Ppp1r1b Mouse dextran sulfate decreases expression EXP 6480464 Dextran Sulfate results in decreased expression of PPP1R1B protein CTD PMID:32272095 Ppp1r1b Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of PPP1R1B protein CTD PMID:35362542 Ppp1r1b Mouse dextran sulfate multiple interactions EXP 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of PPP1R1B protein] and evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of PPP1R1B protein] CTD PMID:32272095 and PMID:35362542 Ppp1r1b Mouse dichloroacetic acid decreases expression EXP 6480464 Dichloroacetic Acid results in decreased expression of PPP1R1B mRNA CTD PMID:28962523 Ppp1r1b Mouse dorsomorphin multiple interactions ISO PPP1R1B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPP1R1B mRNA CTD PMID:27188386 Ppp1r1b Mouse doxorubicin decreases export ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein results in decreased export of Doxorubicin CTD PMID:17470401 Ppp1r1b Mouse doxorubicin increases response to substance ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein results in increased susceptibility to Doxorubicin CTD PMID:17470401 Ppp1r1b Mouse entinostat increases expression ISO PPP1R1B (Homo sapiens) 6480464 entinostat results in increased expression of PPP1R1B mRNA CTD PMID:26272509 Ppp1r1b Mouse entinostat multiple interactions ISO PPP1R1B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPP1R1B mRNA CTD PMID:27188386 Ppp1r1b Mouse enzacamene multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in decreased expression of PPP1R1B mRNA CTD PMID:34383603 Ppp1r1b Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of PPP1R1B mRNA CTD PMID:19167417 Ppp1r1b Mouse ethanol multiple interactions EXP 6480464 Ethanol affects the expression of and affects the splicing of PPP1R1B mRNA CTD PMID:30319688 Ppp1r1b Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of PPP1R1B mRNA CTD PMID:30319688 Ppp1r1b Mouse eticlopride(1+) increases phosphorylation EXP 6480464 eticlopride results in increased phosphorylation of PPP1R1B protein CTD PMID:12871586 Ppp1r1b Mouse Evodiamine multiple interactions EXP 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of PPP1R1B protein] CTD PMID:35362542 Ppp1r1b Mouse fluoxetine affects phosphorylation EXP 6480464 Fluoxetine affects the phosphorylation of PPP1R1B protein CTD PMID:11880651 Ppp1r1b Mouse fluoxetine increases response to substance EXP 6480464 PPP1R1B protein results in increased susceptibility to Fluoxetine CTD PMID:11880651 Ppp1r1b Mouse fluoxetine multiple interactions EXP 6480464 PPP1R1B protein promotes the reaction [Fluoxetine affects the phosphorylation of GRIA1 protein] CTD PMID:11880651 Ppp1r1b Mouse fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of PPP1R1B mRNA and Fluoxetine results in increased expression of PPP1R1B protein CTD PMID:11880651 Ppp1r1b Mouse furan increases expression EXP 6480464 furan results in increased expression of PPP1R1B mRNA CTD PMID:24183702 Ppp1r1b Mouse furan decreases methylation ISO Ppp1r1b (Rattus norvegicus) 6480464 furan results in decreased methylation of PPP1R1B gene CTD PMID:27387713 Ppp1r1b Mouse furan increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 furan results in increased expression of PPP1R1B mRNA CTD PMID:27387713 Ppp1r1b Mouse genistein increases expression ISO PPP1R1B (Homo sapiens) 6480464 Genistein results in increased expression of PPP1R1B mRNA CTD PMID:23019147 Ppp1r1b Mouse gentamycin decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of PPP1R1B mRNA CTD PMID:22061828 Ppp1r1b Mouse glycidol increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 glycidol results in increased expression of PPP1R1B mRNA CTD PMID:24395379 Ppp1r1b Mouse graphite affects expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Graphite affects the expression of PPP1R1B mRNA CTD PMID:29933104 Ppp1r1b Mouse haloperidol increases phosphorylation EXP 6480464 Haloperidol results in increased phosphorylation of PPP1R1B protein CTD PMID:12871586 Ppp1r1b Mouse indole-3-methanol affects expression ISO Ppp1r1b (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of PPP1R1B mRNA CTD PMID:21396975 Ppp1r1b Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PPP1R1B mRNA CTD PMID:36331819 Ppp1r1b Mouse iron atom increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Iron deficiency results in increased expression of PPP1R1B mRNA CTD PMID:16629162 Ppp1r1b Mouse iron(0) increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Iron deficiency results in increased expression of PPP1R1B mRNA CTD PMID:16629162 Ppp1r1b Mouse ketamine increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Ketamine results in increased expression of PPP1R1B mRNA CTD PMID:20080153 Ppp1r1b Mouse ketanserin multiple interactions EXP 6480464 Ketanserin inhibits the reaction [Serotonin results in increased phosphorylation of PPP1R1B protein] CTD PMID:11880652 Ppp1r1b Mouse linuron multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in decreased expression of PPP1R1B mRNA CTD PMID:34383603 Ppp1r1b Mouse LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [BDNF protein results in increased expression of PPP1R1B mRNA] and 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:17209049 Ppp1r1b Mouse manganese atom increases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 Manganese results in increased phosphorylation of PPP1R1B protein CTD PMID:22427945 Ppp1r1b Mouse manganese(0) increases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 Manganese results in increased phosphorylation of PPP1R1B protein CTD PMID:22427945 Ppp1r1b Mouse manganese(II) chloride decreases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 manganese chloride results in decreased phosphorylation of PPP1R1B protein CTD PMID:23385959 Ppp1r1b Mouse methamphetamine multiple interactions EXP 6480464 naloxonazine inhibits the reaction [Methamphetamine results in increased phosphorylation of PPP1R1B protein] CTD PMID:22564758 Ppp1r1b Mouse methamphetamine increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Methamphetamine results in increased expression of PPP1R1B mRNA CTD PMID:28341135 Ppp1r1b Mouse methamphetamine increases phosphorylation EXP 6480464 Methamphetamine results in increased phosphorylation of PPP1R1B protein CTD PMID:22564758 Ppp1r1b Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of PPP1R1B mRNA CTD PMID:18502557 Ppp1r1b Mouse microcystin-LR increases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 cyanoginosin LR results in increased expression of PPP1R1B protein CTD PMID:22430071 Ppp1r1b Mouse morphine affects expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Morphine affects the expression of PPP1R1B protein modified form CTD PMID:15287884 Ppp1r1b Mouse morphine multiple interactions ISO PPP1R1B (Homo sapiens) 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased phosphorylation of PPP1R1B protein] and OPRD1 mutant form inhibits the reaction [Morphine results in increased phosphorylation of PPP1R1B protein] CTD PMID:21600884 Ppp1r1b Mouse morphine multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 ARL6IP5 mutant form inhibits the reaction [Morphine results in increased phosphorylation of PPP1R1B protein] CTD PMID:21600884 Ppp1r1b Mouse morphine increases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 Morphine results in increased phosphorylation of PPP1R1B protein CTD PMID:21600884 Ppp1r1b Mouse nickel atom decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Nickel results in decreased expression of PPP1R1B mRNA CTD PMID:24768652 and PMID:25583101 Ppp1r1b Mouse oxidopamine multiple interactions EXP 6480464 [benserazide and levodopa drug combination co-treated with Oxidopamine] results in increased phosphorylation of PPP1R1B protein CTD PMID:17596448 Ppp1r1b Mouse oxidopamine multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Oxidopamine co-treated with Levodopa] affects the phosphorylation of PPP1R1B protein CTD PMID:17188499 Ppp1r1b Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PPP1R1B mRNA CTD PMID:17562736 Ppp1r1b Mouse paracetamol multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in decreased expression of PPP1R1B mRNA CTD PMID:34383603 Ppp1r1b Mouse paraquat decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Paraquat results in decreased expression of PPP1R1B mRNA CTD PMID:32680482 Ppp1r1b Mouse Pargyline multiple interactions EXP 6480464 [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] inhibits the reaction [resveratrol promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein]] and [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein] CTD PMID:23499958 Ppp1r1b Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Ppp1r1b Mouse perfluorohexanesulfonic acid increases expression EXP 6480464 perfluorohexanesulfonic acid results in increased expression of PPP1R1B mRNA CTD PMID:37995155 Ppp1r1b Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PPP1R1B mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PPP1R1B mRNA CTD PMID:36331819 Ppp1r1b Mouse phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of PPP1R1B mRNA CTD PMID:31904401 Ppp1r1b Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PPP1R1B mRNA CTD PMID:17426115 Ppp1r1b Mouse progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of PPP1R1B mRNA CTD PMID:16966611 and PMID:22238285 Ppp1r1b Mouse quinpirole multiple interactions EXP 6480464 Quinpirole affects the reaction [Serotonin results in decreased phosphorylation of PPP1R1B protein] and Quinpirole affects the reaction [Serotonin results in increased phosphorylation of PPP1R1B protein] CTD PMID:11880652 Ppp1r1b Mouse resveratrol multiple interactions EXP 6480464 [[Clorgyline results in decreased activity of MAOA protein] co-treated with [Pargyline results in decreased activity of MAOB protein]] inhibits the reaction [resveratrol promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein]] and resveratrol promotes the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein] CTD PMID:23499958 Ppp1r1b Mouse roflumilast multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 Roflumilast inhibits the reaction [Rotenone results in decreased phosphorylation of PPP1R1B protein] CTD PMID:36706892 Ppp1r1b Mouse rotenone decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Rotenone results in decreased expression of PPP1R1B mRNA CTD PMID:29955902 Ppp1r1b Mouse rotenone decreases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 Rotenone results in decreased phosphorylation of PPP1R1B protein CTD PMID:36706892 Ppp1r1b Mouse rotenone multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 Roflumilast inhibits the reaction [Rotenone results in decreased phosphorylation of PPP1R1B protein] CTD PMID:36706892 Ppp1r1b Mouse SB 431542 multiple interactions ISO PPP1R1B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPP1R1B mRNA CTD PMID:27188386 Ppp1r1b Mouse serotonin increases phosphorylation EXP 6480464 Serotonin results in increased phosphorylation of PPP1R1B protein CTD PMID:11880652 Ppp1r1b Mouse serotonin decreases phosphorylation EXP 6480464 Serotonin results in decreased phosphorylation of PPP1R1B protein CTD PMID:11880652 Ppp1r1b Mouse serotonin multiple interactions EXP 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:11880652 Ppp1r1b Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of PPP1R1B mRNA CTD PMID:29341224 Ppp1r1b Mouse sirolimus multiple interactions EXP 6480464 Sirolimus inhibits the reaction [BDNF protein results in increased expression of PPP1R1B mRNA] and Sirolimus inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:17209049 Ppp1r1b Mouse sodium arsenite multiple interactions ISO Ppp1r1b (Rattus norvegicus) 6480464 Curcumin inhibits the reaction [sodium arsenite results in decreased phosphorylation of PPP1R1B protein] CTD PMID:27966075 Ppp1r1b Mouse sodium arsenite decreases expression ISO PPP1R1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PPP1R1B mRNA CTD PMID:29301061 Ppp1r1b Mouse sodium arsenite decreases phosphorylation ISO Ppp1r1b (Rattus norvegicus) 6480464 sodium arsenite results in decreased phosphorylation of PPP1R1B protein CTD PMID:27966075 Ppp1r1b Mouse sunitinib decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Sunitinib results in decreased expression of PPP1R1B mRNA CTD PMID:31533062 Ppp1r1b Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of PPP1R1B mRNA CTD PMID:33848595 Ppp1r1b Mouse tetrachloroethene decreases expression EXP 6480464 Tetrachloroethylene results in decreased expression of PPP1R1B mRNA CTD PMID:28973375 Ppp1r1b Mouse thioacetamide decreases expression ISO Ppp1r1b (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of PPP1R1B mRNA CTD PMID:34492290 Ppp1r1b Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of PPP1R1B mRNA CTD PMID:19464567 Ppp1r1b Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PPP1R1B gene and titanium dioxide results in decreased methylation of PPP1R1B promoter CTD PMID:35295148 Ppp1r1b Mouse trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PPP1R1B mRNA CTD PMID:25549359 Ppp1r1b Mouse trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:24204683 Ppp1r1b Mouse trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of PPP1R1B mRNA and trichostatin A results in increased expression of PPP1R1B protein CTD PMID:24204683 Ppp1r1b Mouse triclosan decreases expression ISO PPP1R1B (Homo sapiens) 6480464 Triclosan results in decreased expression of PPP1R1B mRNA CTD PMID:30510588 Ppp1r1b Mouse U-73122 multiple interactions EXP 6480464 1-(6-((3-methoxyestra-1 more ... CTD PMID:11880652 Ppp1r1b Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PPP1R1B mRNA CTD PMID:17292431 Ppp1r1b Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PPP1R1B mRNA and Valproic Acid results in increased expression of PPP1R1B protein CTD PMID:24204683 Ppp1r1b Mouse valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:24204683 Ppp1r1b Mouse vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of PPP1R1B mRNA CTD PMID:18930951 Ppp1r1b Mouse vincristine increases response to substance ISO PPP1R1B (Homo sapiens) 6480464 PPP1R1B protein results in increased susceptibility to Vincristine CTD PMID:17470401 Ppp1r1b Mouse wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [BDNF protein results in increased expression of PPP1R1B protein] CTD PMID:17209049 Ppp1r1b Mouse zoledronic acid decreases expression ISO PPP1R1B (Homo sapiens) 6480464 zoledronic acid results in decreased expression of PPP1R1B mRNA CTD PMID:24714768
(1->4)-beta-D-glucan (EXP) 1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine (EXP) 2-methyl-6-(phenylethynyl)pyridine (ISO) 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 5-fluorouracil (ISO) 5-methoxytryptamine (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Butylparaben (ISO) cadmium atom (EXP) cadmium dichloride (EXP) camptothecin (ISO) carbon nanotube (EXP) cisplatin (ISO) clorgyline (EXP) clozapine (EXP) cobalt dichloride (ISO) cocaine (EXP,ISO) colforsin daropate hydrochloride (EXP) corticosterone (EXP) corticotropin (EXP) Cuprizon (ISO) curcumin (ISO) cyhalothrin (ISO) DDE (ISO) deguelin (EXP) dextran sulfate (EXP) dichloroacetic acid (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) enzacamene (ISO) ethanol (EXP) eticlopride(1+) (EXP) Evodiamine (EXP) fluoxetine (EXP) furan (EXP,ISO) genistein (ISO) gentamycin (ISO) glycidol (ISO) graphite (ISO) haloperidol (EXP) indole-3-methanol (ISO) inulin (EXP) iron atom (ISO) iron(0) (ISO) ketamine (ISO) ketanserin (EXP) linuron (ISO) LY294002 (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (EXP,ISO) methotrexate (EXP) microcystin-LR (ISO) morphine (ISO) nickel atom (ISO) oxidopamine (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) Pargyline (EXP) PCB138 (EXP) perfluorohexanesulfonic acid (EXP) perfluorooctane-1-sulfonic acid (EXP) phorbol 13-acetate 12-myristate (EXP) pirinixic acid (EXP) progesterone (EXP) quinpirole (EXP) resveratrol (EXP) roflumilast (ISO) rotenone (ISO) SB 431542 (ISO) serotonin (EXP) silicon dioxide (EXP) sirolimus (EXP) sodium arsenite (ISO) sunitinib (ISO) testosterone (EXP) tetrachloroethene (EXP) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (EXP) trichostatin A (EXP) triclosan (ISO) U-73122 (EXP) valproic acid (EXP) vancomycin (EXP) vincristine (ISO) wortmannin (EXP) zoledronic acid (ISO)
1.
Neuronal replacement from endogenous precursors in the adult brain after stroke.
Arvidsson A, etal., Nat Med. 2002 Sep;8(9):963-70. doi: 10.1038/nm747. Epub 2002 Aug 5.
2.
The physiology, signaling, and pharmacology of dopamine receptors.
Beaulieu JM and Gainetdinov RR, Pharmacol Rev. 2011 Mar;63(1):182-217. doi: 10.1124/pr.110.002642. Epub 2011 Feb 8.
3.
Sex differences in a transgenic rat model of Huntington's disease: decreased 17beta-estradiol levels correlate with reduced numbers of DARPP32+ neurons in males.
Bode FJ, etal., Hum Mol Genet. 2008 Sep 1;17(17):2595-609. doi: 10.1093/hmg/ddn159. Epub 2008 May 23.
4.
Chronic hyperdopaminergic activity of schizophrenia is associated with increased ¿FosB levels and cdk-5 signaling in the nucleus accumbens.
Cantrup R, etal., Neuroscience. 2012 Oct 11;222:124-35. doi: 10.1016/j.neuroscience.2012.07.027. Epub 2012 Jul 20.
5.
Intrastriatal injection of ionomycin profoundly changes motor response to l-DOPA and its underlying molecular mechanisms.
Han C, etal., Neuroscience. 2017 Jan 6;340:23-33. doi: 10.1016/j.neuroscience.2016.10.033. Epub 2016 Oct 19.
6.
Nanotherapeutic approach for opiate addiction using DARPP-32 gene silencing in an animal model of opiate addiction.
Ignatowski TA, etal., J Neuroimmune Pharmacol. 2015 Mar;10(1):136-52. doi: 10.1007/s11481-015-9585-1. Epub 2015 Jan 22.
7.
DARPP-32 to quantify intracerebral hemorrhage-induced neuronal death in basal ganglia.
Jin H, etal., Transl Stroke Res. 2013 Feb;4(1):130-4. doi: 10.1007/s12975-012-0232-3. Epub 2012 Dec 12.
8.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
9.
Revisiting DARPP-32 in postmortem human brain: changes in schizophrenia and bipolar disorder and genetic associations with t-DARPP-32 expression.
Kunii Y, etal., Mol Psychiatry. 2014 Feb;19(2):192-9. doi: 10.1038/mp.2012.174. Epub 2013 Jan 8.
10.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
11.
MGDs mouse GO annotations
MGD data from the GO Consortium
12.
MGD IEA
MGD IEA
13.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Proteomic analysis of alterations induced by perinatal hypoxic-ischemic brain injury.
Rosenkranz K, etal., J Proteome Res. 2012 Dec 7;11(12):5794-803. doi: 10.1021/pr3005869. Epub 2012 Nov 27.
16.
PPARa modulation of mesolimbic dopamine transmission rescues depression-related behaviors.
Scheggi S, etal., Neuropharmacology. 2016 Nov;110(Pt A):251-259. doi: 10.1016/j.neuropharm.2016.07.024. Epub 2016 Jul 22.
17.
A role for Gsh1 in the developing striatum and olfactory bulb of Gsh2 mutant mice.
Toresson H and Campbell K, Development 2001 Dec;128(23):4769-80.
18.
[Research on expression and function of phosphorylated DARPP-32 on pentylenetetrazol-induced epilepsy model of rat].
Wang W, etal., Sheng Wu Yi Xue Gong Cheng Xue Za Zhi. 2014 Jun;31(3):637-41.
19.
DARPP-32, Jack of All Trades... Master of Which?
Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.
Ppp1r1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 98,239,232 - 98,248,622 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 98,239,230 - 98,248,622 (+) Ensembl GRCm39 Ensembl GRCm38 11 98,348,406 - 98,357,796 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 98,348,404 - 98,357,796 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 98,210,052 - 98,219,109 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 98,164,828 - 98,173,885 (+) NCBI MGSCv36 mm8 Celera 11 108,003,018 - 108,012,075 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 61.75 NCBI
PPP1R1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 39,626,707 - 39,636,624 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 39,626,740 - 39,636,626 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 37,783,205 - 37,792,877 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 35,036,705 - 35,046,404 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 35,038,278 - 35,046,405 NCBI Celera 17 34,442,912 - 34,452,611 (+) NCBI Celera Cytogenetic Map 17 q12 NCBI HuRef 17 33,576,900 - 33,586,601 (+) NCBI HuRef CHM1_1 17 38,019,003 - 38,028,704 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 40,489,777 - 40,500,194 (+) NCBI T2T-CHM13v2.0
Ppp1r1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 83,843,948 - 83,853,063 (+) NCBI GRCr8 mRatBN7.2 10 83,347,731 - 83,356,775 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 83,347,731 - 83,356,775 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 88,292,064 - 88,301,109 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 87,790,149 - 87,799,194 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 83,182,801 - 83,191,846 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 86,303,727 - 86,312,770 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 86,303,727 - 86,312,762 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 86,100,811 - 86,109,854 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 87,121,889 - 87,131,587 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 87,143,530 - 87,145,100 (+) NCBI Celera 10 82,095,371 - 82,102,275 (+) NCBI Celera Cytogenetic Map 10 q31 NCBI
Ppp1r1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 14,389,533 - 14,394,169 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 14,378,186 - 14,394,910 (+) NCBI ChiLan1.0 ChiLan1.0
PPP1R1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 25,318,752 - 25,328,622 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 27,213,568 - 27,223,301 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 17,652,216 - 17,662,085 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 17,868,965 - 17,878,116 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 17,868,965 - 17,878,120 (-) Ensembl panpan1.1 panPan2
PPP1R1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 22,838,198 - 22,847,924 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 22,838,576 - 22,848,142 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 22,310,605 - 22,319,844 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 23,631,857 - 23,641,339 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 23,631,868 - 23,641,337 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 22,404,434 - 22,413,913 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 22,665,479 - 22,674,943 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 22,790,595 - 22,800,065 (-) NCBI UU_Cfam_GSD_1.0
Ppp1r1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 22,243,802 - 22,252,420 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 14,822,213 - 14,831,349 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 14,822,246 - 14,831,337 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP1R1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 22,680,980 - 22,690,952 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 22,681,244 - 22,690,978 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 23,071,451 - 23,079,039 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP1R1B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 66,530,640 - 66,541,025 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 66,530,488 - 66,541,242 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 37,442,205 - 37,453,029 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp1r1b
.
Predicted Target Of
Count of predictions: 2782 Count of miRNA genes: 599 Interacting mature miRNAs: 737 Transcripts: ENSMUST00000078694, ENSMUST00000132443, ENSMUST00000133700, ENSMUST00000137634, ENSMUST00000147415, ENSMUST00000150762, ENSMUST00000152525 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226783 Tibl5_m tibia length 5, 5 week (mouse) 11 68190826 101890826 Mouse 1302034 Pkccl_m protein kinase C content in lungs (mouse) Not determined 11 91604608 121973369 Mouse 1300628 Lgth6_m body length 6 (mouse) Not determined 11 66733420 100733652 Mouse 4141367 Inf1_m acute ozone induced inflammation (mouse) Not determined 44630038 113058009 Mouse 1558812 Rafar_m retinoic acid induced forelimb autopod reduction (mouse) Not determined 11 70691198 104691366 Mouse 1301535 Pas5b_m pulmonary adenoma susceptibility 5b (mouse) Not determined 11 96176465 108806384 Mouse 1300766 Skull16_m skull morphology 16 (mouse) Not determined 11 81574481 115574636 Mouse 1301404 Sbmd4_m spinal bone mineral density 4 (mouse) Not determined 11 72019649 106019734 Mouse 12910539 Sstapa3_m suseptibility to Staphylococcus aureus infection 3 (mouse) 11 96897693 110603991 Mouse 4142121 Tmc1m2_m Tmc1 modifier 2 (mouse) Not determined 11 56864027 114157957 Mouse 27226758 Femd3_m femur midshaft diameter 3, 5 week (mouse) 11 80890826 101890826 Mouse 14747003 Mancz9_m mandible centroid size 9 (mouse) 11 85844911 119844911 Mouse 1301640 Lore4_m loss of righting induced by ethanol 4 (mouse) Not determined 11 79156009 107616472 Mouse 10412288 Carg4_m Candida albicans resistance gene 4 (mouse) Not determined 11 81810267 115810267 Mouse 11251723 Ewc5_m ethanol withdrawal and consumption 5 (mouse) 11 89869251 121973369 Mouse 1301681 Sle13_m systematic lupus erythematosus susceptibility 13 (mouse) Not determined 11 70691198 104691366 Mouse 1300784 Prdt3_m prion disease incubation time 3 (mouse) Not determined 11 66733420 100733652 Mouse 4141339 Nilac2_m nicotine induced locomotor activity 2 (mouse) Not determined 11 70691198 104691366 Mouse 10413882 Moe1_m modifier of epilepsy 1 (mouse) 11 77770978 111771099 Mouse 11039501 Ltpr6a_m Leishmania tropica response 6a (mouse) 11 64830336 98830473 Mouse 11039502 Ltpr6b_m Leishmania tropica response 6b (mouse) 11 64830336 98830473 Mouse 4141465 Dbm2_m diabetes modifier 2 (mouse) Not determined 94437183 118022724 Mouse 10045617 Heal26_m wound healing/regeneration 26 (mouse) Not determined 11 92939373 112544554 Mouse 10045616 Heal25_m wound healing/regeneration 25 (mouse) Not determined 11 77437183 111437322 Mouse 1357631 Motr1_m modifier of tubby retinal degeneration 1 (mouse) Not determined 11 87691198 103274115 Mouse 1301310 Tmevd5_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse) Not determined 11 72726125 106726289 Mouse 1301153 Estq3_m estradiol regulated response QTL 3 (mouse) Not determined 11 96897693 99327028 Mouse 11039515 Ltpr6_m Leishmania tropica response 6 (mouse) 11 64830336 98830473 Mouse 4142348 Pstc2_m periosteal circumference 2 (mouse) Not determined 11 72818615 106818733 Mouse 1301414 Heal10_m wound healing/regeneration 10 (mouse) Not determined 11 77437183 111437322 Mouse 1300651 Pcyts3_m plasmacytoma susceptibility 3 (mouse) Not determined 11 70691198 104691366 Mouse 1301546 Pcir2_m periosteal circumference 2 (mouse) Not determined 11 66733420 100733652 Mouse 1300649 Crhq1_m compensatory renal hypertrophy QTL 1 (mouse) Not determined 11 81574481 115574636 Mouse 27226789 Feml16_m femur length 16, 10 week (mouse) 11 87490826 121873369 Mouse 14746970 Manh71_m mandible shape 71 (mouse) 11 79416257 113416257 Mouse 10043865 T2dm5sa_m type 2 diabetes mellitus 5 in SMXA RI mice (mouse) Not determined 11 79813759 104502698 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 10043866 Adip19_m adiposity 19 (mouse) Not determined 11 72818615 106818733 Mouse 1301072 Eae22_m experimental allergic encephalomyelitis 22 (mouse) Not determined 11 82377698 116377820 Mouse 1300944 Alcp20_m alcohol preference locus 20 (mouse) Not determined 11 95403965 121973369 Mouse 4141939 Pregq2_m pregnancy QTL 2 (mouse) Not determined 11 94063779 118022724 Mouse 11038695 Par8_m pulmonary adenoma resistance 8 (mouse) 11 77063779 111063918 Mouse 1357766 Si5lq6_m serum IGFBP-5 level QTL 6 (mouse) Not determined 11 66733420 100733652 Mouse 1301057 Nidd4_m non-insulin-dependent diabetes mellitus 4 (mouse) Not determined 11 96810136 121973369 Mouse 1301958 Alcp18_m alcohol preference locus 18 (mouse) Not determined 11 95403965 121973369 Mouse 1301833 Tbbmd5_m total body bone mineral density 5 (mouse) Not determined 11 66733420 100733652 Mouse 1301491 Abbp4_m A/J and C57BL/6 blood pressure 4 (mouse) Not determined 11 88699588 99081597 Mouse 15014785 Mvlq1_m macrovesicular liver lesion QTL 1 (mouse) 11 86608320 120608320 Mouse 4141012 Femwf6_m femur work to failure 6 (mouse) Not determined 66733420 100733652 Mouse 15039374 Adip29_m adiposity 29 (mouse) 11 86608320 120608320 Mouse 1300962 Cd8mts4_m CD8 memory T cell subset 4 (mouse) Not determined 11 96137674 121973369 Mouse 1301095 El6_m epilepsy 6 (mouse) Not determined 11 93229183 121973369 Mouse 27226731 Tibmd4_m tibia midshaft diameter 4, 10 week (mouse) 11 94190826 118890826 Mouse 27226730 Tibmd1_m tibia midshaft diameter 1, 5 week (mouse) 11 62590826 109390826 Mouse 15039376 Bw42_m body weight QTL 42 (mouse) 11 86608320 120608320 Mouse 1558753 Ath19_m atherosclerosis 19 (mouse) Not determined 11 91604608 121973369 Mouse 10044007 Hbnr14_m Heligmosomoides bakeri nematode resistance 14 (mouse) Not determined 11 87502600 121502698 Mouse 1302124 Eae7_m susceptibility to experimental allergic encephalomyelitis 7 (mouse) Not determined 11 77573873 99377820 Mouse
AU040756
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 98,357,412 - 98,357,641 UniSTS GRCm38 MGSCv37 11 98,218,726 - 98,218,955 UniSTS GRCm37 Celera 11 108,011,692 - 108,011,921 UniSTS Cytogenetic Map 11 D UniSTS Whitehead/MRC_RH 11 1306.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000078694 ⟹ ENSMUSP00000077760
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,239,230 - 98,248,622 (+) Ensembl GRCm38.p6 Ensembl 11 98,348,404 - 98,357,796 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132443
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,241,681 - 98,248,614 (+) Ensembl GRCm38.p6 Ensembl 11 98,350,855 - 98,357,788 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133700
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,242,315 - 98,248,112 (+) Ensembl GRCm38.p6 Ensembl 11 98,351,489 - 98,357,286 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137634 ⟹ ENSMUSP00000123528
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,240,822 - 98,248,620 (+) Ensembl GRCm38.p6 Ensembl 11 98,349,996 - 98,357,794 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147415
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,242,041 - 98,248,217 (+) Ensembl GRCm38.p6 Ensembl 11 98,351,215 - 98,357,391 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150762 ⟹ ENSMUSP00000121147
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,240,822 - 98,248,620 (+) Ensembl GRCm38.p6 Ensembl 11 98,349,996 - 98,357,794 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000152525
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 98,245,422 - 98,247,929 (+) Ensembl GRCm38.p6 Ensembl 11 98,354,596 - 98,357,103 (+) Ensembl
RefSeq Acc Id:
NM_001313970 ⟹ NP_001300899
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 98,240,822 - 98,248,622 (+) NCBI GRCm38 11 98,349,996 - 98,357,796 (+) NCBI
Sequence:
TTTTTTTCCCATGAGAACTGGGTGATAAATTCTACAGCTTGAGAAAGACTCTAACCTCCAGAGACCCCAGCAGACCCCTCAGTGTCTGGAGTTAAGGCCCCCACTCGAGCTTCAGATCCGGCGCCGGA
hide sequence
RefSeq Acc Id:
NM_144828 ⟹ NP_659077
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 98,239,232 - 98,248,622 (+) NCBI GRCm38 11 98,348,406 - 98,357,796 (+) NCBI MGSCv37 11 98,210,052 - 98,219,109 (+) RGD Celera 11 108,003,018 - 108,012,075 (+) RGD cM Map 11 ENTREZGENE
Sequence:
AAGTCCACGTCCCGAGGGGGGGTGGGCGAAGAGGTTAAAGCCAGAGTCCCGGCTGCAGCTGCCCCTGCCCCCTCCCCTTAGCGTCACCGCTGGACTTCATTAATAATACAACGCCGAGTTCTGGGGAT
hide sequence
RefSeq Acc Id:
NP_659077 ⟸ NM_144828
- Peptide Label:
isoform 1
- UniProtKB:
Q6DV86 (UniProtKB/Swiss-Prot), Q3URF2 (UniProtKB/Swiss-Prot), A2A564 (UniProtKB/Swiss-Prot), Q91XB5 (UniProtKB/Swiss-Prot), Q60829 (UniProtKB/Swiss-Prot)
- Sequence:
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPNPCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEE
hide sequence
RefSeq Acc Id:
NP_001300899 ⟸ NM_001313970
- Peptide Label:
isoform 2
- UniProtKB:
Q60829 (UniProtKB/Swiss-Prot)
- Sequence:
MLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPNPCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEEDSQAEVLKGSRGTVGQKPTCGRGLEGPWERPPPLDE
hide sequence
Ensembl Acc Id:
ENSMUSP00000121147 ⟸ ENSMUST00000150762
Ensembl Acc Id:
ENSMUSP00000123528 ⟸ ENSMUST00000137634
Ensembl Acc Id:
ENSMUSP00000077760 ⟸ ENSMUST00000078694
RGD ID: 6821595 Promoter ID: MM_KWN:9560 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney Transcripts: OTTMUST00000005141 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 98,208,861 - 98,210,117 (+) MPROMDB
RGD ID: 6821597 Promoter ID: MM_KWN:9562 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney Transcripts: OTTMUST00000005346 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 98,215,311 - 98,216,067 (+) MPROMDB
RGD ID: 8676476 Promoter ID: EPDNEW_M16268 Type: initiation region Name: Ppp1r1b_1 Description: Mus musculus protein phosphatase 1, regulatory subunit 1B , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 98,348,726 - 98,348,786 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-05-29
Ppp1r1b
protein phosphatase 1, regulatory inhibitor subunit 1B
protein phosphatase 1, regulatory (inhibitor) subunit 1B
Symbol and/or name change
5135510 APPROVED
