Advanced Search (OLGA)

Gene: PLA2G10 (phospholipase A2 group X) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

PLA2G10

Name:

phospholipase A2 group X

RGD ID:

736427

HGNC Page

HGNC:9029

Description:

Enables 1-alkyl-2-acetylglycerophosphocholine esterase activity and calcium-dependent phospholipase A2 activity. Involved in several processes, including glycerophospholipid metabolic process; low-density lipoprotein particle remodeling; and positive regulation of lipid localization. Acts upstream of or within axon guidance and lysophospholipid transport. Located in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

collagen alpha-3(IX) chain-like; group 10 secretory phospholipase A2; group X secretory phospholipase A2; GX sPLA2; GXPLA2; GXSPLA2; LOC105371095; MGC119918; MGC119919; MGC133367; phosphatidylcholine 2-acylhydrolase 10; phospholipase a2, group 10; phospholipase A2, group X; SPLA2; sPLA2-X

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	14,672,548 - 14,701,850 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	14,672,548 - 14,694,308 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	14,766,405 - 14,788,430 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	14,673,906 - 14,696,027 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	14,673,907 - 14,696,027	NCBI
Celera	16	14,943,182 - 14,965,293 (-)	NCBI		Celera
Cytogenetic Map	16	p13.12-p13.11	NCBI
HuRef	16	14,685,697 - 14,707,807 (-)	NCBI		HuRef
CHM1_1	16	14,766,236 - 14,788,360 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	14,710,083 - 14,732,094 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PLA2G10	Human	(+)-catechin	multiple interactions	EXP		6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PLA2G10 mRNA	CTD	PMID:24763279
PLA2G10	Human	1,2-dimethylhydrazine	decreases expression	ISO	Pla2g10 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of PLA2G10 mRNA	CTD	PMID:22206623
PLA2G10	Human	17alpha-ethynylestradiol	affects expression	ISO	Pla2g10 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of PLA2G10 mRNA	CTD	PMID:17555576
PLA2G10	Human	17alpha-ethynylestradiol	increases expression	ISO	Pla2g10 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of PLA2G10 mRNA	CTD	PMID:17942748
PLA2G10	Human	17alpha-ethynylestradiol	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLA2G10 mRNA	CTD	PMID:17942748
PLA2G10	Human	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of PLA2G10 mRNA	CTD	PMID:21185374
PLA2G10	Human	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of PLA2G10 mRNA	CTD	PMID:31614463
PLA2G10	Human	17beta-estradiol	multiple interactions	ISO	Pla2g10 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PLA2G10 mRNA	CTD	PMID:26496021
PLA2G10	Human	17beta-estradiol	multiple interactions	EXP		6480464	Raloxifene Hydrochloride promotes the reaction [Estradiol results in increased expression of PLA2G10 mRNA]	CTD	PMID:21185374
PLA2G10	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLA2G10 mRNA	CTD	PMID:17942748
PLA2G10	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Pla2g10 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PLA2G10 mRNA	CTD	PMID:21570461
PLA2G10	Human	3,7-dihydropurine-6-thione	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Mercaptopurine results in decreased expression of PLA2G10 mRNA	CTD	PMID:23358152
PLA2G10	Human	6-propyl-2-thiouracil	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of PLA2G10 mRNA	CTD	PMID:30047161
PLA2G10	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of PLA2G10 polyA tail	CTD	PMID:30157460
PLA2G10	Human	all-trans-retinoic acid	decreases expression	ISO	Pla2g10 (Mus musculus)	6480464	Tretinoin results in decreased expression of PLA2G10 mRNA	CTD	PMID:16604517
PLA2G10	Human	all-trans-retinoic acid	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PLA2G10 mRNA	CTD	PMID:36189433
PLA2G10	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of PLA2G10 mRNA	CTD	PMID:23830798
PLA2G10	Human	amitrole	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Amitrole results in decreased expression of PLA2G10 mRNA	CTD	PMID:30047161
PLA2G10	Human	ammonium chloride	affects expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Ammonium Chloride affects the expression of PLA2G10 mRNA	CTD	PMID:16483693
PLA2G10	Human	Azoxymethane	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 mRNA	CTD	PMID:29950665
PLA2G10	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of PLA2G10 mRNA	CTD	PMID:20106945
PLA2G10	Human	bis(2-chloroethyl) sulfide	increases expression	EXP		6480464	Mustard Gas results in increased expression of PLA2G10 mRNA	CTD	PMID:25102026
PLA2G10	Human	bisphenol A	decreases expression	ISO	Pla2g10 (Mus musculus)	6480464	bisphenol A results in decreased expression of PLA2G10 mRNA	CTD	PMID:26063408
PLA2G10	Human	bisphenol A	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of PLA2G10 mRNA	CTD	PMID:25181051
PLA2G10	Human	bisphenol A	multiple interactions	ISO	Pla2g10 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PLA2G10 mRNA	CTD	PMID:26496021
PLA2G10	Human	cadmium dichloride	increases methylation	ISO	Pla2g10 (Rattus norvegicus)	6480464	Cadmium Chloride results in increased methylation of PLA2G10 promoter	CTD	PMID:22457795
PLA2G10	Human	calcitriol	increases expression	EXP		6480464	Calcitriol results in increased expression of PLA2G10 mRNA	CTD	PMID:16002434
PLA2G10	Human	carbon nanotube	affects expression	ISO	Pla2g10 (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of PLA2G10 mRNA	CTD	PMID:23845593
PLA2G10	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of PLA2G10 mRNA	CTD	PMID:20106945
PLA2G10	Human	dextran sulfate	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 mRNA	CTD	PMID:29950665
PLA2G10	Human	dichloroacetic acid	increases expression	ISO	Pla2g10 (Mus musculus)	6480464	Dichloroacetic Acid results in increased expression of PLA2G10 mRNA	CTD	PMID:28962523
PLA2G10	Human	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of PLA2G10 mRNA	CTD	PMID:37167442
PLA2G10	Human	graphite	affects expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Graphite affects the expression of PLA2G10 mRNA	CTD	PMID:29933104
PLA2G10	Human	mercaptopurine	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Mercaptopurine results in decreased expression of PLA2G10 mRNA	CTD	PMID:23358152
PLA2G10	Human	methimazole	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Methimazole results in decreased expression of PLA2G10 mRNA	CTD	PMID:30047161
PLA2G10	Human	methylisothiazolinone	increases expression	EXP		6480464	2-methyl-4-isothiazolin-3-one results in increased expression of PLA2G10 mRNA	CTD	PMID:31629900
PLA2G10	Human	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PLA2G10 mRNA	CTD	PMID:36189433
PLA2G10	Human	ozone	increases expression	ISO	Pla2g10 (Mus musculus)	6480464	Ozone results in increased expression of PLA2G10 mRNA	CTD	PMID:33026818
PLA2G10	Human	permethrin	decreases expression	EXP		6480464	Permethrin results in decreased expression of PLA2G10 mRNA	CTD	PMID:37047231
PLA2G10	Human	progesterone	affects expression	ISO	Pla2g10 (Mus musculus)	6480464	Progesterone affects the expression of PLA2G10 mRNA	CTD	PMID:17251523
PLA2G10	Human	propanal	increases expression	EXP		6480464	propionaldehyde results in increased expression of PLA2G10 mRNA	CTD	PMID:26079696
PLA2G10	Human	purine-6-thiol	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Mercaptopurine results in decreased expression of PLA2G10 mRNA	CTD	PMID:23358152
PLA2G10	Human	raloxifene	multiple interactions	EXP		6480464	Raloxifene Hydrochloride promotes the reaction [Estradiol results in increased expression of PLA2G10 mRNA]	CTD	PMID:21185374
PLA2G10	Human	silicon dioxide	decreases expression	EXP		6480464	Silicon Dioxide analog results in decreased expression of PLA2G10 mRNA	CTD	PMID:25895662
PLA2G10	Human	sulfadimethoxine	decreases expression	ISO	Pla2g10 (Rattus norvegicus)	6480464	Sulfadimethoxine results in decreased expression of PLA2G10 mRNA	CTD	PMID:30047161
PLA2G10	Human	tamoxifen	affects expression	ISO	Pla2g10 (Mus musculus)	6480464	Tamoxifen affects the expression of PLA2G10 mRNA	CTD	PMID:17555576
PLA2G10	Human	titanium dioxide	multiple interactions	ISO	Pla2g10 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 mRNA	CTD	PMID:29950665

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PLA2G10	Human	arachidonate metabolic process	involved_in	NAS		150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	arachidonate secretion	involved_in	IEA	InterPro:IPR016090 and InterPro:IPR036444	150520179		InterPro	GO_REF:0000002
PLA2G10	Human	axon guidance	acts_upstream_of_or_within	IDA		150520179	PMID:15927955	MGI	PMID:15927955
PLA2G10	Human	cellular response to leukemia inhibitory factor	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	cholesterol homeostasis	involved_in	ISS	UniProtKB:Q9QXX3	150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	cholesterol homeostasis	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	defense response to virus	involved_in	IDA		150520179	PMID:16146426	UniProt	PMID:16146426
PLA2G10	Human	erythrocyte maturation	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	fertilization	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	hair follicle morphogenesis	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	intestinal stem cell homeostasis	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	lipid catabolic process	involved_in	IEA	InterPro:IPR001211	150520179		InterPro	GO_REF:0000002
PLA2G10	Human	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	150520179		UniProt	GO_REF:0000043
PLA2G10	Human	low-density lipoprotein particle remodeling	involved_in	IDA		150520179	PMID:12021277	UniProt	PMID:12021277
PLA2G10	Human	lysophospholipid transport	acts_upstream_of_or_within	IDA		150520179	PMID:15927955	MGI	PMID:15927955
PLA2G10	Human	macrophage activation	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	negative regulation of cholesterol efflux	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	negative regulation of cholesterol efflux	acts_upstream_of	ISS	UniProtKB:Q9QXX3	150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	negative regulation of cytokine production involved in inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	negative regulation of DNA-binding transcription factor activity	involved_in	ISO	Pla2g10 (Mus musculus)	9068941	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	negative regulation of inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	negative regulation of transcription by RNA polymerase II	involved_in	IDA		150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	nuclear receptor-mediated signaling pathway	acts_upstream_of_negative_effect	IDA		150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	phosphatidic acid metabolic process	involved_in	IDA		150520179	PMID:12359733	UniProt	PMID:12359733
PLA2G10	Human	phosphatidic acid metabolic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phosphatidylcholine catabolic process	involved_in	IDA		150520179	PMID:12021277	UniProt	PMID:12021277
PLA2G10	Human	phosphatidylcholine metabolic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phosphatidylcholine metabolic process	involved_in	IEA	ARBA:ARBA00028347	150520179		UniProt	GO_REF:0000117
PLA2G10	Human	phosphatidylcholine metabolic process	involved_in	IBA	MGI:1341796 more ...	150520179		GO_Central	GO_REF:0000033
PLA2G10	Human	phosphatidylcholine metabolic process	involved_in	IDA		150520179	PMID:12359733 more ...	UniProt	PMID:12359733 more ...
PLA2G10	Human	phosphatidylethanolamine metabolic process	involved_in	IDA		150520179	PMID:12359733	UniProt	PMID:12359733
PLA2G10	Human	phosphatidylethanolamine metabolic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phosphatidylglycerol metabolic process	involved_in	IBA	MGI:1341796 more ...	150520179		GO_Central	GO_REF:0000033
PLA2G10	Human	phosphatidylglycerol metabolic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phosphatidylglycerol metabolic process	involved_in	IDA		150520179	PMID:12359733	UniProt	PMID:12359733
PLA2G10	Human	phosphatidylserine metabolic process	involved_in	IDA		150520179	PMID:12359733	UniProt	PMID:12359733
PLA2G10	Human	phosphatidylserine metabolic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phospholipid metabolic process	involved_in	IEA	InterPro:IPR016090 and InterPro:IPR036444	150520179		InterPro	GO_REF:0000002
PLA2G10	Human	phospholipid metabolic process	involved_in	IEA	ARBA:ARBA00028721	150520179		UniProt	GO_REF:0000117
PLA2G10	Human	phospholipid metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	platelet activating factor catabolic process	involved_in	IDA		150520179	PMID:16962371	UniProt	PMID:16962371
PLA2G10	Human	positive regulation of acrosome reaction	involved_in	ISS	UniProtKB:Q9QXX3	150520179		UniProt	GO_REF:0000024
PLA2G10	Human	positive regulation of acrosome reaction	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	positive regulation of arachidonate secretion	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	positive regulation of arachidonate secretion	involved_in	ISS	UniProtKB:Q9QXX3	150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	positive regulation of lipid storage	involved_in	IMP		150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	positive regulation of macrophage derived foam cell differentiation	involved_in	IC	GO:0010884	150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	positive regulation of prostaglandin secretion	involved_in	IMP		150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	positive regulation of protein metabolic process	involved_in	IMP		150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	production of molecular mediator involved in inflammatory response	acts_upstream_of_or_within	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	prostaglandin biosynthetic process	involved_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	regulation of macrophage activation	involved_in	IMP		150520179	PMID:18511424	BHF-UCL	PMID:18511424
PLA2G10	Human	signal transduction involved in regulation of gene expression	involved_in	IDA		150520179	PMID:20844270	BHF-UCL	PMID:20844270

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PLA2G10	Human	acrosomal vesicle	located_in	IEA	UniProtKB-SubCell:SL-0007	150520179		UniProt	GO_REF:0000044
PLA2G10	Human	acrosomal vesicle	located_in	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	acrosomal vesicle	located_in	ISS	UniProtKB:Q9QXX3	150520179		UniProt	GO_REF:0000024
PLA2G10	Human	cytoplasmic vesicle	located_in	IEA	UniProtKB-KW:KW-0968	150520179		UniProt	GO_REF:0000043
PLA2G10	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
PLA2G10	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
PLA2G10	Human	extracellular region	located_in	TAS		150520179	PMID:9188469	Reactome	PMID:9188469 more ...
PLA2G10	Human	extracellular space	located_in	IDA		150520179	PMID:21805676	UniProt	PMID:21805676
PLA2G10	Human	lysosome	located_in	IEA	UniProtKB-SubCell:SL-0158	150520179		UniProt	GO_REF:0000044
PLA2G10	Human	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PLA2G10	Human	1-alkyl-2-acetylglycerophosphocholine esterase activity	enables	IDA		150520179	PMID:16962371	UniProt	PMID:16962371
PLA2G10	Human	calcium ion binding	enables	IEA	InterPro:IPR001211	150520179		InterPro	GO_REF:0000002
PLA2G10	Human	calcium ion binding	enables	IBA	MGI:1313269 more ...	150520179		GO_Central	GO_REF:0000033
PLA2G10	Human	calcium-dependent phospholipase A2 activity	enables	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	calcium-dependent phospholipase A2 activity	enables	IBA	MGI:1341796 more ...	150520179		GO_Central	GO_REF:0000033
PLA2G10	Human	calcium-dependent phospholipase A2 activity	enables	IDA		150520179	PMID:12021277 more ...	UniProt	PMID:12021277 more ...
PLA2G10	Human	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
PLA2G10	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
PLA2G10	Human	phospholipase A2 activity		ISO	Pla2g10 (Rattus norvegicus)	9068941		RGD	PMID:15781456 and REF_RGD_ID:1582547
PLA2G10	Human	phospholipase A2 activity	enables	IEA	RHEA:15801	150520179		RHEA	GO_REF:0000116
PLA2G10	Human	phospholipase A2 activity	enables	IEA	ARBA:ARBA00028544	150520179		UniProt	GO_REF:0000117
PLA2G10	Human	phospholipase A2 activity	enables	IEA	InterPro:IPR001211 more ...	150520179		InterPro	GO_REF:0000002
PLA2G10	Human	phospholipase A2 activity	enables	TAS		150520179	PMID:9188469	PINC	PMID:9188469
PLA2G10	Human	phospholipase A2 activity	enables	IEA	EC:3.1.1.4	150520179		UniProt	GO_REF:0000003
PLA2G10	Human	phospholipase activity	enables	ISS	UniProtKB:Q9QXX3	150520179	PMID:20844270	BHF-UCL	PMID:20844270
PLA2G10	Human	phospholipase activity	enables	IEA	UniProtKB:Q9QXX3 and ensembl:ENSMUSP00000023364	150520179		Ensembl	GO_REF:0000107
PLA2G10	Human	phospholipid binding	enables	IBA	PANTHER:PTN000919171 and UniProtKB:P14555	150520179		GO_Central	GO_REF:0000033
PLA2G10	Human	protein binding	enables	IPI	UniProtKB:Q96HA8	150520179	PMID:28514442 and PMID:33961781	IntAct	PMID:28514442 and PMID:33961781
PLA2G10	Human	protein binding	enables	IPI	UniProtKB:A5D8V6 more ...	150520179	PMID:32296183	IntAct	PMID:32296183
PLA2G10	Human	protein binding	enables	IPI	UniProtKB:Q7Z699	150520179	PMID:32814053	IntAct	PMID:32814053

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
PLA2G10	Human	arachidonic acid metabolic pathway		IEA		6907045		KEGG	hsa:00590
PLA2G10	Human	glutamate signaling pathway		IEA		6907045		KEGG	hsa:04724
PLA2G10	Human	glycerophospholipid metabolic pathway		IEA		6907045		KEGG	hsa:00564
PLA2G10	Human	gonadotropin-releasing hormone signaling pathway		IEA		6907045		KEGG	hsa:04912
PLA2G10	Human	linoleic acid metabolic pathway		IEA		6907045		KEGG	hsa:00591
PLA2G10	Human	long term depression		IEA		6907045		KEGG	hsa:04730
PLA2G10	Human	mitogen activated protein kinase signaling pathway		IEA		6907045		KEGG	hsa:04010
PLA2G10	Human	toxoplasmosis pathway		IEA		6907045		KEGG	hsa:05145
PLA2G10	Human	vascular endothelial growth factor signaling pathway		IEA		6907045		KEGG	hsa:04370

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8617505	PMID:9188469	PMID:9377118	PMID:9745929	PMID:10922494	PMID:11019817	PMID:11741884	PMID:12021277	PMID:12048163	PMID:12161451	PMID:12359733	PMID:12477932
PMID:12664556	PMID:14501581	PMID:14962950	PMID:15007070	PMID:15489334	PMID:15781456	PMID:15927955	PMID:16146426	PMID:16169070	PMID:16341674	PMID:16438975	PMID:16962371
PMID:17077289	PMID:17093191	PMID:18511424	PMID:18587072	PMID:19336475	PMID:19495570	PMID:20357262	PMID:20833395	PMID:20844270	PMID:20974857	PMID:21255140	PMID:21652694
PMID:21805676	PMID:21873635	PMID:21878635	PMID:22494626	PMID:22967861	PMID:23349189	PMID:23614662	PMID:23859159	PMID:24070020	PMID:24508801	PMID:25286228	PMID:25583995
PMID:25964585	PMID:26139511	PMID:26711221	PMID:26828067	PMID:28514442	PMID:28528433	PMID:32296183	PMID:32423798	PMID:32814053	PMID:33961781	PMID:34373451	PMID:35231479
PMID:36949045	PMID:38669316

PLA2G10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	14,672,548 - 14,701,850 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	14,672,548 - 14,694,308 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	14,766,405 - 14,788,430 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	14,673,906 - 14,696,027 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	14,673,907 - 14,696,027	NCBI
Celera	16	14,943,182 - 14,965,293 (-)	NCBI		Celera
Cytogenetic Map	16	p13.12-p13.11	NCBI
HuRef	16	14,685,697 - 14,707,807 (-)	NCBI		HuRef
CHM1_1	16	14,766,236 - 14,788,360 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	14,710,083 - 14,732,094 (-)	NCBI		T2T-CHM13v2.0

Pla2g10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	13,532,921 - 13,548,863 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	13,532,921 - 13,548,847 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	13,715,057 - 13,731,094 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	13,715,057 - 13,730,983 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	13,715,155 - 13,730,678 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	13,628,640 - 13,644,163 (-)	NCBI		MGSCv36	mm8
Celera	16	14,319,504 - 14,335,040 (-)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	9.5	NCBI

Pla2g10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	2,104,927 - 2,117,998 (-)	NCBI		GRCr8
mRatBN7.2	10	1,597,761 - 1,610,822 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	1,597,761 - 1,609,000 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	6,294,586 - 6,305,824 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	34,260,010 - 34,271,250 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	1,612,004 - 1,623,245 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	1,509,732 - 1,520,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	1,509,732 - 1,520,970 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	406,661 - 417,899 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	26,035 - 37,273 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	26,034 - 37,266 (-)	NCBI
Celera	10	658,651 - 669,889 (-)	NCBI		Celera
Cytogenetic Map	10	q11	NCBI

Pla2g10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	4,208,575 - 4,225,834 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	4,208,497 - 4,225,893 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100990946
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	15,204,875 - 15,232,910 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	18,987,730 - 19,015,721 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	13,600,152 - 13,622,629 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	15,021,025 - 15,043,782 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

PLA2G10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	28,573,239 - 28,591,714 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	28,574,387 - 28,591,703 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	29,936,319 - 29,954,796 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	28,736,378 - 28,754,847 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	28,736,238 - 28,754,865 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	28,539,400 - 28,557,862 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	28,427,844 - 28,446,114 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	28,835,005 - 28,853,467 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101960864
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	114,743,588 - 114,759,931 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	2,841,660 - 2,854,952 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	2,841,209 - 2,857,570 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC110259864
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	7,623,312 - 7,642,002 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	7,623,326 - 7,641,061 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Pla2g10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	3,870,940 - 3,887,426 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	3,871,034 - 3,887,476 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in PLA2G10
5 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 16p13.12-13.11(chr16:14668382-16678513)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051357]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051357]\|See cases [RCV000051357]	Chr16:14668382..16678513 [GRCh38] Chr16:14762239..16772370 [GRCh37] Chr16:14669740..16679871 [NCBI36] Chr16:16p13.12-13.11	uncertain significance
GRCh38/hg38 16p13.12-12.3(chr16:14609647-18765817)x3	copy number gain	See cases [RCV000051353]	Chr16:14609647..18765817 [GRCh38] Chr16:14703504..18777139 [GRCh37] Chr16:14611005..18684640 [NCBI36] Chr16:16p13.12-12.3	uncertain significance
GRCh38/hg38 16p13.12-13.11(chr16:14639096-16431491)x3	copy number gain	See cases [RCV000051354]	Chr16:14639096..16431491 [GRCh38] Chr16:14732953..16525348 [GRCh37] Chr16:14640454..16432849 [NCBI36] Chr16:16p13.12-13.11	uncertain significance
GRCh38/hg38 16p13.12-13.11(chr16:14668182-16493213)x3	copy number gain	See cases [RCV000051355]	Chr16:14668182..16493213 [GRCh38] Chr16:14762039..16587070 [GRCh37] Chr16:14669540..16494571 [NCBI36] Chr16:16p13.12-13.11	uncertain significance
GRCh38/hg38 16p13.12-13.11(chr16:14668382-16100721)x3	copy number gain	See cases [RCV000051356]	Chr16:14668382..16100721 [GRCh38] Chr16:14762239..16194578 [GRCh37] Chr16:14669740..16102079 [NCBI36] Chr16:16p13.12-13.11	uncertain significance
GRCh38/hg38 16p13.3-11.2(chr16:4644892-29170820)x3	copy number gain	See cases [RCV000133809]	Chr16:4644892..29170820 [GRCh38] Chr16:4694893..29182141 [GRCh37] Chr16:4634894..29089642 [NCBI36] Chr16:16p13.3-11.2	pathogenic
GRCh38/hg38 16p13.13-13.11(chr16:11952467-15186199)x1	copy number loss	See cases [RCV000137596]	Chr16:11952467..15186199 [GRCh38] Chr16:12046324..15280056 [GRCh37] Chr16:11953825..15187557 [NCBI36] Chr16:16p13.13-13.11	likely pathogenic
GRCh38/hg38 16p13.12-13.11(chr16:14686278-16431491)x3	copy number gain	See cases [RCV000140727]	Chr16:14686278..16431491 [GRCh38] Chr16:14780135..16525348 [GRCh37] Chr16:14687636..16432849 [NCBI36] Chr16:16p13.12-13.11	uncertain significance
GRCh38/hg38 16p13.13-13.11(chr16:11967831-15162888)x1	copy number loss	See cases [RCV000052484]	Chr16:11967831..15162888 [GRCh38] Chr16:12061688..15256745 [GRCh37] Chr16:11969189..15164246 [NCBI36] Chr16:16p13.13-13.11	pathogenic
GRCh38/hg38 16p13.12(chr16:14140498-14686337)x3	copy number gain	See cases [RCV000137490]	Chr16:14140498..14686337 [GRCh38] Chr16:14234355..14780194 [GRCh37] Chr16:14141856..14687695 [NCBI36] Chr16:16p13.12	likely benign
GRCh38/hg38 16p13.3-13.11(chr16:666662-15743104)x3	copy number gain	See cases [RCV000143710]	Chr16:666662..15743104 [GRCh38] Chr16:716662..15836961 [GRCh37] Chr16:656663..15744462 [NCBI36] Chr16:16p13.3-13.11	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:102839-28327676)x3	copy number gain	See cases [RCV000203445]	Chr16:102839..28327676 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.3-12.3(chr16:1274615-19073133)x3	copy number gain	Breast ductal adenocarcinoma [RCV000207326]	Chr16:1274615..19073133 [GRCh37] Chr16:16p13.3-12.3	uncertain significance
Single allele	deletion	16p13.11 recurrent microdeletion syndrome [RCV003221320]	Chr16:14692101..16527136 [GRCh38] Chr16:16p13.12-13.11	likely pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:69193-90274381)x3	copy number gain	See cases [RCV000446684]	Chr16:69193..90274381 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.2-q24.3(chr16:9273328-89548493)x3	copy number gain	See cases [RCV000511622]	Chr16:9273328..89548493 [GRCh37] Chr16:16p13.2-q24.3	uncertain significance
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)x3	copy number gain	See cases [RCV000512138]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)	copy number gain	See cases [RCV000511296]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-12.2(chr16:85880-22442007)x3	copy number gain	See cases [RCV000511360]	Chr16:85880..22442007 [GRCh37] Chr16:16p13.3-12.2	pathogenic
GRCh37/hg19 16p13.3-12.3(chr16:85880-19806921)x3	copy number gain	See cases [RCV000512194]	Chr16:85880..19806921 [GRCh37] Chr16:16p13.3-12.3	pathogenic
GRCh37/hg19 16p13.12-12.3(chr16:14780543-16855348)x1	copy number loss	not provided [RCV000683767]	Chr16:14780543..16855348 [GRCh37] Chr16:16p13.12-12.3	pathogenic
GRCh37/hg19 16p13.12-13.11(chr16:14780641-16498084)x1	copy number loss	not provided [RCV000683768]	Chr16:14780641..16498084 [GRCh37] Chr16:16p13.12-13.11	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90274695)x3	copy number gain	not provided [RCV000738918]	Chr16:88165..90274695 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:61451-90294632)x3	copy number gain	not provided [RCV000738915]	Chr16:61451..90294632 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.12-13.11(chr16:14759219-16419494)x1	copy number loss	not provided [RCV000739062]	Chr16:14759219..16419494 [GRCh37] Chr16:16p13.12-13.11	likely benign
GRCh37/hg19 16p13.12-13.11(chr16:14766480-16286694)	copy number gain	not provided [RCV000767573]	Chr16:14766480..16286694 [GRCh37] Chr16:16p13.12-13.11	pathogenic
NM_003561.3(PLA2G10):c.360G>A (p.Pro120=)	single nucleotide variant	not provided [RCV000969969]	Chr16:14672745 [GRCh38] Chr16:14766602 [GRCh37] Chr16:16p13.12	likely benign
GRCh37/hg19 16p13.12-13.11(chr16:14770672-16458408)x1	copy number loss	not provided [RCV001006769]	Chr16:14770672..16458408 [GRCh37] Chr16:16p13.12-13.11	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:1279324-31926800)x3	copy number gain	Breast ductal adenocarcinoma [RCV000207053]	Chr16:1279324..31926800 [GRCh37] Chr16:16p13.3-11.2	uncertain significance
maternal UPD(16p)	complex	Hemimegalencephaly [RCV000494707]	Chr16:1280042..33710558 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.13-13.12(chr16:12007434-14781381)x1	copy number loss	not provided [RCV000683763]	Chr16:12007434..14781381 [GRCh37] Chr16:16p13.13-13.12	uncertain significance
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90163275)x3	copy number gain	not provided [RCV000738917]	Chr16:88165..90163275 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.12-13.11(chr16:14770672-16388343)x1	copy number loss	not provided [RCV001006768]	Chr16:14770672..16388343 [GRCh37] Chr16:16p13.12-13.11	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:5805001-34230001)	copy number gain	Microcephaly [RCV001252948]	Chr16:5805001..34230001 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:2959279-30190593)x3	copy number gain	See cases [RCV001263169]	Chr16:2959279..30190593 [GRCh37] Chr16:16p13.3-11.2	pathogenic\|likely pathogenic
GRCh37/hg19 16p13.12-12.3(chr16:14365745-17052798)x3	copy number gain	not provided [RCV002473916]	Chr16:14365745..17052798 [GRCh37] Chr16:16p13.12-12.3	likely pathogenic
NM_003561.3(PLA2G10):c.387G>C (p.Leu129Phe)	single nucleotide variant	not specified [RCV004111483]	Chr16:14672718 [GRCh38] Chr16:14766575 [GRCh37] Chr16:16p13.12	uncertain significance
NC_000016.10:g.14683149_16205174dup	duplication	not specified [RCV003225664]	Chr16:14683149..16205174 [GRCh38] Chr16:16p13.12-13.11	uncertain significance
GRCh37/hg19 16p13.12-13.11(chr16:14643928-14725823)x1	copy number loss	Dyskeratosis congenita, autosomal recessive 6 [RCV003228701]	Chr16:14643928..14725823 [GRCh37] Chr16:16p13.12-13.11	not provided
GRCh37/hg19 16p13.12(chr16:14423662-14777432)x3	copy number gain	not provided [RCV003485097]	Chr16:14423662..14777432 [GRCh37] Chr16:16p13.12	uncertain significance
GRCh37/hg19 16p13.12(chr16:14233730-14777432)x3	copy number gain	not provided [RCV004819622]	Chr16:14233730..14777432 [GRCh37] Chr16:16p13.12	uncertain significance
GRCh37/hg19 16p13.13-13.11(chr16:12272440-14892976)x1	copy number loss	not provided [RCV004819878]	Chr16:12272440..14892976 [GRCh37] Chr16:16p13.13-13.11	uncertain significance
GRCh37/hg19 16p13.12-13.11(chr16:14780543-16391045)x1	copy number loss	not provided [RCV001006770]	Chr16:14780543..16391045 [GRCh37] Chr16:16p13.12-13.11	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:4380767-30445350)x3	copy number gain	not provided [RCV002472599]	Chr16:4380767..30445350 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.12-13.11(chr16:14780544-16330627)x1	copy number loss	not provided [RCV002473940]	Chr16:14780544..16330627 [GRCh37] Chr16:16p13.12-13.11	pathogenic
NM_003561.3(PLA2G10):c.346G>A (p.Val116Ile)	single nucleotide variant	not specified [RCV004248684]	Chr16:14688174 [GRCh38] Chr16:14782031 [GRCh37] Chr16:16p13.12	likely benign
NM_003561.3(PLA2G10):c.359C>T (p.Pro120Leu)	single nucleotide variant	not specified [RCV004352002]	Chr16:14672746 [GRCh38] Chr16:14766603 [GRCh37] Chr16:16p13.12	uncertain significance
GRCh38/hg38 16p13.12-13.11(chr16:15032610-16203929)	copy number gain	16p13.11 microduplication syndrome [RCV004555167]	Chr16:15032610..16203929 [GRCh38] Chr16:16p13.12-13.11	likely pathogenic
GRCh38/hg38 16p13.12-12.3(chr16:15034129-16187150)	copy number gain	16p13.11 microduplication syndrome [RCV004555196]	Chr16:15034129..16187150 [GRCh38] Chr16:16p13.12-12.3	likely pathogenic

Predicted Target Of

	Summary Value
Count of predictions:	287
Count of miRNA genes:	261
Interacting mature miRNAs:	268
Transcripts:	ENST00000438167, ENST00000567462
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597294479	GWAS1390553_H	lysophosphatidylcholine 20:3 measurement QTL GWAS1390553 (human)		4e-11	glycerophosphocholine amount (VT:0011004)		16	14683535	14683536	Human

D16S312

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	14,787,112 - 14,787,279	UniSTS	GRCh37
GRCh37	16	14,826,229 - 14,826,402	UniSTS	GRCh37
Build 36	16	14,694,613 - 14,694,780	RGD	NCBI36
Celera	16	14,963,878 - 14,964,051	RGD
Cytogenetic Map	16	p12.2	UniSTS
Cytogenetic Map	16	p13.1-p12	UniSTS
HuRef	16	14,706,392 - 14,706,565	UniSTS

RH65989

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	14,766,461 - 14,766,592	UniSTS	GRCh37
Build 36	16	14,673,962 - 14,674,093	RGD	NCBI36
Celera	16	14,943,238 - 14,943,369	RGD
Cytogenetic Map	16	p13.1-p12	UniSTS
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	14,685,753 - 14,685,884	UniSTS
GeneMap99-GB4 RH Map	16	167.28	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
962	2238	2309	1560	4211	1260	2031	4	438	1330	312	1841	5469	4686	41	3312	754	1602	1457	139


RefSeq Transcripts	NM_003561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_133651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011522695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011522696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011522697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011522698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047434757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054329138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054329139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054329140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054329141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054329142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC009167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC243753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC106731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC106732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM739473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HF583722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U95301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000438167 ⟹ ENSP00000393847

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	14,672,548 - 14,694,308 (-)	Ensembl

Ensembl Acc Id:

ENST00000567462 ⟹ ENSP00000456433

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	14,672,681 - 14,694,276 (-)	Ensembl

RefSeq Acc Id:

NM_003561 ⟹ NP_003552

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,672,548 - 14,694,308 (-)	NCBI
GRCh37	16	14,766,405 - 14,788,526 (-)	ENTREZGENE
Build 36	16	14,673,906 - 14,696,027 (-)	NCBI Archive
HuRef	16	14,685,697 - 14,707,807 (-)	ENTREZGENE
CHM1_1	16	14,766,236 - 14,788,264 (-)	NCBI
T2T-CHM13v2.0	16	14,710,083 - 14,731,829 (-)	NCBI

Sequence:

show sequence

GTGACAGCCGGGGTGTGTGTCCGCCGGGCTTGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCTGTGTGCCTGCCAATCATGCTGCTCCTGCTACTGC
CGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGCAGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCC
ATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTTGTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCC
CAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGGACCGGCAGAGAACAAATGCCAAGAACTGTTGTGCAAGTGTGACCAGGAGATTGCTAACTGCTTAGCCCAAACTGAGT
ACAACTTAAAGTACCTCTTCTACCCCCAGTTCCTATGTGAGCCGGACTCGCCCAAGTGTGACTGACTACCTTGACTTGAAATGCTCTTTTGCACAAGGAAATAAAGCGTCCTCTCAGTAATGAA

hide sequence

RefSeq Acc Id:

NR_133651

RefSeq Status:

REVIEWED

Type:

NON-CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,672,548 - 14,694,573 (-)	NCBI
CHM1_1	16	14,766,236 - 14,788,264 (-)	NCBI
T2T-CHM13v2.0	16	14,710,083 - 14,732,094 (-)	NCBI

Sequence:

show sequence

TCTTCTGTTCCCTTTGGGCGCCCAGGTGAGCGGGGGAGGGGCTGGGGGAGTAATAACATCAAAAGAGCGCCTTTTCCTCCCTTATTCCGAGGAGACTTCCCTGGGCCTGACTCCCGGTCCTGTCCCCA
GCGCCCCGCGGCCTCTGGAGCCCCTTCAGTGACCAAGATACAGAGATCAGGACGCCTTTGCGCCGCCCCAGGTGCCCGCCCCTAGCTGGCTCTGCTTGGGCCGCGAGGGAAGGTGAGGTCGGGGGCGG
AGCCGGGGCGTGACAGCCGGGGTGTGTGTCCGCCGGGCTTGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCTGTGTGCCTGCCAATCATGCTGCTCC
TGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGCAGGAACTGTGGGTTGTGTTGGTCCC
CGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTTGTTACACTCGAGCTGAGGAGGCCGG
CTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGTCTTGCTCTGTCACCCAGGCTGGAGTGCAGTGGTGTGATCTCGGCTCACTTCAACCTCTGCCTTTTGGG
CTCAAGCGATCCTCGCACCTCAGCCTCCTGAGTAGCTGGAATCACAGGACCGGCAGAGAACAAATGCCAAGAACTGTTGTGCAAGTGTGACCAGGAGATTGCTAACTGCTTAGCCCAAACTGAGTACA
ACTTAAAGTACCTCTTCTACCCCCAGTTCCTATGTGAGCCGGACTCGCCCAAGTGTGACTGACTACCTTGACTTGAAATGCTCTTTTGCACAAGGAAATAAAGCGTCCTCTCAGTAATGAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_011522695 ⟹ XP_011520997

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,678,794 - 14,701,850 (-)	NCBI

Sequence:

show sequence

CAAAGTGCTGGGATTACAGGCGTGAGTCACCGCGCCCGGCCAAATAAAATAAAATGTTAAAGCA
AATTCAGGACTACCCCTCCTCCAAGTCTTCTGTTCCCTTTGGGCGCCCAGGTGAGCGGGGGAGGGGCTGGGGGAGTAATAACATCAAAAGAGCGCCTTTTCCTCCCTTATTCCGAGGAGACTTCCCTG
GGCCTGACTCCCGGTCCTGTCCCCAGCGCCCCGCGGCCTCTGGAGCCCCTTCAGTGACCAAGATACAGAGATCAGGACGCCTTTGCGCCGCCCCAGGTGCCCGCCCCTAGCTGGCTCTGCTTGGGCCG
CGAGGGAAGGTGAGGTCGGGGGCGGAGCCGGGGCGTGACAGCCGGGGTGTGTGTCCGCCGGGCTTGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCT
GTGTGCCTGCCAATCATGCTGCTCCTGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGC
AGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTT
GTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGGTTGTGAGAATTTTGCCCCAATAACAAAAAGCAGGAGTGCATGG
TGAGGATTTCTCTGTTACTGAGAGTGGTTGGGGTGAGAGAAAGTCTCCCGGAGACACCAATGAAGCAGAGACCTGAGGAACAGAGGAGACAGCCACGTGGAGGTGATGCAACAGCCAGTGCAAGGGCC
CTGGGGTACGCACAAGTGTCTGGGTGGTCTGAGGATCACAAGGAGTTCGGTGAGGCTGGAGCAGAGTCCCCCAGAGTGACAGAAGTAGGGGATGATGTCGGAGAGTGATAGGGGCTAGATTCCTAGGG
CATTGGAGGCTCTTCTCTGAGAGAGATGGGGAGCCAAGGAGGGTTTTGAGCAGGGGAGGGAC

hide sequence

RefSeq Acc Id:

XM_011522696 ⟹ XP_011520998

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,683,458 - 14,701,850 (-)	NCBI

Sequence:

show sequence

CAAAGTGCTGGGATTACAGGCGTGAGTCACCGCGCCCGGCCAAATAAAATAAAATGTTAAAGCA
AATTCAGGACTACCCCTCCTCCAAGTCTTCTGTTCCCTTTGGGCGCCCAGGTGAGCGGGGGAGGGGCTGGGGGAGTAATAACATCAAAAGAGCGCCTTTTCCTCCCTTATTCCGAGGAGACTTCCCTG
GGCCTGACTCCCGGTCCTGTCCCCAGCGCCCCGCGGCCTCTGGAGCCCCTTCAGTGACCAAGATACAGAGATCAGGACGCCTTTGCGCCGCCCCAGGTGCCCGCCCCTAGCTGGCTCTGCTTGGGCCG
CGAGGGAAGGTGAGGTCGGGGGCGGAGCCGGGGCGTGACAGCCGGGGTGTGTGTCCGCCGGGCTTGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCT
GTGTGCCTGCCAATCATGCTGCTCCTGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGC
AGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTT
GTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGTTATCTCAGCCCTCTTGGTTGAAGAGACTCTTCCCCATTGAATC
ATCCTGCTACCTTTGCTGAAAATCACCGCCAGGAGTGGTGGCTCACACCTGTAATCCTAGCACTTTGGGAGGCTGAGGCGGATGGATTGCCTGAACTCAGGAGT

hide sequence

RefSeq Acc Id:

XM_011522697 ⟹ XP_011520999

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,678,699 - 14,701,850 (-)	NCBI

Sequence:

show sequence

CAAAGTGCTGGGATTACAGGCGTGAGTCACCGCGCCCGGCCAAATAAAATAAAATGTTAAAGCAAATTCAGGACTACCCCTCCTCCAAGTCTTCTGTTCCCTTTGGGCGCCCAGGTGAGCGGGGGAGG
GGCTGGGGGAGTAATAACATCAAAAGAGCGCCTTTTCCTCCCTTATTCCGAGGAGACTTCCCTGGGCCTGACTCCCGGTCCTGTCCCCAGCGCCCCGCGGCCTCTGGAGCCCCTTCAGTGACCAAGAT
ACAGAGATCAGGACGCCTTTGCGCCGCCCCAGGTGCCCGCCCCTAGCTGGCTCTGCTTGGGCCGCGAGGGAAGGTGAGGTCGGGGGCGGAGCCGGGGCGTGACAGCCGGGGTGTGTGTCCGCCGGGCT
TGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCTGTGTGCCTGCCAATCATGCTGCTCCTGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTG
GCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGCAGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGT
GGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTTGTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGT
CAATCAGAGCGTCCTGTGCGGCTGGAGTGCAGTGGTGTGATCTCGGCTCACTTCAACCTCTGCC

hide sequence

RefSeq Acc Id:

XM_011522698 ⟹ XP_011521000

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,683,666 - 14,701,850 (-)	NCBI

Sequence:

show sequence

CAAAGTGCTGGGATTACAGGCGTGAGTCACCGCGCCCGGCCAAATAAAATAAAATGTTAAAGCA
AATTCAGGACTACCCCTCCTCCAAGTCTTCTGTTCCCTTTGGGCGCCCAGGTGAGCGGGGGAGGGGCTGGGGGAGTAATAACATCAAAAGAGCGCCTTTTCCTCCCTTATTCCGAGGAGACTTCCCTG
GGCCTGACTCCCGGTCCTGTCCCCAGCGCCCCGCGGCCTCTGGAGCCCCTTCAGTGACCAAGATACAGAGATCAGGACGCCTTTGCGCCGCCCCAGGTGCCCGCCCCTAGCTGGCTCTGCTTGGGCCG
CGAGGGAAGGTGAGGTCGGGGGCGGAGCCGGGGCGTGACAGCCGGGGTGTGTGTCCGCCGGGCTTGGTGCCTCCGGTGGCCCTGCAGCACCGTCCCACCTCTGCCACCCTCCGATGGGGCCGCTACCT
GTGTGCCTGCCAATCATGCTGCTCCTGCTACTGCCGTCGCTGCTGCTGCTGCTGCTTCTACCTGGCCCCGGGTCCGGCGAGGCCTCCAGGATATTACGTGTGCACCGGCGTGGGATCCTGGAACTGGC
AGGAACTGTGGGTTGTGTTGGTCCCCGAACCCCCATCGCCTATATGAAATATGGTTGCTTTTGTGGCTTGGGAGGCCATGGCCAGCCCCGCGATGCCATTGACTGGTGCTGCCATGGCCACGACTGTT
GTTACACTCGAGCTGAGGAGGCCGGCTGCAGCCCCAAGACAGAGCGCTACTCCTGGCAGTGCGTCAATCAGAGCGTCCTGTGCGGTCATTGATCCATTTTGAGTTAA

hide sequence

RefSeq Acc Id:

XM_047434757 ⟹ XP_047290713

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	14,672,548 - 14,701,850 (-)	NCBI


Protein RefSeqs	NP_003552	(Get FASTA)	NCBI Sequence Viewer
	XP_011520997	(Get FASTA)	NCBI Sequence Viewer
	XP_011520998	(Get FASTA)	NCBI Sequence Viewer
	XP_011520999	(Get FASTA)	NCBI Sequence Viewer
	XP_011521000	(Get FASTA)	NCBI Sequence Viewer
	XP_047290713	(Get FASTA)	NCBI Sequence Viewer
	XP_054185113	(Get FASTA)	NCBI Sequence Viewer
	XP_054185114	(Get FASTA)	NCBI Sequence Viewer
	XP_054185115	(Get FASTA)	NCBI Sequence Viewer
	XP_054185116	(Get FASTA)	NCBI Sequence Viewer
	XP_054185117	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB64410	(Get FASTA)	NCBI Sequence Viewer
	AAH69539	(Get FASTA)	NCBI Sequence Viewer
	AAI06732	(Get FASTA)	NCBI Sequence Viewer
	AAI06733	(Get FASTA)	NCBI Sequence Viewer
	AAI11805	(Get FASTA)	NCBI Sequence Viewer
	CAG33166	(Get FASTA)	NCBI Sequence Viewer
	CCQ43219	(Get FASTA)	NCBI Sequence Viewer
	EAW85104	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000393847
	ENSP00000393847.4
	ENSP00000456433
	ENSP00000479397.1
GenBank Protein	O15496	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_003552 ⟸ NM_003561
- Peptide Label:	preproprotein
- UniProtKB:	Q14DU3 (UniProtKB/Swiss-Prot), Q6NT23 (UniProtKB/Swiss-Prot), O15496 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQEL LCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD hide sequence

RefSeq Acc Id:	XP_011520999 ⟸ XM_011522697
- Peptide Label:	isoform X4
- UniProtKB:	H3BRW4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMK YGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGWSAVV hide sequence

RefSeq Acc Id:	XP_011520997 ⟸ XM_011522695
- Peptide Label:	isoform X2
- UniProtKB:	H3BRW4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMK YGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGCENFAPITKSRSAW hide sequence

RefSeq Acc Id:	XP_011520998 ⟸ XM_011522696
- Peptide Label:	isoform X3
- UniProtKB:	H3BRW4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCVISALLVEET LPH hide sequence

RefSeq Acc Id:	XP_011521000 ⟸ XM_011522698
- Peptide Label:	isoform X5
- UniProtKB:	H3BRW4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMK YGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGH hide sequence

Protein Domains

Phospholipase A2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O15496-F1-model_v2	AlphaFold	O15496	1-165	view protein structure

Database	Acc Id	Source(s)
COSMIC	PLA2G10	COSMIC
Ensembl Genes	ENSG00000069764	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000276870	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000438167	ENTREZGENE
	ENST00000438167.8	UniProtKB/Swiss-Prot
	ENST00000567462	ENTREZGENE
	ENST00000621727.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.90.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000069764	GTEx
	ENSG00000276870	GTEx
HGNC ID	HGNC:9029	ENTREZGENE
Human Proteome Map	PLA2G10	Human Proteome Map
InterPro	PLipase_A2	UniProtKB/Swiss-Prot
	PLipase_A2_Asp_AS	UniProtKB/Swiss-Prot
	PLipase_A2_dom	UniProtKB/Swiss-Prot
	PLipase_A2_dom_sf	UniProtKB/Swiss-Prot
	PLipase_A2_His_AS	UniProtKB/Swiss-Prot
KEGG Report	hsa:8399	UniProtKB/Swiss-Prot
NCBI Gene	8399	ENTREZGENE
OMIM	603603	OMIM
PANTHER	GROUP 10 SECRETORY PHOSPHOLIPASE A2	UniProtKB/Swiss-Prot
	PTHR11716	UniProtKB/Swiss-Prot
Pfam	Phospholip_A2_1	UniProtKB/Swiss-Prot
PharmGKB	PA33360	PharmGKB
PRINTS	PHPHLIPASEA2	UniProtKB/Swiss-Prot
PROSITE	PA2_ASP	UniProtKB/Swiss-Prot
	PA2_HIS	UniProtKB/Swiss-Prot
SMART	PA2c	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48619	UniProtKB/Swiss-Prot
UniProt	H3BRW4	ENTREZGENE, UniProtKB/TrEMBL
	L8E7V2_HUMAN	UniProtKB/TrEMBL
	O15496	ENTREZGENE, UniProtKB/Swiss-Prot
	Q14DU3	ENTREZGENE
	Q6NT23	ENTREZGENE
UniProt Secondary	Q14DU3	UniProtKB/Swiss-Prot
	Q6NT23	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-04-14	PLA2G10	phospholipase A2 group X	LOC105371095	collagen alpha-3(IX) chain-like	Data merged from RGD:38606216	737654	PROVISIONAL
2015-11-24	PLA2G10	phospholipase A2 group X		phospholipase A2, group X	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - KEGG (archival)