Symbol:
Pla2g10
Name:
phospholipase A2, group X
RGD ID:
61935
Description:
Enables phospholipase A2 activity. Predicted to be involved in several processes, including cholesterol homeostasis; glycerophospholipid metabolic process; and positive regulation of lipid localization. Predicted to act upstream of or within several processes, including cellular response to leukemia inhibitory factor; erythrocyte maturation; and negative regulation of cytokine production involved in inflammatory response. Predicted to be located in acrosomal vesicle and extracellular space. Orthologous to human PLA2G10 (phospholipase A2 group X); PARTICIPATES IN alpha-linolenic acid metabolic pathway; arachidonic acid metabolic pathway; ether lipid metabolic pathway; INTERACTS WITH 17beta-estradiol; 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
group 10 secretory phospholipase A2; group X phospholipase A2; group X secretory phospholipase A2; GX sPLA2; phosphatidylcholine 2-acylhydrolase 10; phosphatidylcholine 2-acylhydrolase GX; phospholipase A2 group X; phospholipase A2, group 10; PLA2GX; sPLA2-X
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLA2G10 (phospholipase A2 group X) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pla2g10 (phospholipase A2, group X) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pla2g10 (phospholipase A2 group X) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100990946 (group 10 secretory phospholipase A2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLA2G10 (phospholipase A2 group X) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101960864 (group 10 secretory phospholipase A2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC110259864 (group 10 secretory phospholipase A2-like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pla2g10 (phospholipase A2 group X) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Pla2g10 (phospholipase A2, group X)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLA2G10 (phospholipase A2 group X)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:92162
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG14507
Alliance
DIOPT (Ensembl Compara|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
C03H5.4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 2,104,927 - 2,117,998 (-) NCBI GRCr8 mRatBN7.2 10 1,597,761 - 1,610,822 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 1,597,761 - 1,609,000 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 6,294,586 - 6,305,824 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 34,260,010 - 34,271,250 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 1,612,004 - 1,623,245 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 1,509,732 - 1,520,970 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 1,509,732 - 1,520,970 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 406,661 - 417,899 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 26,035 - 37,273 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 26,034 - 37,266 (-) NCBI Celera 10 658,651 - 669,889 (-) NCBI Celera Cytogenetic Map 10 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pla2g10 Rat (+)-catechin multiple interactions ISO RGD:736427 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PLA2G10 mRNA CTD PMID:24763279 Pla2g10 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:62228 6480464 1,2-Dimethylhydrazine results in decreased expression of PLA2G10 mRNA CTD PMID:22206623 Pla2g10 Rat 17alpha-ethynylestradiol affects expression ISO RGD:62228 6480464 Ethinyl Estradiol affects the expression of PLA2G10 mRNA CTD PMID:17555576 Pla2g10 Rat 17alpha-ethynylestradiol increases expression ISO RGD:62228 6480464 Ethinyl Estradiol results in increased expression of PLA2G10 mRNA CTD PMID:17942748 Pla2g10 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:62228 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLA2G10 mRNA CTD PMID:17942748 Pla2g10 Rat 17beta-estradiol increases expression ISO RGD:736427 6480464 Estradiol results in increased expression of PLA2G10 mRNA CTD PMID:21185374 Pla2g10 Rat 17beta-estradiol decreases expression ISO RGD:736427 6480464 Estradiol results in decreased expression of PLA2G10 mRNA CTD PMID:31614463 Pla2g10 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLA2G10 mRNA CTD PMID:26496021 Pla2g10 Rat 17beta-estradiol multiple interactions ISO RGD:736427 6480464 Raloxifene Hydrochloride promotes the reaction [Estradiol results in increased expression of PLA2G10 mRNA] CTD PMID:21185374 Pla2g10 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:62228 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLA2G10 mRNA CTD PMID:17942748 Pla2g10 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:62228 6480464 Tetrachlorodibenzodioxin affects the expression of PLA2G10 mRNA CTD PMID:21570461 Pla2g10 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PLA2G10 mRNA CTD PMID:23358152 Pla2g10 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLA2G10 mRNA CTD PMID:30047161 Pla2g10 Rat aflatoxin B1 increases methylation ISO RGD:736427 6480464 Aflatoxin B1 results in increased methylation of PLA2G10 polyA tail CTD PMID:30157460 Pla2g10 Rat all-trans-retinoic acid decreases expression ISO RGD:62228 6480464 Tretinoin results in decreased expression of PLA2G10 mRNA CTD PMID:16604517 Pla2g10 Rat all-trans-retinoic acid multiple interactions ISO RGD:62228 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PLA2G10 mRNA CTD PMID:36189433 Pla2g10 Rat all-trans-retinoic acid increases expression ISO RGD:736427 6480464 Tretinoin results in increased expression of PLA2G10 mRNA CTD PMID:23830798 Pla2g10 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLA2G10 mRNA CTD PMID:30047161 Pla2g10 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLA2G10 mRNA CTD PMID:16483693 Pla2g10 Rat Azoxymethane multiple interactions ISO RGD:62228 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 more ... CTD PMID:29950665 Pla2g10 Rat benzo[a]pyrene increases expression ISO RGD:736427 6480464 Benzo(a)pyrene results in increased expression of PLA2G10 mRNA CTD PMID:20106945 Pla2g10 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:736427 6480464 Mustard Gas results in increased expression of PLA2G10 mRNA CTD PMID:25102026 Pla2g10 Rat bisphenol A decreases expression ISO RGD:62228 6480464 bisphenol A results in decreased expression of PLA2G10 mRNA CTD PMID:26063408 Pla2g10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLA2G10 mRNA CTD PMID:25181051 Pla2g10 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLA2G10 mRNA CTD PMID:26496021 Pla2g10 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of PLA2G10 promoter CTD PMID:22457795 Pla2g10 Rat calcitriol increases expression ISO RGD:736427 6480464 Calcitriol results in increased expression of PLA2G10 mRNA CTD PMID:16002434 Pla2g10 Rat carbon nanotube affects expression ISO RGD:62228 6480464 Nanotubes, Carbon affects the expression of PLA2G10 mRNA CTD PMID:23845593 Pla2g10 Rat cyclosporin A increases expression ISO RGD:736427 6480464 Cyclosporine results in increased expression of PLA2G10 mRNA CTD PMID:20106945 Pla2g10 Rat dextran sulfate multiple interactions ISO RGD:62228 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 more ... CTD PMID:29950665 Pla2g10 Rat dichloroacetic acid increases expression ISO RGD:62228 6480464 Dichloroacetic Acid results in increased expression of PLA2G10 mRNA CTD PMID:28962523 Pla2g10 Rat flavonoids decreases expression ISO RGD:736427 6480464 Flavonoids results in decreased expression of PLA2G10 mRNA CTD PMID:37167442 Pla2g10 Rat graphite affects expression EXP 6480464 Graphite affects the expression of PLA2G10 mRNA CTD PMID:29933104 Pla2g10 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PLA2G10 mRNA CTD PMID:23358152 Pla2g10 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PLA2G10 mRNA CTD PMID:30047161 Pla2g10 Rat methylisothiazolinone increases expression ISO RGD:736427 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of PLA2G10 mRNA CTD PMID:31629900 Pla2g10 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:62228 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PLA2G10 mRNA CTD PMID:36189433 Pla2g10 Rat ozone increases expression ISO RGD:62228 6480464 Ozone results in increased expression of PLA2G10 mRNA CTD PMID:33026818 Pla2g10 Rat permethrin decreases expression ISO RGD:736427 6480464 Permethrin results in decreased expression of PLA2G10 mRNA CTD PMID:37047231 Pla2g10 Rat progesterone affects expression ISO RGD:62228 6480464 Progesterone affects the expression of PLA2G10 mRNA CTD PMID:17251523 Pla2g10 Rat propanal increases expression ISO RGD:736427 6480464 propionaldehyde results in increased expression of PLA2G10 mRNA CTD PMID:26079696 Pla2g10 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of PLA2G10 mRNA CTD PMID:23358152 Pla2g10 Rat raloxifene multiple interactions ISO RGD:736427 6480464 Raloxifene Hydrochloride promotes the reaction [Estradiol results in increased expression of PLA2G10 mRNA] CTD PMID:21185374 Pla2g10 Rat silicon dioxide decreases expression ISO RGD:736427 6480464 Silicon Dioxide analog results in decreased expression of PLA2G10 mRNA CTD PMID:25895662 Pla2g10 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PLA2G10 mRNA CTD PMID:30047161 Pla2g10 Rat tamoxifen affects expression ISO RGD:62228 6480464 Tamoxifen affects the expression of PLA2G10 mRNA CTD PMID:17555576 Pla2g10 Rat titanium dioxide multiple interactions ISO RGD:62228 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PLA2G10 more ... CTD PMID:29950665
Imported Annotations - KEGG (archival)
Biological Process
arachidonate secretion (IEA) axon guidance (ISO) cellular response to leukemia inhibitory factor (IEA,ISO) cholesterol homeostasis (IEA,ISO) defense response to virus (ISO) erythrocyte maturation (IEA,ISO) fertilization (IEA,ISO) hair follicle morphogenesis (IEA,ISO) intestinal stem cell homeostasis (IEA,ISO) lipid catabolic process (IEA) lipid metabolic process (IEA) low-density lipoprotein particle remodeling (ISO) lysophospholipid transport (ISO) macrophage activation (IEA,ISO) negative regulation of cholesterol efflux (IEA,ISO) negative regulation of cytokine production involved in inflammatory response (IEA,ISO) negative regulation of DNA-binding transcription factor activity (ISO) negative regulation of inflammatory response (IEA,ISO) negative regulation of transcription by RNA polymerase II (ISO) nuclear receptor-mediated signaling pathway (ISO) phosphatidic acid metabolic process (IEA,ISO,ISS) phosphatidylcholine catabolic process (ISO) phosphatidylcholine metabolic process (IBA,IEA,ISO,ISS) phosphatidylethanolamine metabolic process (IEA,ISO,ISS) phosphatidylglycerol metabolic process (IBA,IEA,ISO,ISS) phosphatidylserine metabolic process (IEA,ISO,ISS) phospholipid metabolic process (IEA,ISO) platelet activating factor catabolic process (ISO,ISS) positive regulation of acrosome reaction (IEA,ISO,ISS) positive regulation of arachidonate secretion (IEA,ISO) positive regulation of lipid storage (ISO) positive regulation of prostaglandin secretion (ISO) positive regulation of protein metabolic process (ISO) production of molecular mediator involved in inflammatory response (IEA,ISO) prostaglandin biosynthetic process (IEA,ISO) regulation of macrophage activation (ISO) signal transduction involved in regulation of gene expression (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
4.
Expression and location of mRNAs encoding multiple forms of secretory phospholipase A2 in the rat retina.
Kolko M, etal., J Neurosci Res 2004 Aug 15;77(4):517-24.
5.
Neuronal expression and neuritogenic action of group X secreted phospholipase A2.
Masuda S, etal., J Biol Chem. 2005 Jun 17;280(24):23203-14. Epub 2005 Mar 21.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
12.
On the diversity of secreted phospholipases A(2). Cloning, tissue distribution, and functional expression of two novel mouse group II enzymes.
Valentin E, etal., J Biol Chem 1999 Oct 29;274(44):31195-202.
Pla2g10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 2,104,927 - 2,117,998 (-) NCBI GRCr8 mRatBN7.2 10 1,597,761 - 1,610,822 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 1,597,761 - 1,609,000 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 6,294,586 - 6,305,824 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 34,260,010 - 34,271,250 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 1,612,004 - 1,623,245 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 1,509,732 - 1,520,970 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 1,509,732 - 1,520,970 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 406,661 - 417,899 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 26,035 - 37,273 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 26,034 - 37,266 (-) NCBI Celera 10 658,651 - 669,889 (-) NCBI Celera Cytogenetic Map 10 q11 NCBI
PLA2G10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 14,672,548 - 14,701,850 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 14,672,548 - 14,694,308 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 14,766,405 - 14,788,430 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 14,673,906 - 14,696,027 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 14,673,907 - 14,696,027 NCBI Celera 16 14,943,182 - 14,965,293 (-) NCBI Celera Cytogenetic Map 16 p13.12-p13.11 NCBI HuRef 16 14,685,697 - 14,707,807 (-) NCBI HuRef CHM1_1 16 14,766,236 - 14,788,360 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 14,710,083 - 14,732,094 (-) NCBI T2T-CHM13v2.0
Pla2g10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 13,532,921 - 13,548,863 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 13,532,921 - 13,548,847 (-) Ensembl GRCm39 Ensembl GRCm38 16 13,715,057 - 13,731,094 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 13,715,057 - 13,730,983 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 13,715,155 - 13,730,678 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 13,628,640 - 13,644,163 (-) NCBI MGSCv36 mm8 Celera 16 14,319,504 - 14,335,040 (-) NCBI Celera Cytogenetic Map 16 A1 NCBI cM Map 16 9.5 NCBI
Pla2g10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 4,208,575 - 4,225,834 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 4,208,497 - 4,225,893 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100990946 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 15,204,875 - 15,232,910 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 18,987,730 - 19,015,721 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 13,600,152 - 13,622,629 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 15,021,025 - 15,043,782 (-) NCBI panpan1.1 PanPan1.1 panPan2
PLA2G10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 28,573,239 - 28,591,714 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 28,574,387 - 28,591,703 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 29,936,319 - 29,954,796 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 28,736,378 - 28,754,847 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 28,736,238 - 28,754,865 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 28,539,400 - 28,557,862 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 28,427,844 - 28,446,114 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 28,835,005 - 28,853,467 (+) NCBI UU_Cfam_GSD_1.0
LOC101960864 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 114,743,588 - 114,759,931 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936501 2,841,660 - 2,854,952 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936501 2,841,209 - 2,857,570 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LOC110259864
Pla2g10
.
Predicted Target Of
Count of predictions: 49 Count of miRNA genes: 48 Interacting mature miRNAs: 48 Transcripts: ENSRNOT00000004237 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
12
46
51
52
23
20
23
3
127
48
31
42
60
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004237 ⟹ ENSRNOP00000004237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 1,597,761 - 1,609,000 (-) Ensembl Rnor_6.0 Ensembl 10 1,509,732 - 1,520,970 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101842 ⟹ ENSRNOP00000092711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 1,597,761 - 1,606,701 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103030 ⟹ ENSRNOP00000080329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 1,598,246 - 1,609,000 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114578 ⟹ ENSRNOP00000093943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 1,597,761 - 1,607,200 (-) Ensembl
RefSeq Acc Id:
NM_017176 ⟹ NP_058872
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,172 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,007 (-) NCBI Rnor_6.0 10 1,509,732 - 1,520,970 (-) NCBI Rnor_5.0 10 406,661 - 417,899 (-) NCBI RGSC_v3.4 10 26,035 - 37,273 (-) RGD Celera 10 658,651 - 669,889 (-) RGD
Sequence:
CACGAGGCACGCTCCTATGTGTGGGCCACCTCTGTGACGGGCTATAATGCTGCTGCTACTGCTGCTGTTGCTACTGGGACCTGGATCCTGTCTCAGCGAAGCAACCAGGAGGTCACATGTGTACAAGC
hide sequence
RefSeq Acc Id:
XM_039085716 ⟹ XP_038941644
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,698 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,529 (-) NCBI
RefSeq Acc Id:
XM_039085719 ⟹ XP_038941647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,691 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,529 (-) NCBI
RefSeq Acc Id:
XM_039085721 ⟹ XP_038941649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,698 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,529 (-) NCBI
RefSeq Acc Id:
XM_039085722 ⟹ XP_038941650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,698 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,529 (-) NCBI
RefSeq Acc Id:
XM_039085724 ⟹ XP_038941652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,199 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,032 (-) NCBI
RefSeq Acc Id:
XM_039085726 ⟹ XP_038941654
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,199 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,040 (-) NCBI
RefSeq Acc Id:
XM_039085731 ⟹ XP_038941659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,182 (-) NCBI mRatBN7.2 10 1,597,761 - 1,609,021 (-) NCBI
RefSeq Acc Id:
XM_063268802 ⟹ XP_063124872
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,698 (-) NCBI
RefSeq Acc Id:
XM_063268803 ⟹ XP_063124873
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,117,998 (-) NCBI
RefSeq Acc Id:
XM_063268804 ⟹ XP_063124874
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,691 (-) NCBI
RefSeq Acc Id:
XM_063268805 ⟹ XP_063124875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,058 (-) NCBI
RefSeq Acc Id:
XM_063268807 ⟹ XP_063124877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,691 (-) NCBI
RefSeq Acc Id:
XM_063268808 ⟹ XP_063124878
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 2,104,927 - 2,116,079 (-) NCBI
RefSeq Acc Id:
NP_058872 ⟸ NM_017176
- Peptide Label:
precursor
- UniProtKB:
Q9QZT3 (UniProtKB/Swiss-Prot), G3V6E2 (UniProtKB/TrEMBL), A6K4E7 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLLLLLGPGSCLSEATRRSHVYKRGLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLAD
hide sequence
Ensembl Acc Id:
ENSRNOP00000004237 ⟸ ENSRNOT00000004237
RefSeq Acc Id:
XP_038941647 ⟸ XM_039085719
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941649 ⟸ XM_039085721
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941650 ⟸ XM_039085722
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941644 ⟸ XM_039085716
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941654 ⟸ XM_039085726
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941652 ⟸ XM_039085724
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038941659 ⟸ XM_039085731
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000092711 ⟸ ENSRNOT00000101842
Ensembl Acc Id:
ENSRNOP00000080329 ⟸ ENSRNOT00000103030
Ensembl Acc Id:
ENSRNOP00000093943 ⟸ ENSRNOT00000114578
RefSeq Acc Id:
XP_063124873 ⟸ XM_063268803
- Peptide Label:
isoform X1
- UniProtKB:
Q9QZT3 (UniProtKB/Swiss-Prot), A6K4E7 (UniProtKB/TrEMBL), G3V6E2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124872 ⟸ XM_063268802
- Peptide Label:
isoform X1
- UniProtKB:
Q9QZT3 (UniProtKB/Swiss-Prot), A6K4E7 (UniProtKB/TrEMBL), G3V6E2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124874 ⟸ XM_063268804
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063124877 ⟸ XM_063268807
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063124878 ⟸ XM_063268808
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063124875 ⟸ XM_063268805
- Peptide Label:
isoform X2
RGD ID: 13696926 Promoter ID: EPDNEW_R7451 Type: multiple initiation site Name: Pla2g10_1 Description: phospholipase A2, group X SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 1,520,977 - 1,521,037 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pla2g10
phospholipase A2, group X
phospholipase A2, group 10
Name updated
1299863 APPROVED
2002-06-10
Pla2g10
phospholipase A2, group 10
Name updated
70584 APPROVED
